Majority protein IDs Protein names Gene names Entry name Organism Gene ontology (biological process) Gene ontology (cellular component) Gene ontology (GO) Gene ontology (molecular function) Peptide sequences Q-value Healthy Infect Intensity healthy_BC6_01_25563 Intensity healthy_BC6_01_25564 Intensity healthy_BC6_01_25565 Intensity infect_BC7_01_25566 Intensity infect_BC7_01_25567 Intensity infect_BC7_01_25568 A0A2C9VCR7 Uncharacterized protein MANES_08G021900 A0A2C9VCR7_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] HLLDLVR 0.95448 9.01424 0 9.01424 0 0 0 0 0 A0A2C9V039 Uncharacterized protein MANES_11G062200 A0A2C9V039_MANES Manihot esculenta (Cassava) (Jatropha manihot) PVILPLPGAR 0.98305 9.17473 0 9.17473 0 0 0 0 0 A0A2C9U6S8 Uncharacterized protein MANES_17G072000 A0A2C9U6S8_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular membrane-bounded organelle [GO:0043231] intracellular membrane-bounded organelle [GO:0043231];serine-type endopeptidase activity [GO:0004252] serine-type endopeptidase activity [GO:0004252] EIPSPNGR 1.0008 9.86706 0 9.86706 0 0 0 0 0 A0A199UBF4 Homeobox domain-containing protein MANES_S031200 A0A199UBF4_MANES Manihot esculenta (Cassava) (Jatropha manihot) "positive regulation of transcription, DNA-templated [GO:0045893]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];sequence-specific DNA binding [GO:0043565];positive regulation of transcription, DNA-templated [GO:0045893]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];sequence-specific DNA binding [GO:0043565]" QLEKDYEILKK 0.95385 9.89788 0 9.89788 0 0 0 0 0 A0A2C9VZX3 Uncharacterized protein MANES_04G054700 A0A2C9VZX3_MANES Manihot esculenta (Cassava) (Jatropha manihot) triglyceride biosynthetic process [GO:0019432] plasma membrane [GO:0005886] plasma membrane [GO:0005886];diacylglycerol O-acyltransferase activity [GO:0004144];long-chain-alcohol O-fatty-acyltransferase activity [GO:0047196];triglyceride biosynthetic process [GO:0019432] diacylglycerol O-acyltransferase activity [GO:0004144];long-chain-alcohol O-fatty-acyltransferase activity [GO:0047196] VEMQIVVAKDIIPDPEFLAK 1.0059 9.96838 0 9.96838 0 0 0 0 0 A0A2C9VVN0 Peptidylprolyl isomerase (EC 5.2.1.8) PPIase MANES_05G125700 A0A2C9VVN0_MANES Manihot esculenta (Cassava) (Jatropha manihot) peptidyl-prolyl cis-trans isomerase activity [GO:0003755] peptidyl-prolyl cis-trans isomerase activity [GO:0003755] VGAPPGK 0.98217 10.1422 0 0 10.1422 0 0 0 0 A0A2C9W3S9 Uncharacterized protein MANES_03G015900 A0A2C9W3S9_MANES Manihot esculenta (Cassava) (Jatropha manihot) innate immune response [GO:0045087] membrane [GO:0016020] membrane [GO:0016020];ATP binding [GO:0005524];transmembrane receptor protein kinase activity [GO:0019199];innate immune response [GO:0045087] ATP binding [GO:0005524];transmembrane receptor protein kinase activity [GO:0019199] CVDPNLTCYHK 0.9532 10.1997 0 0 0 10.1997 0 0 0 A0A2C9UDJ7 CBFD_NFYB_HMF domain-containing protein MANES_15G060400 A0A2C9UDJ7_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of transcription by RNA polymerase II [GO:0006357] CCAAT-binding factor complex [GO:0016602] "CCAAT-binding factor complex [GO:0016602];DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein heterodimerization activity [GO:0046982];sequence-specific DNA binding [GO:0043565];regulation of transcription by RNA polymerase II [GO:0006357]" "DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein heterodimerization activity [GO:0046982];sequence-specific DNA binding [GO:0043565]" FLPIANVSRIMKK 0.95392 10.2586 0 0 10.2586 0 0 0 0 A0A0M4FLR6 NAC transcription factors 75 MANES_11G142800 A0A0M4FLR6_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" "DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] LLDAMVK 0.95563 10.2606 0 0 0 10.2606 0 0 0 A0A2C9V667 Uncharacterized protein MANES_10G140800 A0A2C9V667_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] TLIPGLAVASSRAK 0.97477 10.3793 0 0 10.3793 0 0 0 0 A0A2C9UTE5 Uncharacterized protein MANES_13G150300 A0A2C9UTE5_MANES Manihot esculenta (Cassava) (Jatropha manihot) KGGWRDVIVESALVDLYAK 0.9963 10.5279 0 10.5279 0 0 0 0 0 A0A2C9W7I7 DEK C-terminal domain-containing protein MANES_03G140900 A0A2C9W7I7_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin organization [GO:0006325];regulation of double-strand break repair [GO:2000779] nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];histone binding [GO:0042393];chromatin organization [GO:0006325];regulation of double-strand break repair [GO:2000779] DNA binding [GO:0003677];histone binding [GO:0042393] SSKSPSR 0.97612 10.5281 0 0 0 10.5281 0 0 0 A0A199UBX0 Uncharacterized protein MANES_S015600 A0A199UBX0_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid transport [GO:0006869] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];lipid binding [GO:0008289];lipid transport [GO:0006869] lipid binding [GO:0008289] AKINIEEVVEFFNNLYGEK 1.0098 10.5712 0 0 0 10.5712 0 0 0 A0A2C9U952 DNA-directed RNA polymerase subunit beta (EC 2.7.7.6) MANES_16G027100 A0A2C9U952_MANES Manihot esculenta (Cassava) (Jatropha manihot) "transcription, DNA-templated [GO:0006351]" "RNA polymerase II, core complex [GO:0005665]" "RNA polymerase II, core complex [GO:0005665];DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899];metal ion binding [GO:0046872];ribonucleoside binding [GO:0032549];transcription, DNA-templated [GO:0006351]" DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899];metal ion binding [GO:0046872];ribonucleoside binding [GO:0032549] PMMTESDGETATLFPK 0.99645 10.6813 0 0 10.6813 0 0 0 0 A0A2C9VD87 SET domain-containing protein MANES_08G040300 A0A2C9VD87_MANES Manihot esculenta (Cassava) (Jatropha manihot) histone lysine methylation [GO:0034968] nucleus [GO:0005634] nucleus [GO:0005634];histone-lysine N-methyltransferase activity [GO:0018024];histone lysine methylation [GO:0034968] histone-lysine N-methyltransferase activity [GO:0018024] CNCLRCMSGE 1.0109 10.736 0 10.736 0 0 0 0 0 A0A2C9VNP1 Uncharacterized protein MANES_06G073300 A0A2C9VNP1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] RWKPDNQA 0.96246 10.8652 0 0 10.8652 0 0 0 0 A0A2C9UPJ4 Uncharacterized protein MANES_13G032100 A0A2C9UPJ4_MANES Manihot esculenta (Cassava) (Jatropha manihot) EALVVFHEMIK 0.9976 10.9068 0 10.9068 0 0 0 0 0 A0A2C9WAT9 Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) MANES_02G045700 A0A2C9WAT9_MANES Manihot esculenta (Cassava) (Jatropha manihot) aromatic amino acid family biosynthetic process [GO:0009073];cellular amino acid biosynthetic process [GO:0008652];chorismate biosynthetic process [GO:0009423] chloroplast [GO:0009507] chloroplast [GO:0009507];3-deoxy-7-phosphoheptulonate synthase activity [GO:0003849];aromatic amino acid family biosynthetic process [GO:0009073];cellular amino acid biosynthetic process [GO:0008652];chorismate biosynthetic process [GO:0009423] 3-deoxy-7-phosphoheptulonate synthase activity [GO:0003849] VSDKMDPKELVK 0.95256 10.9392 0 0 0 10.9392 0 0 0 A0A2C9WF05 Uncharacterized protein MANES_02G180800 A0A2C9WF05_MANES Manihot esculenta (Cassava) (Jatropha manihot) GFTFHGHHVKK 0.98197 10.9477 0 10.9477 0 0 0 0 0 A0A2C9U1T1 DnaJ-X domain-containing protein MANES_18G085200 A0A2C9U1T1_MANES Manihot esculenta (Cassava) (Jatropha manihot) GAFQLLQLQEDIRKQFK 1 10.9575 0 10.9575 0 0 0 0 0 A0A2C9VND0 RING-type domain-containing protein MANES_06G063700 A0A2C9VND0_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567] ubiquitin protein ligase activity [GO:0061630];protein ubiquitination [GO:0016567] ubiquitin protein ligase activity [GO:0061630] DCFDGWLDHLNFNCPLCR 0.99564 10.9948 0 0 10.9948 0 0 0 0 A0A2C9VZC7 LNS2 domain-containing protein MANES_05G172400 A0A2C9VZC7_MANES Manihot esculenta (Cassava) (Jatropha manihot) LWPFPFRR 0.96973 11.0454 0 11.0454 0 0 0 0 0 A0A2C9WNH3 Poly [ADP-ribose] polymerase (PARP) (EC 2.4.2.-) MANES_01G220000 A0A2C9WNH3_MANES Manihot esculenta (Cassava) (Jatropha manihot) double-strand break repair [GO:0006302];protein poly-ADP-ribosylation [GO:0070212] nucleolus [GO:0005730] nucleolus [GO:0005730];NAD+ ADP-ribosyltransferase activity [GO:0003950];protein ADP-ribosylase activity [GO:1990404];double-strand break repair [GO:0006302];protein poly-ADP-ribosylation [GO:0070212] NAD+ ADP-ribosyltransferase activity [GO:0003950];protein ADP-ribosylase activity [GO:1990404] WGRVGVR 0.97723 11.0469 0 0 11.0469 0 0 0 0 A0A2C9WMY3 ABC-type xenobiotic transporter (EC 7.6.2.2) MANES_01G217900 A0A2C9WMY3_MANES Manihot esculenta (Cassava) (Jatropha manihot) transmembrane transport [GO:0055085] integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524];ATPase-coupled transmembrane transporter activity [GO:0042626];transmembrane transport [GO:0055085] ABC-type transporter activity [GO:0140359];ATPase-coupled transmembrane transporter activity [GO:0042626];ATP binding [GO:0005524] NNRFQFNVMINRDSR 0.97709 11.0773 0 0 0 11.0773 0 0 0 A0A2C9V5R5 Uricase (EC 1.7.3.3) (Urate oxidase) MANES_10G059900 A0A2C9V5R5_MANES Manihot esculenta (Cassava) (Jatropha manihot) purine nucleobase catabolic process [GO:0006145];urate catabolic process [GO:0019628] peroxisome [GO:0005777] peroxisome [GO:0005777];urate oxidase activity [GO:0004846];purine nucleobase catabolic process [GO:0006145];urate catabolic process [GO:0019628] urate oxidase activity [GO:0004846] LDQRHGK 0.96002 11.078 0 11.078 0 0 0 0 0 A0A2C9VBK7 HMA domain-containing protein MANES_09G164500 A0A2C9VBK7_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872] metal ion binding [GO:0046872] GGGGDGK 0.98238 11.1279 0 11.1279 0 0 0 0 0 A0A2C9VM44 FPL domain-containing protein MANES_06G018200 A0A2C9VM44_MANES Manihot esculenta (Cassava) (Jatropha manihot) anthocyanin-containing compound biosynthetic process [GO:0009718];cell fate specification [GO:0001708];endosomal transport [GO:0016197];endosome to lysosome transport [GO:0008333];flavonoid transport from endoplasmic reticulum to plant-type vacuole [GO:1903415];positive regulation of vacuole organization [GO:0044090];regulation of autophagosome maturation [GO:1901096] endolysosome membrane [GO:0036020];extrinsic component of membrane [GO:0019898];Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] endolysosome membrane [GO:0036020];extrinsic component of membrane [GO:0019898];Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];anthocyanin-containing compound biosynthetic process [GO:0009718];cell fate specification [GO:0001708];endosomal transport [GO:0016197];endosome to lysosome transport [GO:0008333];flavonoid transport from endoplasmic reticulum to plant-type vacuole [GO:1903415];positive regulation of vacuole organization [GO:0044090];regulation of autophagosome maturation [GO:1901096] EVDARLK 0.959 11.1423 0 0 0 11.1423 0 0 0 A0A2C9VJW0 Glycos_transf_1 domain-containing protein MANES_07G093200 A0A2C9VJW0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];glycosyltransferase activity [GO:0016757] glycosyltransferase activity [GO:0016757] LPILKDAYYR 0.95404 11.1447 0 0 11.1447 0 0 0 0 A0A2C9VNV3 Uncharacterized protein MANES_06G079500 A0A2C9VNV3_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of asymmetric cell division [GO:0009786] plasma membrane [GO:0005886] plasma membrane [GO:0005886];regulation of asymmetric cell division [GO:0009786] LDCSMSVDDSTSDNEK 1.0154 11.1567 0 0 11.1567 0 0 0 0 A0A2C9VU78 LEA_2 domain-containing protein MANES_05G028600 A0A2C9VU78_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] LLNIIKK 0.97018 11.1633 0 0 11.1633 0 0 0 0 A0A2C9VJ96 Uncharacterized protein MANES_07G018100 A0A2C9VJ96_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" DTIGAALVWFFWLVGTHPLVEK 1.0014 11.192 0 0 11.192 0 0 0 0 A0A2C9UIX9 Uncharacterized protein MANES_14G016400 A0A2C9UIX9_MANES Manihot esculenta (Cassava) (Jatropha manihot) DSDDNFLSNVEDTDEMFDDLFNKHGKVVFR 1.0049 11.2458 0 0 11.2458 0 0 0 0 A0A2C9WE23 FHA domain-containing protein MANES_02G100600 A0A2C9WE23_MANES Manihot esculenta (Cassava) (Jatropha manihot) Ino80 complex [GO:0031011];MLL1 complex [GO:0071339] Ino80 complex [GO:0031011];MLL1 complex [GO:0071339];G-quadruplex RNA binding [GO:0002151] G-quadruplex RNA binding [GO:0002151] ACRAELEPVVER 0.94843 11.2642 0 0 0 11.2642 0 0 0 A0A2C9UKE1 Non-specific serine/threonine protein kinase (EC 2.7.11.1) MANES_14G100300 A0A2C9UKE1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA cis splicing, via spliceosome [GO:0045292];peptidyl-serine phosphorylation [GO:0018105];peptidyl-threonine phosphorylation [GO:0018107]" "ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];mRNA cis splicing, via spliceosome [GO:0045292];peptidyl-serine phosphorylation [GO:0018105];peptidyl-threonine phosphorylation [GO:0018107]" ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] HCVRFLSSFK 0.97637 11.2671 0 0 11.2671 0 0 0 0 A0A2C9W384 F-box domain-containing protein MANES_04G093500 A0A2C9W384_MANES Manihot esculenta (Cassava) (Jatropha manihot) DDSWRKIDFCLNDWQLLCHK 1.009 11.3091 0 0 0 11.3091 0 0 0 A0A2C9WHN8 Probable 6-phosphogluconolactonase (EC 3.1.1.31) MANES_01G038600 A0A2C9WHN8_MANES Manihot esculenta (Cassava) (Jatropha manihot) "carbohydrate metabolic process [GO:0005975];pentose-phosphate shunt, oxidative branch [GO:0009051]" cytoplasm [GO:0005737] "cytoplasm [GO:0005737];6-phosphogluconolactonase activity [GO:0017057];carbohydrate metabolic process [GO:0005975];pentose-phosphate shunt, oxidative branch [GO:0009051]" 6-phosphogluconolactonase activity [GO:0017057] KLLEPPYIDSIEWSK 0.97941 11.3206 0 11.3206 0 0 0 0 0 A0A2C9V3U9 Uncharacterized protein MANES_10G059500 A0A2C9V3U9_MANES Manihot esculenta (Cassava) (Jatropha manihot) SGRKFVR 0.96163 11.3608 0 0 11.3608 0 0 0 0 A0A2C9UXX6 Ribosomal_L18e/L15P domain-containing protein MANES_12G150400 A0A2C9UXX6_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] mitochondrial large ribosomal subunit [GO:0005762] mitochondrial large ribosomal subunit [GO:0005762];mRNA binding [GO:0003729];structural constituent of ribosome [GO:0003735];translation [GO:0006412] mRNA binding [GO:0003729];structural constituent of ribosome [GO:0003735] KGRLLPK 0.96167 11.3644 0 0 11.3644 0 0 0 0 A0A2C9W8X5 Uncharacterized protein MANES_03G141900 A0A2C9W8X5_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleic acid binding [GO:0003676] nucleic acid binding [GO:0003676] PCVNVEVQVDDTR 0.95928 11.3722 0 0 11.3722 0 0 0 0 A0A2C9UB88 Cellulose synthase (EC 2.4.1.12) MANES_16G120400 A0A2C9UB88_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellulose biosynthetic process [GO:0030244];cell wall organization [GO:0071555];plant-type primary cell wall biogenesis [GO:0009833] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];cellulose synthase (UDP-forming) activity [GO:0016760];cellulose synthase activity [GO:0016759];metal ion binding [GO:0046872];cell wall organization [GO:0071555];cellulose biosynthetic process [GO:0030244];plant-type primary cell wall biogenesis [GO:0009833] cellulose synthase (UDP-forming) activity [GO:0016760];cellulose synthase activity [GO:0016759];metal ion binding [GO:0046872] DAYPLWLTSVICEIWFALSWLLDQFPK 1.0373 11.3954 0 0 11.3954 0 0 0 0 A0A2C9W5B7 Uncharacterized protein MANES_03G000100 A0A2C9W5B7_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] EDYFDEVEK 1.02 11.4079 0 11.4079 0 0 0 0 0 A0A2C9UVQ6 Uncharacterized protein MANES_12G116800 A0A2C9UVQ6_MANES Manihot esculenta (Cassava) (Jatropha manihot) GCTETGVAHR 0.98042 11.4616 0 11.4616 0 0 0 0 0 A0A2C9UTD6 Flavin-containing monooxygenase (EC 1.-.-.-) MANES_12G039800 A0A2C9UTD6_MANES Manihot esculenta (Cassava) (Jatropha manihot) "flavin adenine dinucleotide binding [GO:0050660];N,N-dimethylaniline monooxygenase activity [GO:0004499];NADP binding [GO:0050661]" "flavin adenine dinucleotide binding [GO:0050660];N,N-dimethylaniline monooxygenase activity [GO:0004499];NADP binding [GO:0050661]" GLSGASSDAMRIAQDIGK 1.0009 11.4912 0 0 11.4912 0 0 0 0 A0A2C9WDQ1 Uncharacterized protein (Fragment) MANES_02G053700 A0A2C9WDQ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrion [GO:0005739] mitochondrion [GO:0005739];metal ion binding [GO:0046872];metalloendopeptidase activity [GO:0004222] metal ion binding [GO:0046872];metalloendopeptidase activity [GO:0004222] ADCLDDLAWAIMYETTKLSYRVSEADVTR 0.40625 11.4916 0 0 0 11.4916 0 0 0 A0A2C9WH14 Uncharacterized protein MANES_02G161000 A0A2C9WH14_MANES Manihot esculenta (Cassava) (Jatropha manihot) TDIQVGDDTLPFFSVSLWQK 1.0167 11.5022 0 11.5022 0 0 0 0 0 A0A2C9UUN1 Uncharacterized protein MANES_12G078900 A0A2C9UUN1_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive regulation of telomerase activity [GO:0051973];ribosome biogenesis [GO:0042254] nucleus [GO:0005634] nucleus [GO:0005634];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];preribosome binding [GO:1990275];positive regulation of telomerase activity [GO:0051973];ribosome biogenesis [GO:0042254] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];preribosome binding [GO:1990275] VWSESFKTA 0.95427 11.5501 0 0 11.5501 0 0 0 0 A0A2C9V7Q0 DYW_deaminase domain-containing protein MANES_10G123700 A0A2C9V7Q0_MANES Manihot esculenta (Cassava) (Jatropha manihot) zinc ion binding [GO:0008270] zinc ion binding [GO:0008270] TDVIPWSFMIARYAQSNQSKEALELFCQMR 1.01 11.5637 0 0 11.5637 0 0 0 0 A0A2C9VRC7 Mur_ligase_M domain-containing protein MANES_06G157100 A0A2C9VRC7_MANES Manihot esculenta (Cassava) (Jatropha manihot) embryo development ending in seed dormancy [GO:0009793];folic acid-containing compound biosynthetic process [GO:0009396] cytoplasm [GO:0005737];cytosol [GO:0005829];mitochondrial matrix [GO:0005759];mitochondrion [GO:0005739] cytoplasm [GO:0005737];cytosol [GO:0005829];mitochondrial matrix [GO:0005759];mitochondrion [GO:0005739];ATP binding [GO:0005524];dihydrofolate synthase activity [GO:0008841];metal ion binding [GO:0046872];tetrahydrofolylpolyglutamate synthase activity [GO:0004326];embryo development ending in seed dormancy [GO:0009793];folic acid-containing compound biosynthetic process [GO:0009396] ATP binding [GO:0005524];dihydrofolate synthase activity [GO:0008841];metal ion binding [GO:0046872];tetrahydrofolylpolyglutamate synthase activity [GO:0004326] AFYADGSRTLSLR 0.5 11.5803 0 0 11.5803 0 0 0 0 A0A2C9UQS6 Rhamnogalacturonan endolyase (EC 4.2.2.23) MANES_13G102800 A0A2C9UQS6_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] extracellular region [GO:0005576] extracellular region [GO:0005576];carbohydrate binding [GO:0030246];rhamnogalacturonan endolyase activity [GO:0102210];carbohydrate metabolic process [GO:0005975] carbohydrate binding [GO:0030246];rhamnogalacturonan endolyase activity [GO:0102210] FHFMAVSDDRQR 0.95435 11.5869 0 11.5869 0 0 0 0 0 A0A2C9VJ45 Uncharacterized protein MANES_07G066300 A0A2C9VJ45_MANES Manihot esculenta (Cassava) (Jatropha manihot) "chromatin organization [GO:0006325];regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];chromatin binding [GO:0003682];DNA binding [GO:0003677];metal ion binding [GO:0046872];chromatin organization [GO:0006325];regulation of transcription, DNA-templated [GO:0006355]" chromatin binding [GO:0003682];DNA binding [GO:0003677];metal ion binding [GO:0046872] SHEKPKAPDSSINLPK 0.97963 11.5913 0 11.5913 0 0 0 0 0 A0A2C9WI22 RING-type domain-containing protein MANES_01G058900 A0A2C9WI22_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567] ubiquitin protein ligase activity [GO:0061630];protein ubiquitination [GO:0016567] ubiquitin protein ligase activity [GO:0061630] IPEFYSVSAVLIR 0.95729 11.6072 0 0 11.6072 0 0 0 0 A0A251J882 H(+)-exporting diphosphatase (EC 7.1.3.1) MANES_14G008800 A0A251J882_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];inorganic diphosphatase activity [GO:0004427];pyrophosphate hydrolysis-driven proton transmembrane transporter activity [GO:0009678] inorganic diphosphatase activity [GO:0004427];pyrophosphate hydrolysis-driven proton transmembrane transporter activity [GO:0009678] MMTHDDVEGGNLGHYQDRPR 1.0152 11.6325 0 0 0 11.6325 0 0 0 A0A2C9UEQ3 GLTP domain-containing protein MANES_15G042800 A0A2C9UEQ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) ceramide transport [GO:0035627];intermembrane lipid transfer [GO:0120009] cytosol [GO:0005829] cytosol [GO:0005829];ceramide 1-phosphate binding [GO:1902387];ceramide 1-phosphate transfer activity [GO:1902388];ceramide transport [GO:0035627];intermembrane lipid transfer [GO:0120009] ceramide 1-phosphate binding [GO:1902387];ceramide 1-phosphate transfer activity [GO:1902388] YSSDPTKYTHLYTMVQEEIDAKTAK 1.0207 11.666 0 0 0 11.666 0 0 0 A0A2C9VC80 Protein DETOXIFICATION (Multidrug and toxic compound extrusion protein) MANES_09G134800 A0A2C9VC80_MANES Manihot esculenta (Cassava) (Jatropha manihot) xenobiotic detoxification by transmembrane export across the plasma membrane [GO:1990961] integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];antiporter activity [GO:0015297];transmembrane transporter activity [GO:0022857];xenobiotic transmembrane transporter activity [GO:0042910];xenobiotic detoxification by transmembrane export across the plasma membrane [GO:1990961] antiporter activity [GO:0015297];transmembrane transporter activity [GO:0022857];xenobiotic transmembrane transporter activity [GO:0042910] TDWDEQVK 0.99414 11.6802 0 0 0 11.6802 0 0 0 A0A2C9V181 Uncharacterized protein MANES_11G100800 A0A2C9V181_MANES Manihot esculenta (Cassava) (Jatropha manihot) DRVVMER 0.97781 11.6842 0 11.6842 0 0 0 0 0 A0A2C9VGJ8 Uncharacterized protein MANES_08G109900 A0A2C9VGJ8_MANES Manihot esculenta (Cassava) (Jatropha manihot) AEVYHGDEICQEKTK 0.9801 11.6865 0 0 11.6865 0 0 0 0 A0A2C9UB44 GTP-binding nuclear protein MANES_16G119200 A0A2C9UB44_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleocytoplasmic transport [GO:0006913];protein transport [GO:0015031] nucleus [GO:0005634] nucleus [GO:0005634];GTP binding [GO:0005525];GTPase activity [GO:0003924];nucleocytoplasmic transport [GO:0006913];protein transport [GO:0015031] GTPase activity [GO:0003924];GTP binding [GO:0005525] LTYKNVPTWHRDLCR 0.97952 11.6879 0 0 11.6879 0 0 0 0 A0A2C9UFN5 Protein kinase domain-containing protein MANES_15G142700 A0A2C9UFN5_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];ATP binding [GO:0005524];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683];intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] ATP binding [GO:0005524];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683] AAIPEEGECESEDATGLDLDK 0.98599 11.7389 0 0 11.7389 0 0 0 0 A0A2C9WMC6 Uncharacterized protein MANES_01G203900 A0A2C9WMC6_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] TSFLLWK 0.95405 11.7392 0 0 11.7392 0 0 0 0 A0A2C9UDS0 BCAS3 domain-containing protein MANES_15G076800 A0A2C9UDS0_MANES Manihot esculenta (Cassava) (Jatropha manihot) autophagy [GO:0006914];response to starvation [GO:0042594] cytoplasm [GO:0005737] cytoplasm [GO:0005737];autophagy [GO:0006914];response to starvation [GO:0042594] HSRVPALDGNVNGQLR 0.98295 11.7515 0 0 0 11.7515 0 0 0 A0A2C9VUW1 GATA transcription factor MANES_05G050300 A0A2C9VUW1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "cell differentiation [GO:0030154];positive regulation of transcription, DNA-templated [GO:0045893]" nucleus [GO:0005634] "nucleus [GO:0005634];sequence-specific DNA binding [GO:0043565];zinc ion binding [GO:0008270];cell differentiation [GO:0030154];positive regulation of transcription, DNA-templated [GO:0045893]" sequence-specific DNA binding [GO:0043565];zinc ion binding [GO:0008270] TGPLGPK 0.96713 11.7768 0 11.7768 0 0 0 0 0 A0A2C9W3C8 Protein kinase domain-containing protein MANES_04G099300 A0A2C9W3C8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] SMEDEDPLFMQIMEATENLNDKYIVGK 1.0567 11.7903 0 0 0 11.7903 0 0 0 A0A2C9W478 Amino_oxidase domain-containing protein MANES_03G033700 A0A2C9W478_MANES Manihot esculenta (Cassava) (Jatropha manihot) oxidoreductase activity [GO:0016491];polyamine oxidase activity [GO:0046592] oxidoreductase activity [GO:0016491];polyamine oxidase activity [GO:0046592] TIAEGGCELNPSLVK 0.97811 11.8001 0 11.8001 0 0 0 0 0 A0A251JQQ8 Uncharacterized protein MANES_12G158300 A0A251JQQ8_MANES Manihot esculenta (Cassava) (Jatropha manihot) QKWKEACQFFVEMIER 0.98429 11.8379 0 11.8379 0 0 0 0 0 A0A2C9V3H5 Uncharacterized protein MANES_10G047900 A0A2C9V3H5_MANES Manihot esculenta (Cassava) (Jatropha manihot) EFEPRPNVSIYHNNIGLK 0.99479 11.8551 0 0 0 11.8551 0 0 0 A0A2C9WHH0 Uncharacterized protein MANES_02G215800 A0A2C9WHH0_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive regulation of GTPase activity [GO:0043547] cytoplasm [GO:0005737] cytoplasm [GO:0005737];GTPase activator activity [GO:0005096];positive regulation of GTPase activity [GO:0043547] GTPase activator activity [GO:0005096] FEADHISSQVPVKLMHLEGLYELFVSKFAYSTVDYAMR 1.0528 11.8685 0 0 11.8685 0 0 0 0 A0A2C9VZX4 Fmp27_GFWDK domain-containing protein MANES_05G189400 A0A2C9VZX4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] PKKVIEFHNIK 1.0065 11.8691 0 0 0 11.8691 0 0 0 A0A2C9VZH9 D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) MANES_05G177600 A0A2C9VZH9_MANES Manihot esculenta (Cassava) (Jatropha manihot) L-serine biosynthetic process [GO:0006564] chloroplast stroma [GO:0009570] chloroplast stroma [GO:0009570];NAD binding [GO:0051287];phosphoglycerate dehydrogenase activity [GO:0004617];L-serine biosynthetic process [GO:0006564] NAD binding [GO:0051287];phosphoglycerate dehydrogenase activity [GO:0004617] IVLDGSPEK 0.97677 11.8887 0 0 0 11.8887 0 0 0 A0A2C9U046 Uncharacterized protein MANES_18G005700 A0A2C9U046_MANES Manihot esculenta (Cassava) (Jatropha manihot) LLYWLMVVGYSIRNIEVR 0.9948 11.9049 0 11.9049 0 0 0 0 0 A0A2C9WH13 Uncharacterized protein MANES_01G025600 A0A2C9WH13_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive regulation of transcription by RNA polymerase II [GO:0045944];regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];positive regulation of transcription by RNA polymerase II [GO:0045944];regulation of transcription by RNA polymerase II [GO:0006357]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]" GKLFEYSTDSCMEKILER 1.0069 11.9062 0 0 11.9062 0 0 0 0 A0A2C9UUP5 Uncharacterized protein MANES_12G035800 A0A2C9UUP5_MANES Manihot esculenta (Cassava) (Jatropha manihot) KLVLKFR 0.96206 11.9189 0 11.9189 0 0 0 0 0 A0A2C9V1V8 BZIP domain-containing protein MANES_11G123600 A0A2C9V1V8_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700] DNA-binding transcription factor activity [GO:0003700] DKATGHGGGLPPPSGR 0.98688 11.9205 0 0 0 11.9205 0 0 0 A0A251JWN8 Uncharacterized protein MANES_13G035800 A0A251JWN8_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524] ATP binding [GO:0005524] LFEYQKVGVQWLWELHCQR 1.0038 11.9226 0 0 0 11.9226 0 0 0 A0A251JDZ4 Uncharacterized protein MANES_14G164300 A0A251JDZ4_MANES Manihot esculenta (Cassava) (Jatropha manihot) electron transport chain [GO:0022900];mitochondrial respiratory chain complex I assembly [GO:0032981] mitochondrial respiratory chain complex I [GO:0005747] mitochondrial respiratory chain complex I [GO:0005747];electron transport chain [GO:0022900];mitochondrial respiratory chain complex I assembly [GO:0032981] HPMVTNQFR 0.97851 11.9332 0 11.9332 0 0 0 0 0 A0A2C9VK92 Uncharacterized protein MANES_07G059700 A0A2C9VK92_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein transport [GO:0015031] vacuolar membrane [GO:0005774] vacuolar membrane [GO:0005774];GTP binding [GO:0005525];GTPase activity [GO:0003924];protein transport [GO:0015031] GTPase activity [GO:0003924];GTP binding [GO:0005525] EVCCFMISCKNSTNIDTVIDWLVK 0.75 11.9496 0 0 0 11.9496 0 0 0 A0A2C9U992 Serine/threonine protein phosphatase 2A regulatory subunit MANES_16G067900 A0A2C9U992_MANES Manihot esculenta (Cassava) (Jatropha manihot) signal transduction [GO:0007165] cytoplasm [GO:0005737];protein phosphatase type 2A complex [GO:0000159] cytoplasm [GO:0005737];protein phosphatase type 2A complex [GO:0000159];protein phosphatase regulator activity [GO:0019888];signal transduction [GO:0007165] protein phosphatase regulator activity [GO:0019888] KYIDHSFIVR 0.99498 11.9658 0 0 11.9658 0 0 0 0 A0A2C9ULY9 Uncharacterized protein MANES_14G148900 A0A2C9ULY9_MANES Manihot esculenta (Cassava) (Jatropha manihot) RGEAHEK 0.94959 11.9705 0 11.9705 0 0 0 0 0 A0A2C9UL07 ENTH domain-containing protein MANES_14G116700 A0A2C9UL07_MANES Manihot esculenta (Cassava) (Jatropha manihot) clathrin coat assembly [GO:0048268];clathrin-dependent endocytosis [GO:0072583];vesicle budding from membrane [GO:0006900] clathrin-coated pit [GO:0005905];clathrin-coated vesicle [GO:0030136];Golgi apparatus [GO:0005794] "clathrin-coated pit [GO:0005905];clathrin-coated vesicle [GO:0030136];Golgi apparatus [GO:0005794];1-phosphatidylinositol binding [GO:0005545];clathrin heavy chain binding [GO:0032050];phosphatidylinositol-4,5-bisphosphate binding [GO:0005546];SNARE binding [GO:0000149];clathrin coat assembly [GO:0048268];clathrin-dependent endocytosis [GO:0072583];vesicle budding from membrane [GO:0006900]" "1-phosphatidylinositol binding [GO:0005545];clathrin heavy chain binding [GO:0032050];phosphatidylinositol-4,5-bisphosphate binding [GO:0005546];SNARE binding [GO:0000149]" FMKIEQPPASFLQTMEEYVREAPR 1.0093 11.975 0 0 0 11.975 0 0 0 A0A2C9VEU5 Uncharacterized protein MANES_08G095100 A0A2C9VEU5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] VQLKDGTNLMQVTQQPL 1.0031 11.9823 0 11.9823 0 0 0 0 0 A0A2C9VUV0 Uncharacterized protein MANES_05G017400 A0A2C9VUV0_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] TLRCSLSETKNR 0.95039 12.0131 0 12.0131 0 0 0 0 0 A0A2C9VR74 Glutamate synthase (NADH) (EC 1.4.1.14) MANES_06G159400 A0A2C9VR74_MANES Manihot esculenta (Cassava) (Jatropha manihot) ammonia assimilation cycle [GO:0019676];glutamate biosynthetic process [GO:0006537];L-glutamate biosynthetic process [GO:0097054] "3 iron, 4 sulfur cluster binding [GO:0051538];flavin adenine dinucleotide binding [GO:0050660];FMN binding [GO:0010181];glutamate synthase (NADH) activity [GO:0016040];glutamate synthase activity [GO:0015930];iron ion binding [GO:0005506];oxidoreductase activity [GO:0016491];ammonia assimilation cycle [GO:0019676];glutamate biosynthetic process [GO:0006537];L-glutamate biosynthetic process [GO:0097054]" "3 iron, 4 sulfur cluster binding [GO:0051538];flavin adenine dinucleotide binding [GO:0050660];FMN binding [GO:0010181];glutamate synthase (NADH) activity [GO:0016040];glutamate synthase activity [GO:0015930];iron ion binding [GO:0005506];oxidoreductase activity [GO:0016491]" MMIQQHQRHTNSQLSR 0.98558 12.0281 0 0 0 12.0281 0 0 0 A0A2C9VJR3 Glutaredoxin domain-containing protein MANES_07G084800 A0A2C9VJR3_MANES Manihot esculenta (Cassava) (Jatropha manihot) glutathione oxidoreductase activity [GO:0097573] glutathione oxidoreductase activity [GO:0097573] IVEDDGLSRRCHDCNENGLIICPLCC 1 12.0437 0 0 0 12.0437 0 0 0 A0A2C9USG8 Uncharacterized protein MANES_12G006200 A0A2C9USG8_MANES Manihot esculenta (Cassava) (Jatropha manihot) ARLSTRCFDTK 0.95346 12.0479 0 12.0479 0 0 0 0 0 A0A2C9WES5 Uncharacterized protein MANES_02G124400 A0A2C9WES5_MANES Manihot esculenta (Cassava) (Jatropha manihot) ACKSSNGRLDSSTGLR 0.95012 12.0531 0 0 0 12.0531 0 0 0 A0A2C9UQE3 Uncharacterized protein MANES_13G060500 A0A2C9UQE3_MANES Manihot esculenta (Cassava) (Jatropha manihot) MLSREEWEEIR 0.95331 12.0741 0 12.0741 0 0 0 0 0 A0A2C9VCW4 ACPS domain-containing protein MANES_08G026600 A0A2C9VCW4_MANES Manihot esculenta (Cassava) (Jatropha manihot) holo-[acyl-carrier-protein] synthase activity [GO:0008897];magnesium ion binding [GO:0000287] holo-[acyl-carrier-protein] synthase activity [GO:0008897];magnesium ion binding [GO:0000287] TFTIHVK 0.97977 12.084 0 0 12.084 0 0 0 0 A0A2C9V4D7 Btz domain-containing protein MANES_10G081700 A0A2C9V4D7_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA processing [GO:0006397];mRNA transport [GO:0051028];nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184];regulation of translation [GO:0006417];RNA splicing [GO:0008380]" cytoplasm [GO:0005737];exon-exon junction complex [GO:0035145] "cytoplasm [GO:0005737];exon-exon junction complex [GO:0035145];mRNA binding [GO:0003729];mRNA processing [GO:0006397];mRNA transport [GO:0051028];nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184];regulation of translation [GO:0006417];RNA splicing [GO:0008380]" mRNA binding [GO:0003729] NPRHSDRYER 0.95337 12.0969 0 0 0 12.0969 0 0 0 A0A2C9WPD4 Uncharacterized protein MANES_01G263800 A0A2C9WPD4_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive regulation of transcription by RNA polymerase II [GO:0045944];regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];positive regulation of transcription by RNA polymerase II [GO:0045944];regulation of transcription by RNA polymerase II [GO:0006357]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]" CCFNPRDNSIER 0.94923 12.1179 0 12.1179 0 0 0 0 0 A0A2C9UIR1 Protein kinase domain-containing protein MANES_14G038000 A0A2C9UIR1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] GLDHLHTGLQKTVIHGNLK 1.0019 12.131 0 12.131 0 0 0 0 0 A0A2C9VFG5 PPM-type phosphatase domain-containing protein MANES_08G114600 A0A2C9VFG5_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytosol [GO:0005829];nucleus [GO:0005634] cytosol [GO:0005829];nucleus [GO:0005634];phosphatase activity [GO:0016791] phosphatase activity [GO:0016791] RLVESAAHAWK 0.95159 12.1548 0 0 0 12.1548 0 0 0 A0A2C9UJY3 Uncharacterized protein MANES_14G077600 A0A2C9UJY3_MANES Manihot esculenta (Cassava) (Jatropha manihot) LINILCR 0.9555 12.1679 0 0 0 12.1679 0 0 0 A0A2C9UGB3 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) MANES_15G148200 A0A2C9UGB3_MANES Manihot esculenta (Cassava) (Jatropha manihot) CDP-diacylglycerol biosynthetic process [GO:0016024] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];1-acylglycerol-3-phosphate O-acyltransferase activity [GO:0003841];CDP-diacylglycerol biosynthetic process [GO:0016024] 1-acylglycerol-3-phosphate O-acyltransferase activity [GO:0003841] MYLWNLAWR 0.97688 12.1876 0 12.1876 0 0 0 0 0 A0A2C9UTN4 Uncharacterized protein MANES_12G045400 A0A2C9UTN4_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin organization [GO:0006325] NuA4 histone acetyltransferase complex [GO:0035267] NuA4 histone acetyltransferase complex [GO:0035267];chromatin organization [GO:0006325] FDKETCEELEMQNAGK 0.98624 12.1999 0 0 0 12.1999 0 0 0 A0A2C9WGD8 AAA domain-containing protein MANES_02G215300 A0A2C9WGD8_MANES Manihot esculenta (Cassava) (Jatropha manihot) ADP binding [GO:0043531] ADP binding [GO:0043531] HHQISRK 0.97705 12.219 0 12.219 0 0 0 0 0 A0A2C9UT79 "ADP/ATP translocase (ADP,ATP carrier protein)" MANES_13G144600 A0A2C9UT79_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial ADP transmembrane transport [GO:0140021];mitochondrial ATP transmembrane transport [GO:1990544] integral component of membrane [GO:0016021];mitochondrial inner membrane [GO:0005743] integral component of membrane [GO:0016021];mitochondrial inner membrane [GO:0005743];ATP:ADP antiporter activity [GO:0005471];mitochondrial ADP transmembrane transport [GO:0140021];mitochondrial ATP transmembrane transport [GO:1990544] ATP:ADP antiporter activity [GO:0005471] YGSGGGG 0.98221 12.2196 0 12.2196 0 11.9492 0 0 0 A0A2C9VCZ1 Uncharacterized protein MANES_09G176500 A0A2C9VCZ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) YTNFTLDNHMDR 0.99725 12.2197 0 0 12.2197 0 0 0 0 A0A2C9W909 Uncharacterized protein MANES_03G196200 A0A2C9W909_MANES Manihot esculenta (Cassava) (Jatropha manihot) ILERFLQQSDNK 0.9524 12.2392 0 12.2392 0 0 0 0 0 A0A2C9WMW7 t-SNARE coiled-coil homology domain-containing protein (Fragment) MANES_01G136800 A0A2C9WMW7_MANES Manihot esculenta (Cassava) (Jatropha manihot) biosynthetic process [GO:0009058];exocytosis [GO:0006887];intracellular protein transport [GO:0006886];vesicle docking [GO:0048278];vesicle fusion [GO:0006906] endomembrane system [GO:0012505];integral component of membrane [GO:0016021];plasma membrane [GO:0005886];SNARE complex [GO:0031201] endomembrane system [GO:0012505];integral component of membrane [GO:0016021];plasma membrane [GO:0005886];SNARE complex [GO:0031201];catalytic activity [GO:0003824];SNAP receptor activity [GO:0005484];SNARE binding [GO:0000149];biosynthetic process [GO:0009058];exocytosis [GO:0006887];intracellular protein transport [GO:0006886];vesicle docking [GO:0048278];vesicle fusion [GO:0006906] catalytic activity [GO:0003824];SNAP receptor activity [GO:0005484];SNARE binding [GO:0000149] INRRTSELYK 0.95257 12.2758 0 0 12.2758 0 0 0 0 A0A2C9VUS3 DUF1338 domain-containing protein MANES_05G096800 A0A2C9VUS3_MANES Manihot esculenta (Cassava) (Jatropha manihot) EELRFPVKK 0.95438 12.3087 0 0 12.3087 0 0 0 0 A0A2C9UN82 RRM domain-containing protein MANES_13G020000 A0A2C9UN82_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA splicing, via spliceosome [GO:0000398]" nuclear speck [GO:0016607] "nuclear speck [GO:0016607];mRNA binding [GO:0003729];RNA binding [GO:0003723];mRNA splicing, via spliceosome [GO:0000398]" mRNA binding [GO:0003729];RNA binding [GO:0003723] CNVGYGFVNMTSPQATWR 0.99727 12.3111 0 12.3111 0 0 0 0 0 A0A2C9V1X5 Importin N-terminal domain-containing protein MANES_11G097900 A0A2C9V1X5_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein import into nucleus [GO:0006606] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];nuclear import signal receptor activity [GO:0061608];nuclear localization sequence binding [GO:0008139];small GTPase binding [GO:0031267];protein import into nucleus [GO:0006606] nuclear import signal receptor activity [GO:0061608];nuclear localization sequence binding [GO:0008139];small GTPase binding [GO:0031267] SQIWQQLQHYSQFPDFNNYLVFILTR 1.0351 12.3129 0 0 12.3129 11.9355 0 0 0 A0A2C9UHP7 LRRNT_2 domain-containing protein MANES_14G020000 A0A2C9UHP7_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] GIQCSNQTGHITVLDLHVAELGDRNKPLR 1.0526 12.3297 0 12.3297 0 0 0 0 0 A0A2C9V695 NLE domain-containing protein MANES_10G139000 A0A2C9V695_MANES Manihot esculenta (Cassava) (Jatropha manihot) ribosomal large subunit assembly [GO:0000027] nucleolus [GO:0005730] nucleolus [GO:0005730];ribosomal large subunit assembly [GO:0000027] AGELQCWDPQTGK 1.0211 12.3312 0 12.3312 0 0 0 0 0 A0A2C9WKL5 Protein kinase domain-containing protein MANES_01G096300 A0A2C9WKL5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672];receptor serine/threonine kinase binding [GO:0033612] ATP binding [GO:0005524];protein kinase activity [GO:0004672];receptor serine/threonine kinase binding [GO:0033612] FIQERSTRAVDWR 0.95489 12.3349 0 12.3349 0 0 0 0 0 A0A2C9VKF2 Protein kinase domain-containing protein MANES_07G108000 A0A2C9VKF2_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] VSHGAAK 0.96759 12.3357 0 0 0 12.3357 0 0 0 A0A2C9WMT9 Uncharacterized protein MANES_01G133700 A0A2C9WMT9_MANES Manihot esculenta (Cassava) (Jatropha manihot) ISASEFHQGDKSK 0.96989 12.3381 0 0 12.3381 0 0 0 0 A0A2C9VMM1 Uncharacterized protein MANES_07G115300 A0A2C9VMM1_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677] DNA binding [GO:0003677] DGWKKFVQENHLEVGDVCVFELINR 1.0246 12.3392 0 0 0 12.3392 0 0 0 A0A199UBM1 Uncharacterized protein (Fragment) MANES_S051300 A0A199UBM1_MANES Manihot esculenta (Cassava) (Jatropha manihot) diterpenoid biosynthetic process [GO:0016102];gibberellin biosynthetic process [GO:0009686];hydrocarbon biosynthetic process [GO:0120251] chloroplast [GO:0009507] chloroplast [GO:0009507];magnesium ion binding [GO:0000287];terpene synthase activity [GO:0010333];diterpenoid biosynthetic process [GO:0016102];gibberellin biosynthetic process [GO:0009686];hydrocarbon biosynthetic process [GO:0120251] magnesium ion binding [GO:0000287];terpene synthase activity [GO:0010333] ARLQQGRCIK 0.95297 12.3425 0 12.3425 0 0 0 0 0 A0A2C9VF60 Uncharacterized protein MANES_08G105300 A0A2C9VF60_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872] metal ion binding [GO:0046872] DNWHAMLRDPRLHFFSWR 1.0026 12.3497 0 12.3497 0 0 0 0 0 A0A2C9UJC5 Isochorismate synthase (EC 5.4.4.2) MANES_14G075200 A0A2C9UJC5_MANES Manihot esculenta (Cassava) (Jatropha manihot) phylloquinone biosynthetic process [GO:0042372] plastid [GO:0009536] plastid [GO:0009536];isochorismate synthase activity [GO:0008909];phylloquinone biosynthetic process [GO:0042372] isochorismate synthase activity [GO:0008909] IEAIDWLHAQHQLLPRCFFSSK 0.98182 12.354 0 12.354 0 0 0 0 0 A0A2C9VLN2 Protein kinase domain-containing protein MANES_06G007900 A0A2C9VLN2_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] SSGYESR 0.95475 12.3595 0 0 0 12.3595 0 0 0 A0A2C9WJ95 Uncharacterized protein MANES_01G050000 A0A2C9WJ95_MANES Manihot esculenta (Cassava) (Jatropha manihot) aspartic-type endopeptidase activity [GO:0004190] aspartic-type endopeptidase activity [GO:0004190] IQADKEKIK 0.95598 12.36 0 0 12.36 0 0 0 0 A0A2C9WFV0 Uncharacterized protein MANES_02G132600 A0A2C9WFV0_MANES Manihot esculenta (Cassava) (Jatropha manihot) LLLKIPSIKK 0.95261 12.3676 0 12.3676 0 0 0 0 0 A0A2C9WKG6 HABP4_PAI-RBP1 domain-containing protein MANES_01G086200 A0A2C9WKG6_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];RNA binding [GO:0003723] RNA binding [GO:0003723] RALLSTK 0.95251 12.3734 0 11.3572 12.3734 0 0 0 0 A0A2C9UUY9 PMR5N domain-containing protein MANES_12G025800 A0A2C9UUY9_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];O-acetyltransferase activity [GO:0016413] O-acetyltransferase activity [GO:0016413] PDDGFVK 0.97918 12.3899 0 0 12.3899 0 0 0 0 A0A2C9W242 Uncharacterized protein MANES_04G129400 A0A2C9W242_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytosol [GO:0005829] cytosol [GO:0005829];glyoxylate reductase (NADP+) activity [GO:0030267];hydroxypyruvate reductase activity [GO:0016618];NAD binding [GO:0051287] glyoxylate reductase (NADP+) activity [GO:0030267];hydroxypyruvate reductase activity [GO:0016618];NAD binding [GO:0051287] DVIDALGPK 0.97679 12.3938 0 12.3938 0 0 0 0 0 A0A2C9URP3 NB-ARC domain-containing protein MANES_13G133600 A0A2C9URP3_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] LVNLRHLYCEGCSSLTHMPRGLGQLTLLQTLSR 0.96396 12.4052 0 12.4052 0 0 0 0 0 A0A2C9W690 SP-RING-type domain-containing protein MANES_03G104900 A0A2C9W690_MANES Manihot esculenta (Cassava) (Jatropha manihot) double-strand break repair via homologous recombination [GO:0000724];germ-line stem-cell niche homeostasis [GO:0060250];negative regulation of DNA endoreduplication [GO:0032876];positive regulation of cell population proliferation [GO:0008284];positive regulation of cytokinin-activated signaling pathway [GO:0080038];positive regulation of mitotic cell cycle [GO:0045931];protein sumoylation [GO:0016925];regulation of meristem development [GO:0048509];regulation of root meristem growth [GO:0010082] nucleus [GO:0005634];Smc5-Smc6 complex [GO:0030915] nucleus [GO:0005634];Smc5-Smc6 complex [GO:0030915];SUMO ligase activity [GO:0061665];zinc ion binding [GO:0008270];double-strand break repair via homologous recombination [GO:0000724];germ-line stem-cell niche homeostasis [GO:0060250];negative regulation of DNA endoreduplication [GO:0032876];positive regulation of cell population proliferation [GO:0008284];positive regulation of cytokinin-activated signaling pathway [GO:0080038];positive regulation of mitotic cell cycle [GO:0045931];protein sumoylation [GO:0016925];regulation of meristem development [GO:0048509];regulation of root meristem growth [GO:0010082] SUMO ligase activity [GO:0061665];zinc ion binding [GO:0008270] HGGAAGR 0.9821 12.4094 0 0 12.4094 0 0 0 0 A0A2C9VSH4 L-gulonolactone oxidase (EC 1.1.3.8) MANES_05G017300 A0A2C9VSH4_MANES Manihot esculenta (Cassava) (Jatropha manihot) L-ascorbic acid biosynthetic process [GO:0019853] membrane [GO:0016020] "membrane [GO:0016020];D-arabinono-1,4-lactone oxidase activity [GO:0003885];FAD binding [GO:0071949];L-gulonolactone oxidase activity [GO:0050105];oxidoreductase activity [GO:0016491];L-ascorbic acid biosynthetic process [GO:0019853]" "D-arabinono-1,4-lactone oxidase activity [GO:0003885];FAD binding [GO:0071949];L-gulonolactone oxidase activity [GO:0050105];oxidoreductase activity [GO:0016491]" ARVCSFIGK 0.95559 12.4119 0 0 0 12.4119 0 0 0 A0A2C9V7A7 Uncharacterized protein MANES_10G136900 A0A2C9V7A7_MANES Manihot esculenta (Cassava) (Jatropha manihot) FHPKTFSLQILNK 0.95786 12.4165 0 0 12.4165 0 0 0 0 A0A2C9VT57 Protein kinase domain-containing protein MANES_06G151900 A0A2C9VT57_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein autophosphorylation [GO:0046777] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674];protein autophosphorylation [GO:0046777] ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] IDDETLDIWLR 0.99595 12.4244 0 0 0 12.4244 0 0 0 A0A2C9UBD9 RING-type domain-containing protein MANES_16G072900 A0A2C9UBD9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] HAFHKNCIDQWLQNHSSCPLCRYK 1.0125 12.4476 0 12.4476 0 11.2356 0 0 0 A0A251LN22 Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12) MANES_01G056100 A0A251LN22_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein deubiquitination [GO:0016579];ubiquitin-dependent protein catabolic process [GO:0006511] thiol-dependent deubiquitinase [GO:0004843];protein deubiquitination [GO:0016579];ubiquitin-dependent protein catabolic process [GO:0006511] thiol-dependent deubiquitinase [GO:0004843] ASLHELYERVCTLRGTER 1.0069 12.4483 0 0 0 12.4483 0 0 0 A0A2C9VF48 Auxin response factor MANES_08G102200 A0A2C9VF48_MANES Manihot esculenta (Cassava) (Jatropha manihot) "auxin-activated signaling pathway [GO:0009734];regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA binding [GO:0003677];auxin-activated signaling pathway [GO:0009734];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] WDETSPIHRPEK 0.95288 12.4511 0 12.4511 0 0 0 0 0 B1NWD9 "30S ribosomal protein S2, chloroplastic" rps2 RR2_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] chloroplast [GO:0009507];small ribosomal subunit [GO:0015935] chloroplast [GO:0009507];small ribosomal subunit [GO:0015935];structural constituent of ribosome [GO:0003735];translation [GO:0006412] structural constituent of ribosome [GO:0003735] ARCHYVNK 0.96306 12.4549 0 0 0 12.4549 0 0 0 A0A251LHB0 Uncharacterized protein MANES_04G070100 A0A251LHB0_MANES Manihot esculenta (Cassava) (Jatropha manihot) ARKLFDEMPK 0.96505 12.4576 0 0 12.4576 0 0 0 0 A0A2C9VVV0 Uncharacterized protein MANES_05G058300 A0A2C9VVV0_MANES Manihot esculenta (Cassava) (Jatropha manihot) SHKEVGVGLVGFHK 0.97758 12.4581 0 12.4581 0 0 0 0 0 A0A2C9UN68 Uncharacterized protein MANES_14G161700 A0A2C9UN68_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular protein transport [GO:0006886];vesicle-mediated transport [GO:0016192] Golgi apparatus [GO:0005794] Golgi apparatus [GO:0005794];GTP binding [GO:0005525];GTPase activity [GO:0003924];intracellular protein transport [GO:0006886];vesicle-mediated transport [GO:0016192] GTPase activity [GO:0003924];GTP binding [GO:0005525] DEFHAILEEEELR 1.0117 12.4647 0 0 12.4647 0 0 0 0 A0A2C9VTX7 Uncharacterized protein MANES_05G066200 A0A2C9VTX7_MANES Manihot esculenta (Cassava) (Jatropha manihot) "chloroplast organization [GO:0009658];developmental process [GO:0032502];DNA-templated transcription, termination [GO:0006353];regulation of transcription, DNA-templated [GO:0006355]" chloroplast [GO:0009507] "chloroplast [GO:0009507];double-stranded DNA binding [GO:0003690];chloroplast organization [GO:0009658];developmental process [GO:0032502];DNA-templated transcription, termination [GO:0006353];regulation of transcription, DNA-templated [GO:0006355]" double-stranded DNA binding [GO:0003690] FEEEVPELLSIYEGK 0.9769 12.4655 0 12.4655 0 0 0 0 0 A0A2C9VVW2 Uncharacterized protein (Fragment) MANES_05G085700 A0A2C9VVW2_MANES Manihot esculenta (Cassava) (Jatropha manihot) ribosomal small subunit assembly [GO:0000028];translation [GO:0006412] cytosolic small ribosomal subunit [GO:0022627] cytosolic small ribosomal subunit [GO:0022627];RNA binding [GO:0003723];structural constituent of ribosome [GO:0003735];ribosomal small subunit assembly [GO:0000028];translation [GO:0006412] RNA binding [GO:0003723];structural constituent of ribosome [GO:0003735] HGRPGIGATHSSR 0.97094 12.4812 0 12.4812 0 0 0 0 0 A0A2C9W2D4 Uncharacterized protein MANES_04G092000 A0A2C9W2D4_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial phosphate ion transmembrane transport [GO:1990547];phosphate ion transmembrane transport [GO:0035435] integral component of mitochondrial inner membrane [GO:0031305] integral component of mitochondrial inner membrane [GO:0031305];inorganic phosphate transmembrane transporter activity [GO:0005315];mitochondrial phosphate ion transmembrane transport [GO:1990547];phosphate ion transmembrane transport [GO:0035435] inorganic phosphate transmembrane transporter activity [GO:0005315] GLGDGLPK 0.99664 12.4826 0 12.4826 0 0 0 0 0 A0A2C9WND5 DYW_deaminase domain-containing protein MANES_01G231600 A0A2C9WND5_MANES Manihot esculenta (Cassava) (Jatropha manihot) zinc ion binding [GO:0008270] zinc ion binding [GO:0008270] VNGGSGK 0.97988 12.506 0 0 12.506 0 0 0 0 A0A2C9WCF5 Uncharacterized protein MANES_02G097800 A0A2C9WCF5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] RRTHLVQSFSVVFLYWFYVFS 0.978 12.5111 0 12.5111 0 0 0 0 0 A0A2C9WD61 MFS domain-containing protein MANES_02G122000 A0A2C9WD61_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];monosaccharide transmembrane transporter activity [GO:0015145];symporter activity [GO:0015293] monosaccharide transmembrane transporter activity [GO:0015145];symporter activity [GO:0015293] MLDLSQGEDAAAGGGGSGGGDFPAKLTK 1.0619 12.5169 0 0 0 12.5169 0 0 0 A0A2C9WG20 ARC6-like_IMS domain-containing protein MANES_02G218300 A0A2C9WG20_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast fission [GO:0010020] chloroplast [GO:0009507];integral component of membrane [GO:0016021];plastid inner membrane [GO:0009528] chloroplast [GO:0009507];integral component of membrane [GO:0016021];plastid inner membrane [GO:0009528];protein self-association [GO:0043621];chloroplast fission [GO:0010020] protein self-association [GO:0043621] LLFEPEYAGNVR 0.94786 12.5319 0 0 12.5319 0 0 0 0 A0A2C9VY55 Uncharacterized protein MANES_05G160500 A0A2C9VY55_MANES Manihot esculenta (Cassava) (Jatropha manihot) NHSGPSK 0.97738 12.5392 0 0 12.5392 0 0 0 0 A0A2C9UVZ3 Uncharacterized protein MANES_12G125600 A0A2C9UVZ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672];ubiquitin-protein transferase activity [GO:0004842] ATP binding [GO:0005524];protein kinase activity [GO:0004672];ubiquitin-protein transferase activity [GO:0004842] RIEFCKEK 0.96248 12.5556 0 0 12.5556 0 0 0 0 A0A2C9US66 Uncharacterized protein MANES_13G150900 A0A2C9US66_MANES Manihot esculenta (Cassava) (Jatropha manihot) folic acid binding [GO:0005542];transferase activity [GO:0016740] folic acid binding [GO:0005542];transferase activity [GO:0016740] PSLDSCPLK 1.0068 12.5581 0 0 12.5581 0 0 0 0 A0A2C9VXX6 Uncharacterized protein MANES_05G128400 A0A2C9VXX6_MANES Manihot esculenta (Cassava) (Jatropha manihot) DFECSPK 0.95555 12.5623 0 0 0 12.5623 0 0 0 A0A2C9VQ31 Pectate lyase (EC 4.2.2.2) MANES_06G113200 A0A2C9VQ31_MANES Manihot esculenta (Cassava) (Jatropha manihot) pectin catabolic process [GO:0045490] metal ion binding [GO:0046872];pectate lyase activity [GO:0030570];pectin catabolic process [GO:0045490] metal ion binding [GO:0046872];pectate lyase activity [GO:0030570] SEGDLLVNGAFFTASGAGASSSYAKASSLSAR 0.94898 12.566 0 12.566 0 0 0 0 0 A0A2C9WGE8 Uncharacterized protein MANES_02G177100 A0A2C9WGE8_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872] metal ion binding [GO:0046872] VSESSNHTRR 0.75 12.5799 0 0 0 12.5799 0 0 0 A0A2C9V1N4 Uncharacterized protein MANES_11G155600 A0A2C9V1N4_MANES Manihot esculenta (Cassava) (Jatropha manihot) plant organ development [GO:0099402] chloroplast membrane [GO:0031969];integral component of membrane [GO:0016021] chloroplast membrane [GO:0031969];integral component of membrane [GO:0016021];plant organ development [GO:0099402] YCTMLRNR 0.96265 12.5825 0 0 0 12.5825 0 0 0 A0A199UAH2 Uncharacterized protein MANES_S060500 A0A199UAH2_MANES Manihot esculenta (Cassava) (Jatropha manihot) LAEIMHWQKLVEHIIYHNYMPWRNSLIGLA 1.0152 12.5827 0 0 0 12.5827 0 0 0 A0A140H8N3 WRKY transcription factor 29 A0A140H8N3_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] HVERASHDTK 0.95493 12.5873 0 0 0 12.5873 0 0 0 A0A2C9VIU1 Uncharacterized protein MANES_07G003500 A0A2C9VIU1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" DPELWDNPNEFYPEKFLHEEENQKK 1.0207 12.5961 0 12.5961 0 0 0 0 0 A0A2C9VHZ2 Uncharacterized protein MANES_07G029800 A0A2C9VHZ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] ILIILLLNI 1.0014 12.5968 0 12.5968 0 0 0 0 0 A0A251LCQ4 BFN domain-containing protein MANES_05G155800 A0A251LCQ4_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567] nucleus [GO:0005634];VCB complex [GO:0030891] nucleus [GO:0005634];VCB complex [GO:0030891];nuclease activity [GO:0004518];protein ubiquitination [GO:0016567] nuclease activity [GO:0004518] ECVSFDLR 1.0034 12.6026 0 0 12.6026 0 0 0 0 A0A2C9U805 Receptor-like serine/threonine-protein kinase (EC 2.7.11.1) MANES_16G018200 A0A2C9U805_MANES Manihot esculenta (Cassava) (Jatropha manihot) recognition of pollen [GO:0048544] ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];recognition of pollen [GO:0048544] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] GTPWPCGR 1 12.6043 0 12.6043 0 0 0 0 0 A0A2C9UIC8 Exostosin domain-containing protein MANES_14G032100 A0A2C9UIC8_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein glycosylation [GO:0006486];xyloglucan biosynthetic process [GO:0009969] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021];galactosyltransferase activity [GO:0008378];protein glycosylation [GO:0006486];xyloglucan biosynthetic process [GO:0009969] galactosyltransferase activity [GO:0008378] VLESYSKEDVR 0.95333 12.6098 0 12.6098 0 0 0 0 0 A0A2C9VV31 Uncharacterized protein MANES_05G108300 A0A2C9VV31_MANES Manihot esculenta (Cassava) (Jatropha manihot) extracellular space [GO:0005615] extracellular space [GO:0005615] QPPSCASFPHKTTSR 0.98009 12.6106 0 0 0 12.6106 0 0 0 A0A2C9V386 Uncharacterized protein MANES_10G004100 A0A2C9V386_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231] integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231] TSSNFGK 0.98058 12.6189 0 0 12.6189 0 0 0 0 A0A2C9VKD5 WAT1-related protein MANES_07G110000 A0A2C9VKD5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] QMVMKIFKWLHELK 0.97661 12.6292 0 0 0 12.6292 0 0 0 A0A2C9V3Z1 Phospholipid-transporting ATPase (EC 7.6.2.1) MANES_10G072200 A0A2C9V3Z1_MANES Manihot esculenta (Cassava) (Jatropha manihot) phospholipid translocation [GO:0045332] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];ATPase-coupled intramembrane lipid transporter activity [GO:0140326];magnesium ion binding [GO:0000287];phospholipid translocation [GO:0045332] ATPase-coupled intramembrane lipid transporter activity [GO:0140326];ATP binding [GO:0005524];magnesium ion binding [GO:0000287] LNTMPFYR 0.95257 12.6587 0 0 0 12.6587 0 0 0 A0A2C9UBB3 Uncharacterized protein MANES_16G094700 A0A2C9UBB3_MANES Manihot esculenta (Cassava) (Jatropha manihot) MPEKNIIKFPASEVETHNR 0.99721 12.6604 0 0 12.6604 0 0 0 0 A0A2C9UVN0 NAB domain-containing protein MANES_12G126100 A0A2C9UVN0_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin binding [GO:0003779] actin binding [GO:0003779] NLTAEDNSLAESK 1.017 12.6647 0 0 0 12.6647 0 0 0 A0A2C9UHY2 Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase (EC 2.7.4.21) (EC 2.7.4.24) MANES_15G175400 A0A2C9UHY2_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytosol [GO:0005829] "cytosol [GO:0005829];5-diphosphoinositol pentakisphosphate 3-kinase activity [GO:0102092];ATP binding [GO:0005524];diphosphoinositol-pentakisphosphate kinase activity [GO:0033857];inositol heptakisphosphate kinase activity [GO:0000829];inositol hexakisphosphate 1-kinase activity [GO:0052723];inositol hexakisphosphate 3-kinase activity [GO:0052724];inositol hexakisphosphate 5-kinase activity [GO:0000832];inositol-1,3,4,5,6-pentakisphosphate kinase activity [GO:0000827]" "5-diphosphoinositol pentakisphosphate 3-kinase activity [GO:0102092];ATP binding [GO:0005524];diphosphoinositol-pentakisphosphate kinase activity [GO:0033857];inositol-1,3,4,5,6-pentakisphosphate kinase activity [GO:0000827];inositol heptakisphosphate kinase activity [GO:0000829];inositol hexakisphosphate 1-kinase activity [GO:0052723];inositol hexakisphosphate 3-kinase activity [GO:0052724];inositol hexakisphosphate 5-kinase activity [GO:0000832]" LDPKYANVK 0.95466 12.6685 0 0 0 12.6685 0 0 0 A0A2C9UL51 Protein kinase domain-containing protein MANES_14G138500 A0A2C9UL51_MANES Manihot esculenta (Cassava) (Jatropha manihot) signal transduction [GO:0007165] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674];signal transduction [GO:0007165] ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] SLMERCWASEPSDR 0.9759 12.7006 0 0 12.7006 0 0 0 0 A0A2C9WL96 ELYS domain-containing protein MANES_01G084200 A0A2C9WL96_MANES Manihot esculenta (Cassava) (Jatropha manihot) "negative regulation of transcription, DNA-templated [GO:0045892];response to cold [GO:0009409];vegetative to reproductive phase transition of meristem [GO:0010228]" cytoplasm [GO:0005737];nucleus [GO:0005634] "cytoplasm [GO:0005737];nucleus [GO:0005634];ubiquitin-protein transferase activity [GO:0004842];negative regulation of transcription, DNA-templated [GO:0045892];response to cold [GO:0009409];vegetative to reproductive phase transition of meristem [GO:0010228]" ubiquitin-protein transferase activity [GO:0004842] CAWEDWVEVLVTEICCLCVK 1.0156 12.707 0 0 12.707 0 0 0 0 A0A2C9U5Y2 "(1->3)-beta-glucan endohydrolase (EC 3.2.1.39) (Beta-1,3-endoglucanase)" MANES_17G070500 A0A2C9U5Y2_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] anchored component of plasma membrane [GO:0046658] "anchored component of plasma membrane [GO:0046658];glucan endo-1,3-beta-D-glucosidase activity [GO:0042973];carbohydrate metabolic process [GO:0005975]" "glucan endo-1,3-beta-D-glucosidase activity [GO:0042973]" APFWINAYPYFAYK 0.97871 12.7118 0 0 0 12.7118 0 0 0 A0A2C9UB49 Uncharacterized protein MANES_16G093300 A0A2C9UB49_MANES Manihot esculenta (Cassava) (Jatropha manihot) EIDDSNEWLMGQMQEELNR 0.95916 12.7119 0 0 0 12.7119 0 0 0 A0A2C9WEE3 PH domain-containing protein MANES_02G159800 A0A2C9WEE3_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytosol [GO:0005829];intracellular membrane-bounded organelle [GO:0043231];membrane [GO:0016020] cytosol [GO:0005829];intracellular membrane-bounded organelle [GO:0043231];membrane [GO:0016020];sterol binding [GO:0032934];sterol transporter activity [GO:0015248] sterol binding [GO:0032934];sterol transporter activity [GO:0015248] LYCDHYGTMRIEGNREYSCK 1.012 12.7355 0 0 0 12.7355 0 0 0 A0A2C9VYT1 Uncharacterized protein MANES_05G148200 A0A2C9VYT1_MANES Manihot esculenta (Cassava) (Jatropha manihot) NCERFDPPK 0.95563 12.7707 0 12.7707 0 0 0 0 0 A0A2C9UT56 Uncharacterized protein MANES_12G040100 A0A2C9UT56_MANES Manihot esculenta (Cassava) (Jatropha manihot) FAGSGAK 0.97868 12.772 0 0 0 12.772 0 0 0 A0A2C9VFT9 Auxin_resp domain-containing protein MANES_08G128900 A0A2C9VFT9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355];response to hormone [GO:0009725]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355];response to hormone [GO:0009725]" DNA binding [GO:0003677] YIKVQWDKPSTFFPER 0.98034 12.773 0 12.773 0 0 0 0 0 A0A2C9WLL3 Carboxypeptidase (EC 3.4.16.-) MANES_01G095900 A0A2C9WLL3_MANES Manihot esculenta (Cassava) (Jatropha manihot) extracellular region [GO:0005576] extracellular region [GO:0005576];serine-type carboxypeptidase activity [GO:0004185] serine-type carboxypeptidase activity [GO:0004185] PRAALQLFK 0.95588 12.7759 0 0 0 12.7759 0 0 0 A0A2C9UQS7 SpoU_methylase domain-containing protein MANES_13G101800 A0A2C9UQS7_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA processing [GO:0006396] RNA binding [GO:0003723];RNA methyltransferase activity [GO:0008173];RNA processing [GO:0006396] RNA binding [GO:0003723];RNA methyltransferase activity [GO:0008173] FTLPAHVKSITSTSNPFVK 1.0029 12.7775 0 0 12.7775 0 0 0 0 A0A2C9W5A3 LRRNT_2 domain-containing protein MANES_03G071700 A0A2C9W5A3_MANES Manihot esculenta (Cassava) (Jatropha manihot) CPGGDRIL 0.96322 12.7844 0 0 0 12.7844 0 0 0 A0A2C9U6D6 Uncharacterized protein MANES_17G084500 A0A2C9U6D6_MANES Manihot esculenta (Cassava) (Jatropha manihot) YEEDDDEK 0.95027 12.8077 0 0 0 12.8077 0 0 0 A0A2C9V7J3 Uncharacterized protein MANES_10G143200 A0A2C9V7J3_MANES Manihot esculenta (Cassava) (Jatropha manihot) DLCVPPLEICSR 0.94788 12.8189 0 0 12.8189 0 0 0 0 A0A2C9WNA0 Methyltransferase (EC 2.1.1.-) MANES_01G186200 A0A2C9WNA0_MANES Manihot esculenta (Cassava) (Jatropha manihot) methylation [GO:0032259] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231];methyltransferase activity [GO:0008168];methylation [GO:0032259] methyltransferase activity [GO:0008168] RAMTFPRENMIYR 0.95657 12.8347 0 12.8347 0 0 0 0 0 A0A2C9VTY0 "ADP/ATP translocase (ADP,ATP carrier protein)" MANES_06G166100 A0A2C9VTY0_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial ADP transmembrane transport [GO:0140021];mitochondrial ATP transmembrane transport [GO:1990544] integral component of membrane [GO:0016021];mitochondrial inner membrane [GO:0005743] integral component of membrane [GO:0016021];mitochondrial inner membrane [GO:0005743];ATP:ADP antiporter activity [GO:0005471];mitochondrial ADP transmembrane transport [GO:0140021];mitochondrial ATP transmembrane transport [GO:1990544] ATP:ADP antiporter activity [GO:0005471] KYGSGGA 0.95595 12.8457 0 0 12.8457 0 0 0 0 A0A2C9U9J2 Uncharacterized protein MANES_16G035300 A0A2C9U9J2_MANES Manihot esculenta (Cassava) (Jatropha manihot) GSGDWFK 0.98106 12.8481 0 0 12.8481 0 0 0 0 A0A2C9VD82 Uncharacterized protein MANES_08G039500 A0A2C9VD82_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634] DLPTTFSFK 0.96158 12.8515 0 0 0 12.8515 0 0 0 A0A2C9WBD9 SANT domain-containing protein MANES_02G064100 A0A2C9WBD9_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA-binding transcription factor activity [GO:0003700] DNA-binding transcription factor activity [GO:0003700] DTPDRWSNIAK 0.95419 12.8564 0 12.8564 0 0 0 0 0 A0A2C9UTL3 Uncharacterized protein MANES_12G009900 A0A2C9UTL3_MANES Manihot esculenta (Cassava) (Jatropha manihot) endoplasmic reticulum unfolded protein response [GO:0030968];protein glycosylation [GO:0006486];protein transport [GO:0015031] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021];endoplasmic reticulum unfolded protein response [GO:0030968];protein glycosylation [GO:0006486];protein transport [GO:0015031] TATSGGMA 1.0017 12.8642 0 12.8642 0 0 0 0 0 A0A2C9UNH4 Uncharacterized protein MANES_14G170800 A0A2C9UNH4_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] defense response [GO:0006952] HGCIFDASGR 0.98309 12.8655 0 12.8655 0 0 0 0 0 A0A2C9VK52 Uncharacterized protein MANES_07G098800 A0A2C9VK52_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid transport [GO:0006869] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021];lipid binding [GO:0008289];metal ion binding [GO:0046872];lipid transport [GO:0006869] lipid binding [GO:0008289];metal ion binding [GO:0046872] DVEVRPLQELDSDTLQDILPEIPLWVKCPDYER 0.9633 12.8895 0 0 12.8895 0 0 0 0 A0A2C9UYH0 Receptor-like serine/threonine-protein kinase (EC 2.7.11.1) MANES_11G045600 A0A2C9UYH0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] LIGCCIQREEK 0.95327 12.8994 0 0 0 12.8994 0 0 0 A0A251IPT4 Uncharacterized protein MANES_18G036800 A0A251IPT4_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast accumulation movement [GO:0009904];chloroplast avoidance movement [GO:0009903] cytosol [GO:0005829] cytosol [GO:0005829];chloroplast accumulation movement [GO:0009904];chloroplast avoidance movement [GO:0009903] RTHADIELAK 0.99351 12.9005 0 0 12.9005 0 0 0 0 A0A2C9VTI1 Uncharacterized protein MANES_05G051400 A0A2C9VTI1_MANES Manihot esculenta (Cassava) (Jatropha manihot) EEKTASEYSNR 0.95461 12.9069 0 0 12.9069 0 0 0 0 A0A2C9WI48 "Starch synthase, chloroplastic/amyloplastic (EC 2.4.1.-)" MANES_01G055700 A0A2C9WI48_MANES Manihot esculenta (Cassava) (Jatropha manihot) starch biosynthetic process [GO:0019252] amyloplast [GO:0009501];chloroplast [GO:0009507] amyloplast [GO:0009501];chloroplast [GO:0009507];glycogen (starch) synthase activity [GO:0004373];starch biosynthetic process [GO:0019252] glycogen (starch) synthase activity [GO:0004373] SSFETQIEQLEVQYPDK 1.0008 12.9119 0 12.9119 0 0 0 0 0 A0A2C9WDH6 Autophagy protein 5 MANES_02G080800 A0A2C9WDH6_MANES Manihot esculenta (Cassava) (Jatropha manihot) autophagosome assembly [GO:0000045];autophagy of mitochondrion [GO:0000422];autophagy of nucleus [GO:0044804];cellular response to nitrogen starvation [GO:0006995];C-terminal protein lipidation [GO:0006501] Atg12-Atg5-Atg16 complex [GO:0034274];phagophore assembly site membrane [GO:0034045] Atg12-Atg5-Atg16 complex [GO:0034274];phagophore assembly site membrane [GO:0034045];autophagosome assembly [GO:0000045];autophagy of mitochondrion [GO:0000422];autophagy of nucleus [GO:0044804];C-terminal protein lipidation [GO:0006501];cellular response to nitrogen starvation [GO:0006995] AGKIPVR 0.98018 12.912 0 12.912 0 0 0 0 0 A0A2C9V6W7 Uncharacterized protein MANES_10G121500 A0A2C9V6W7_MANES Manihot esculenta (Cassava) (Jatropha manihot) KLIEIDPK 0.97079 12.9129 0 12.9129 0 0 0 0 0 A0A2C9UED9 Uncharacterized protein MANES_15G058600 A0A2C9UED9_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast accumulation movement [GO:0009904];chloroplast avoidance movement [GO:0009903] cytosol [GO:0005829] cytosol [GO:0005829];chloroplast accumulation movement [GO:0009904];chloroplast avoidance movement [GO:0009903] EGQNASDSTK 0.95868 12.9131 0 12.9131 0 0 0 0 0 A0A2C9UY99 Uncharacterized protein MANES_11G039200 A0A2C9UY99_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] NWAIEAMPTFLLLKRGQLLDK 0.98056 12.9179 0 12.9179 0 0 0 0 0 A0A2C9UG70 Fn3_like domain-containing protein MANES_15G119100 A0A2C9UG70_MANES Manihot esculenta (Cassava) (Jatropha manihot) arabinan catabolic process [GO:0031222];xylan catabolic process [GO:0045493] extracellular region [GO:0005576] "extracellular region [GO:0005576];alpha-L-arabinofuranosidase activity [GO:0046556];xylan 1,4-beta-xylosidase activity [GO:0009044];arabinan catabolic process [GO:0031222];xylan catabolic process [GO:0045493]" "alpha-L-arabinofuranosidase activity [GO:0046556];xylan 1,4-beta-xylosidase activity [GO:0009044]" VSSCCKHFAAYDVDNWK 1.0023 12.9193 0 0 12.9193 0 0 0 0 A0A2C9UKK8 Uncharacterized protein MANES_14G119300 A0A2C9UKK8_MANES Manihot esculenta (Cassava) (Jatropha manihot) SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146] SCF ubiquitin ligase complex [GO:0019005] SCF ubiquitin ligase complex [GO:0019005];SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146] WLGTSLPR 1 12.9321 0 0 12.9321 0 0 0 0 A0A251J6Y7 2Fe-2S ferredoxin-type domain-containing protein MANES_15G169000 A0A251J6Y7_MANES Manihot esculenta (Cassava) (Jatropha manihot) iron-sulfur cluster binding [GO:0051536] iron-sulfur cluster binding [GO:0051536] YFARGPIER 0.95417 12.9342 0 0 12.9342 0 0 0 0 A0A2C9UYF8 Uncharacterized protein MANES_11G044800 A0A2C9UYF8_MANES Manihot esculenta (Cassava) (Jatropha manihot) HSNSRREEK 1.0612 12.936 0 0 0 12.936 0 0 0 A0A2C9UL20 Uncharacterized protein MANES_14G087600 A0A2C9UL20_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" MVLHPDIQAK 0.95968 12.9398 0 0 0 12.9398 0 0 0 A0A2C9W8I7 Uncharacterized protein MANES_03G129000 A0A2C9W8I7_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA repair [GO:0006281] DNA repair [GO:0006281] SSCTLLQDDNDDGYFQPR 0.99738 12.9712 0 0 12.9712 0 0 0 0 A0A2C9UUZ2 Ribosomal_TL5_C domain-containing protein MANES_12G093600 A0A2C9UUZ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] cytosolic large ribosomal subunit [GO:0022625] cytosolic large ribosomal subunit [GO:0022625];5S rRNA binding [GO:0008097];structural constituent of ribosome [GO:0003735];translation [GO:0006412] 5S rRNA binding [GO:0008097];structural constituent of ribosome [GO:0003735] LLSKNEELPICK 0.94869 12.9804 0 0 12.9804 0 0 0 0 A0A2C9UFC0 AAA domain-containing protein MANES_15G093400 A0A2C9UFC0_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] ECYRSNGKAWR 0.95303 12.9813 0 12.9813 0 0 0 0 0 A0A2C9WBU1 H15 domain-containing protein MANES_02G076600 A0A2C9WBU1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "chromosome condensation [GO:0030261];negative regulation of DNA recombination [GO:0045910];nucleosome assembly [GO:0006334];nucleosome positioning [GO:0016584];regulation of transcription, DNA-templated [GO:0006355]" nucleolus [GO:0005730];nucleosome [GO:0000786];nucleus [GO:0005634] "nucleolus [GO:0005730];nucleosome [GO:0000786];nucleus [GO:0005634];double-stranded DNA binding [GO:0003690];methyltransferase activity [GO:0008168];nucleosomal DNA binding [GO:0031492];chromosome condensation [GO:0030261];negative regulation of DNA recombination [GO:0045910];nucleosome assembly [GO:0006334];nucleosome positioning [GO:0016584];regulation of transcription, DNA-templated [GO:0006355]" double-stranded DNA binding [GO:0003690];methyltransferase activity [GO:0008168];nucleosomal DNA binding [GO:0031492] PTGGMSGTTATTTVVMASGTGR 0.98307 12.9824 0 0 12.9824 0 0 0 0 A0A2C9V1F8 Uncharacterized protein MANES_11G096800 A0A2C9V1F8_MANES Manihot esculenta (Cassava) (Jatropha manihot) HSPNKARQESK 0.95298 12.9835 0 0 12.9835 0 0 0 0 A0A2C9W7U0 Uncharacterized protein MANES_03G155600 A0A2C9W7U0_MANES Manihot esculenta (Cassava) (Jatropha manihot) NWSFSGLNSSFLVEQMREER 1.0131 12.9927 0 0 0 12.9927 0 0 0 A0A2C9UR29 AP2/ERF domain-containing protein MANES_13G120400 A0A2C9UR29_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] GDGTVDGDR 0.98795 12.9942 0 12.9942 0 0 0 0 0 A0A2C9V7H9 Phosphatidylserine decarboxylase proenzyme 2 (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase 2 beta chain;Phosphatidylserine decarboxylase 2 alpha chain] PSD2 MANES_10G117200 A0A2C9V7H9_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphatidylethanolamine biosynthetic process [GO:0006646];protein autoprocessing [GO:0016540] membrane [GO:0016020] membrane [GO:0016020];calcium ion binding [GO:0005509];phosphatidylserine decarboxylase activity [GO:0004609];phosphatidylethanolamine biosynthetic process [GO:0006646];protein autoprocessing [GO:0016540] calcium ion binding [GO:0005509];phosphatidylserine decarboxylase activity [GO:0004609] LSEWAHFSK 0.97963 12.9965 0 12.9965 0 0 0 0 0 A0A2C9V564 40S ribosomal protein S6 MANES_10G105000 A0A2C9V564_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] ribosome [GO:0005840] ribosome [GO:0005840];structural constituent of ribosome [GO:0003735];translation [GO:0006412] structural constituent of ribosome [GO:0003735] KLEVDDDQKLR 0.95311 12.9986 0 0 0 12.9986 0 0 0 A0A2C9UMS2 Uncharacterized protein MANES_14G117300 A0A2C9UMS2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] EALNPWRNHDAEARK 0.9783 13.0146 0 13.0146 0 0 0 0 0 A0A2C9W3V8 VARLMGL domain-containing protein MANES_03G022200 A0A2C9W3V8_MANES Manihot esculenta (Cassava) (Jatropha manihot) LMGLEDIPSKK 0.41935 13.0153 0 0 0 13.0153 0 0 0 A0A2C9VC65 C3H1-type domain-containing protein MANES_08G001900 A0A2C9VC65_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasmic translation [GO:0002181] cytosol [GO:0005829] cytosol [GO:0005829];DNA binding [GO:0003677];metal ion binding [GO:0046872];cytoplasmic translation [GO:0002181] DNA binding [GO:0003677];metal ion binding [GO:0046872] IVEDKTFGLK 0.95347 13.0178 0 0 13.0178 0 0 0 0 A0A2C9WFN4 Uncharacterized protein MANES_02G204400 A0A2C9WFN4_MANES Manihot esculenta (Cassava) (Jatropha manihot) RAIVGRCR 0.96998 13.0287 0 0 0 13.0287 0 0 0 A0A2C9WPG1 Uncharacterized protein MANES_01G218500 A0A2C9WPG1_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];DNA binding [GO:0003677];metal ion binding [GO:0046872];mRNA binding [GO:0003729];RNA binding [GO:0003723] ATP binding [GO:0005524];DNA binding [GO:0003677];metal ion binding [GO:0046872];mRNA binding [GO:0003729];RNA binding [GO:0003723] GILVFLPTYRDLEQQWCLLKPLSSCFK 1.0477 13.036 0 13.036 0 0 0 0 0 A0A2C9US06 Uncharacterized protein MANES_13G105200 A0A2C9US06_MANES Manihot esculenta (Cassava) (Jatropha manihot) "histone exchange [GO:0043486];nucleosome assembly [GO:0006334];regulation of chromatin assembly [GO:0010847];regulation of transcription, DNA-templated [GO:0006355]" nucleolus [GO:0005730] "nucleolus [GO:0005730];DNA binding [GO:0003677];histone binding [GO:0042393];histone exchange [GO:0043486];nucleosome assembly [GO:0006334];regulation of chromatin assembly [GO:0010847];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677];histone binding [GO:0042393] KPIPPIK 0.96891 13.0502 0 0 0 13.0502 0 0 0 A0A2C9VA86 Uncharacterized protein MANES_09G078100 A0A2C9VA86_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoskeleton organization [GO:0007010] microtubule binding [GO:0008017];cytoskeleton organization [GO:0007010] microtubule binding [GO:0008017] RISELNEEK 0.97866 13.0538 0 0 13.0538 0 0 0 0 A0A2C9VFZ1 Aldo_ket_red domain-containing protein MANES_08G133700 A0A2C9VFZ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] cytoplasm [GO:0005737];aldo-keto reductase (NADP) activity [GO:0004033];D-threo-aldose 1-dehydrogenase activity [GO:0047834] aldo-keto reductase (NADP) activity [GO:0004033];D-threo-aldose 1-dehydrogenase activity [GO:0047834] AEEQRLVIPKVK 0.9527 13.0562 0 0 13.0562 0 0 0 0 A0A2C9USE4 Uncharacterized protein MANES_13G125800 A0A2C9USE4_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] "cytoplasm [GO:0005737];intramolecular transferase activity, phosphotransferases [GO:0016868];phosphatase activity [GO:0016791]" "intramolecular transferase activity, phosphotransferases [GO:0016868];phosphatase activity [GO:0016791]" AESPSVSESNPR 0.99725 13.0583 0 13.0583 0 0 0 0 0 A0A2C9UJD1 Uncharacterized protein MANES_14G063500 A0A2C9UJD1_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleoside diphosphate catabolic process [GO:0009134] integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];ATP binding [GO:0005524];nucleoside-diphosphatase activity [GO:0017110];nucleoside diphosphate catabolic process [GO:0009134] ATP binding [GO:0005524];nucleoside-diphosphatase activity [GO:0017110] GEQLCLESWDDSSNISRTQNYFGQYCFR 1.0623 13.0597 0 13.0597 0 0 0 0 0 A0A2C9UQ12 Uncharacterized protein MANES_13G047600 A0A2C9UQ12_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] HLSSLNVPCR 0.98625 13.0603 0 0 13.0603 0 0 0 0 A0A2C9WNK4 RNA helicase (EC 3.6.4.13) MANES_01G223000 A0A2C9WNK4_MANES Manihot esculenta (Cassava) (Jatropha manihot) "maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000462]" nucleolus [GO:0005730] "nucleolus [GO:0005730];ATP binding [GO:0005524];hydrolase activity [GO:0016787];RNA binding [GO:0003723];RNA helicase activity [GO:0003724];maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000462]" ATP binding [GO:0005524];hydrolase activity [GO:0016787];RNA binding [GO:0003723];RNA helicase activity [GO:0003724] HVREDSMDFSPASCPHDSTKASDLMGK 1.0457 13.0622 0 0 0 13.0622 0 0 0 B2M1Y0 Homogentisate phytyltransferase VTE2 B2M1Y0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];prenyltransferase activity [GO:0004659] prenyltransferase activity [GO:0004659] TWNVLERHYFAK 0.95027 13.0664 0 13.0664 0 0 0 0 0 A0A2C9VZY3 C2H2-type domain-containing protein MANES_04G012700 A0A2C9VZY3_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to acidic pH [GO:0010447];response to aluminum ion [GO:0010044] response to acidic pH [GO:0010447];response to aluminum ion [GO:0010044] HCGELKWQCSCGTTFSR 0.99922 13.0717 0 0 0 13.0717 0 0 0 A0A2C9W5V0 Kinesin-like protein MANES_03G090900 A0A2C9W5V0_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] microtubule [GO:0005874] microtubule [GO:0005874];ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777] RALEEFK 0.94949 13.0831 0 0 0 13.0831 0 0 0 A0A2C9UEA4 Uncharacterized protein MANES_15G083000 A0A2C9UEA4_MANES Manihot esculenta (Cassava) (Jatropha manihot) DHNVSKDR 0.96182 13.0902 0 0 0 13.0902 0 0 0 A0A2C9UTG8 Peptidylprolyl isomerase (EC 5.2.1.8) MANES_12G050700 A0A2C9UTG8_MANES Manihot esculenta (Cassava) (Jatropha manihot) chaperone-mediated protein folding [GO:0061077];protein peptidyl-prolyl isomerization [GO:0000413] cytoplasm [GO:0005737] cytoplasm [GO:0005737];peptidyl-prolyl cis-trans isomerase activity [GO:0003755];chaperone-mediated protein folding [GO:0061077];protein peptidyl-prolyl isomerization [GO:0000413] peptidyl-prolyl cis-trans isomerase activity [GO:0003755] KGHDSEDDLFEFK 0.97806 13.094 0 0 0 13.094 0 0 0 A0A251LD65 "(1->3)-beta-glucan endohydrolase (EC 3.2.1.39) (Beta-1,3-endoglucanase)" MANES_05G192000 A0A251LD65_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] "glucan endo-1,3-beta-D-glucosidase activity [GO:0042973];carbohydrate metabolic process [GO:0005975]" "glucan endo-1,3-beta-D-glucosidase activity [GO:0042973]" PTSGVEDENTKLVYTNMLDEQIDAVFSAMK 1.0049 13.0985 0 0 12.6688 13.0985 0 0 0 A0A2C9VPL2 Uncharacterized protein MANES_06G020600 A0A2C9VPL2_MANES Manihot esculenta (Cassava) (Jatropha manihot) GCCFSCR 0.98282 13.1031 0 13.1031 0 0 0 0 0 A0A2C9WA22 UBA domain-containing protein MANES_03G146600 A0A2C9WA22_MANES Manihot esculenta (Cassava) (Jatropha manihot) IEGDEFLFLPR 0.96132 13.1216 0 0 0 13.1216 0 0 0 A0A251L962 RING-type domain-containing protein MANES_05G055200 A0A251L962_MANES Manihot esculenta (Cassava) (Jatropha manihot) ubiquitin protein ligase activity [GO:0061630] ubiquitin protein ligase activity [GO:0061630] EESMGSCPVCRKVFHVK 1.0031 13.1221 0 0 0 13.1221 0 0 0 A0A2C9VJS4 ABC transporter domain-containing protein MANES_07G034600 A0A2C9VJS4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524] ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524] SHASFLNQCVVLTRR 0.97386 13.1227 0 0 13.1227 0 0 0 0 A0A2C9VI43 Uncharacterized protein MANES_07G028800 A0A2C9VI43_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672];ubiquitin-protein transferase activity [GO:0004842] ATP binding [GO:0005524];protein kinase activity [GO:0004672];ubiquitin-protein transferase activity [GO:0004842] VTDLIPFLNSR 0.99515 13.1244 0 0 13.1244 0 0 0 0 A0A2C9UIP1 O-fucosyltransferase family protein MANES_14G053500 A0A2C9UIP1_MANES Manihot esculenta (Cassava) (Jatropha manihot) fucose metabolic process [GO:0006004] cytoplasm [GO:0005737];integral component of membrane [GO:0016021] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];transferase activity [GO:0016740];fucose metabolic process [GO:0006004] transferase activity [GO:0016740] AYVGHWK 0.95503 13.1249 0 0 13.1249 0 0 0 0 A0A251KW28 Uncharacterized protein MANES_05G118900 A0A251KW28_MANES Manihot esculenta (Cassava) (Jatropha manihot) FFGLESKLK 0.95696 13.1296 0 0 0 13.1296 0 0 0 A0A251IUX5 F-box_5 domain-containing protein MANES_17G056300 A0A251IUX5_MANES Manihot esculenta (Cassava) (Jatropha manihot) FHGICRGIDAR 0.95245 13.132 0 0 13.132 0 0 0 0 A0A2C9W443 Uncharacterized protein MANES_03G030300 A0A2C9W443_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasmic translation [GO:0002181] cytosolic large ribosomal subunit [GO:0022625] cytosolic large ribosomal subunit [GO:0022625];structural constituent of ribosome [GO:0003735];cytoplasmic translation [GO:0002181] structural constituent of ribosome [GO:0003735] LHGCTFK 0.98214 13.1353 0 13.1353 0 0 0 0 0 A0A2C9V3P0 Uncharacterized protein MANES_10G063000 A0A2C9V3P0_MANES Manihot esculenta (Cassava) (Jatropha manihot) MAVSAFK 0.97849 13.1363 0 0 0 13.1363 0 0 0 A0A2C9US16 Protein kinase domain-containing protein MANES_13G106200 A0A2C9US16_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] PLPPCSR 0.97933 13.1407 0 0 13.1407 0 0 0 0 A0A2C9UGA3 CRM domain-containing protein MANES_15G151600 A0A2C9UGA3_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] DVHRKQDGFGR 0.95407 13.1425 0 0 13.1425 0 0 0 0 A0A2C9UPV8 SET domain-containing protein MANES_13G074400 A0A2C9UPV8_MANES Manihot esculenta (Cassava) (Jatropha manihot) carpel development [GO:0048440];stamen development [GO:0048443];vegetative to reproductive phase transition of meristem [GO:0010228] histone methyltransferase activity (H3-K4 specific) [GO:0042800];carpel development [GO:0048440];stamen development [GO:0048443];vegetative to reproductive phase transition of meristem [GO:0010228] histone methyltransferase activity (H3-K4 specific) [GO:0042800] ALPCTYKCRHDAAADLIHVYAHTK 0.95326 13.158 0 0 13.158 0 0 0 0 A0A2C9UZL5 DNA helicase (EC 3.6.4.12) MANES_11G044500 A0A2C9UZL5_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular response to DNA damage stimulus [GO:0006974];DNA duplex unwinding [GO:0032508];establishment of sister chromatid cohesion [GO:0034085];nucleobase-containing compound metabolic process [GO:0006139] nucleus [GO:0005634] nucleus [GO:0005634];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];DNA binding [GO:0003677];DNA helicase activity [GO:0003678];cellular response to DNA damage stimulus [GO:0006974];DNA duplex unwinding [GO:0032508];establishment of sister chromatid cohesion [GO:0034085];nucleobase-containing compound metabolic process [GO:0006139] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];DNA binding [GO:0003677];DNA helicase activity [GO:0003678] HKLQRQYR 0.96207 13.1596 0 13.1596 0 0 0 0 0 A0A2C9WNF8 Uncharacterized protein MANES_01G230800 A0A2C9WNF8_MANES Manihot esculenta (Cassava) (Jatropha manihot) HGFDVTVPQNR 1.0078 13.16 0 0 13.16 0 0 0 0 A0A2C9W579 Uncharacterized protein MANES_03G067000 A0A2C9W579_MANES Manihot esculenta (Cassava) (Jatropha manihot) GTPase activator activity [GO:0005096] GTPase activator activity [GO:0005096] RARDIYLK 0.99511 13.1613 0 13.1613 0 0 0 0 0 A0A2C9VIZ4 Uncharacterized protein MANES_07G058100 A0A2C9VIZ4_MANES Manihot esculenta (Cassava) (Jatropha manihot) FFQGCVASAFAERDHAIMEAEKATEK 1.0325 13.1632 0 13.1632 0 0 0 0 0 A0A2C9V4Z7 Uncharacterized protein MANES_10G061900 A0A2C9V4Z7_MANES Manihot esculenta (Cassava) (Jatropha manihot) GGAAGGR 0.98047 13.1685 0 13.1685 0 0 0 0 0 A0A251KGC9 Uncharacterized protein MANES_07G024500 A0A251KGC9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] SGFSSERSK 0.95522 13.1846 0 13.1846 0 0 0 0 0 A0A2C9V0X3 PGG domain-containing protein MANES_11G126500 A0A2C9V0X3_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] ELQWFKEVEK 0.96964 13.1849 0 13.1849 0 0 0 0 0 A0A2C9UQL4 Kinesin motor domain-containing protein MANES_13G102000 A0A2C9UQL4_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777] ATPSAGK 0.98152 13.1909 0 0 13.1909 0 0 0 0 A0A251KI96 Aa_trans domain-containing protein MANES_07G095400 A0A251KI96_MANES Manihot esculenta (Cassava) (Jatropha manihot) amino acid transport [GO:0006865];auxin-activated signaling pathway [GO:0009734] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];symporter activity [GO:0015293];amino acid transport [GO:0006865];auxin-activated signaling pathway [GO:0009734] symporter activity [GO:0015293] AEDEKLPQQRR 0.96008 13.1941 0 0 0 13.1941 0 0 0 A0A2C9W0M1 Uncharacterized protein MANES_05G205300 A0A2C9W0M1_MANES Manihot esculenta (Cassava) (Jatropha manihot) calcium ion binding [GO:0005509] calcium ion binding [GO:0005509] MVEAMQR 0.98076 13.1972 0 13.1972 0 0 0 0 0 A0A2C9VE32 Uncharacterized protein MANES_08G068700 A0A2C9VE32_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitotic sister chromatid cohesion [GO:0007064] mitotic sister chromatid cohesion [GO:0007064] EGALHVLAK 0.9616 13.1982 0 0 13.1982 0 0 0 0 A0A2C9VU22 Uncharacterized protein MANES_05G000200 A0A2C9VU22_MANES Manihot esculenta (Cassava) (Jatropha manihot) extracellular space [GO:0005615] extracellular space [GO:0005615] DTIVENFCR 0.97792 13.2009 0 0 0 13.2009 0 0 0 A0A2C9W5V8 Mechanosensitive ion channel protein MANES_03G085500 A0A2C9W5V8_MANES Manihot esculenta (Cassava) (Jatropha manihot) anion transport [GO:0006820] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];mechanosensitive ion channel activity [GO:0008381];anion transport [GO:0006820] mechanosensitive ion channel activity [GO:0008381] IQRSPRLSSPR 0.96373 13.2045 0 13.2045 0 0 0 0 0 A0A2C9WMZ4 DYW_deaminase domain-containing protein MANES_01G203700 A0A2C9WMZ4_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast RNA processing [GO:0031425] chloroplast [GO:0009507] chloroplast [GO:0009507];mRNA binding [GO:0003729];zinc ion binding [GO:0008270];chloroplast RNA processing [GO:0031425] mRNA binding [GO:0003729];zinc ion binding [GO:0008270] MKMKGIGLK 0.96429 13.2121 0 13.2121 0 0 0 0 0 A0A2C9UB47 Uncharacterized protein MANES_16G092800 A0A2C9UB47_MANES Manihot esculenta (Cassava) (Jatropha manihot) CAAX-box protein processing [GO:0071586] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];metalloendopeptidase activity [GO:0004222];CAAX-box protein processing [GO:0071586] metalloendopeptidase activity [GO:0004222] KLSADTMK 1.038 13.2123 0 13.2123 0 0 0 0 0 A0A2C9UKV4 Uncharacterized protein MANES_14G128600 A0A2C9UKV4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];voltage-gated potassium channel activity [GO:0005249] voltage-gated potassium channel activity [GO:0005249] FIFRTCKEPK 0.95259 13.2128 0 0 0 13.2128 0 0 0 A0A2C9WEY8 Uncharacterized protein MANES_02G178300 A0A2C9WEY8_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] mitochondrial large ribosomal subunit [GO:0005762] mitochondrial large ribosomal subunit [GO:0005762];structural constituent of ribosome [GO:0003735];translation [GO:0006412] structural constituent of ribosome [GO:0003735] GFQGGMK 0.95677 13.2138 0 13.2138 0 0 0 0 0 A0A199UBG1 Protein kinase domain-containing protein MANES_S040600 A0A199UBG1_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] MLFCIDVCINNR 1 13.2179 0 0 13.2179 0 0 0 0 A0A2C9VGI0 Uncharacterized protein MANES_08G151800 A0A2C9VGI0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];regulation of transcription, DNA-templated [GO:0006355]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]" ALSLNLDEEEEPNGSTPGK 1.0098 13.2213 0 0 0 13.2213 0 0 0 A0A2C9V754 Alpha-carbonic anhydrase domain-containing protein MANES_09G017600 A0A2C9V754_MANES Manihot esculenta (Cassava) (Jatropha manihot) one-carbon metabolic process [GO:0006730] chloroplast stroma [GO:0009570] chloroplast stroma [GO:0009570];carbonate dehydratase activity [GO:0004089];hydro-lyase activity [GO:0016836];zinc ion binding [GO:0008270];one-carbon metabolic process [GO:0006730] carbonate dehydratase activity [GO:0004089];hydro-lyase activity [GO:0016836];zinc ion binding [GO:0008270] DIGFWSRNYFR 0.95329 13.2218 0 0 0 13.2218 0 0 0 A0A2C9W8D4 Uncharacterized protein (Fragment) MANES_03G124300 A0A2C9W8D4_MANES Manihot esculenta (Cassava) (Jatropha manihot) Group II intron splicing [GO:0000373];mRNA processing [GO:0006397] RNA binding [GO:0003723];Group II intron splicing [GO:0000373];mRNA processing [GO:0006397] RNA binding [GO:0003723] GGVTHNMLDDIHNHWR 0.97628 13.2235 0 13.2235 0 0 0 0 0 A0A2C9UFZ9 Protein kinase domain-containing protein MANES_15G108900 A0A2C9UFZ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] KIGEGRFGEVYR 0.95254 13.2284 0 0 0 13.2284 0 0 0 A0A2C9UT37 Uncharacterized protein MANES_12G038100 A0A2C9UT37_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to symbiotic fungus [GO:0009610] serine-type endopeptidase activity [GO:0004252];response to symbiotic fungus [GO:0009610] serine-type endopeptidase activity [GO:0004252] LTNVGNPK 0.95088 13.246 0 13.246 0 0 0 0 0 A0A2C9U7Z9 Uncharacterized protein MANES_17G114600 A0A2C9U7Z9_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA catabolic process [GO:0006401] ATP binding [GO:0005524];nucleic acid binding [GO:0003676];RNA helicase activity [GO:0003724];RNA catabolic process [GO:0006401] ATP binding [GO:0005524];nucleic acid binding [GO:0003676];RNA helicase activity [GO:0003724] EVINSFVYWK 0.98373 13.2614 0 13.2614 0 0 0 0 0 A0A2C9WMA4 EDR2_C domain-containing protein MANES_01G193200 A0A2C9WMA4_MANES Manihot esculenta (Cassava) (Jatropha manihot) GQNYFRDR 0.96466 13.2619 0 0 13.2619 0 0 0 0 A0A2C9UE25 LisH domain-containing protein MANES_15G052600 A0A2C9UE25_MANES Manihot esculenta (Cassava) (Jatropha manihot) transcription corepressor activity [GO:0003714] transcription corepressor activity [GO:0003714] PNTTQLATSSFDTCIR 1.0008 13.2662 0 0 0 13.2662 0 0 0 A0A2C9VD47 MADS-box domain-containing protein MANES_08G035100 A0A2C9VD47_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive regulation of transcription by RNA polymerase II [GO:0045944];regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];positive regulation of transcription by RNA polymerase II [GO:0045944];regulation of transcription by RNA polymerase II [GO:0006357]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]" EPMLWPSR 0.95255 13.2678 0 0 0 13.2678 0 0 0 A0A2C9WK00 GTD-binding domain-containing protein MANES_01G118000 A0A2C9WK00_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];myosin XI tail binding [GO:0080115] myosin XI tail binding [GO:0080115] INDFSSVDHQTK 1.0009 13.2778 0 0 0 13.2778 0 0 0 A0A251J4Z6 Uncharacterized protein MANES_15G110800 A0A251J4Z6_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA export from nucleus [GO:0006405] structural constituent of nuclear pore [GO:0017056];RNA export from nucleus [GO:0006405] structural constituent of nuclear pore [GO:0017056] DIPSQLYDK 0.98608 13.2851 0 13.2851 0 0 0 0 0 A0A2C9W2J9 Uncharacterized protein MANES_04G146100 A0A2C9W2J9_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to symbiotic fungus [GO:0009610] serine-type endopeptidase activity [GO:0004252];response to symbiotic fungus [GO:0009610] serine-type endopeptidase activity [GO:0004252] GFVSYQGK 0.99832 13.2893 0 13.2893 0 0 0 0 0 A0A2C9VAV3 Uncharacterized protein MANES_09G147600 A0A2C9VAV3_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737];membrane [GO:0016020] cytoplasm [GO:0005737];membrane [GO:0016020] IAPSDTYRIWK 0.95201 13.3102 0 0 0 13.3102 0 0 0 A0A2C9VJ74 PsbP domain-containing protein MANES_07G016300 A0A2C9VJ74_MANES Manihot esculenta (Cassava) (Jatropha manihot) photosynthesis [GO:0015979] chloroplast [GO:0009507];extrinsic component of membrane [GO:0019898];photosystem II oxygen evolving complex [GO:0009654] chloroplast [GO:0009507];extrinsic component of membrane [GO:0019898];photosystem II oxygen evolving complex [GO:0009654];calcium ion binding [GO:0005509];photosynthesis [GO:0015979] calcium ion binding [GO:0005509] LHAVVDSFNIFSV 0.96046 13.3144 0 0 0 13.3144 0 0 0 A0A2C9UFV3 NAD(P)H dehydrogenase (quinone) (EC 1.6.5.2) MANES_15G148800 A0A2C9UFV3_MANES Manihot esculenta (Cassava) (Jatropha manihot) FMN binding [GO:0010181];NADH dehydrogenase (quinone) activity [GO:0050136];NADPH dehydrogenase (quinone) activity [GO:0008753] FMN binding [GO:0010181];NADH dehydrogenase (quinone) activity [GO:0050136];NADPH dehydrogenase (quinone) activity [GO:0008753] FGSMASQMKAFFDSTDELWMEQK 1.0014 13.3292 0 0 13.3292 0 0 0 0 A0A2C9VG05 Transpos_assoc domain-containing protein MANES_08G056800 A0A2C9VG05_MANES Manihot esculenta (Cassava) (Jatropha manihot) KFQSRQDVTYHLCK 0.97662 13.3347 0 0 13.3347 0 0 0 0 A0A2C9UBS9 Uncharacterized protein MANES_15G012700 A0A2C9UBS9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] LLKVELLLIHAK 0.96316 13.3385 0 0 0 13.3385 0 0 0 A0A2C9V3Y2 TLC domain-containing protein MANES_10G071500 A0A2C9V3Y2_MANES Manihot esculenta (Cassava) (Jatropha manihot) ceramide biosynthetic process [GO:0046513] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021];N-acyltransferase activity [GO:0016410];sphingosine N-acyltransferase activity [GO:0050291];ceramide biosynthetic process [GO:0046513] N-acyltransferase activity [GO:0016410];sphingosine N-acyltransferase activity [GO:0050291] LKIDEAMR 0.96211 13.3457 0 0 0 13.3457 0 0 0 A0A2C9W5T8 Uncharacterized protein MANES_03G090000 A0A2C9W5T8_MANES Manihot esculenta (Cassava) (Jatropha manihot) (1->3)-beta-D-glucan biosynthetic process [GO:0006075] "1,3-beta-D-glucan synthase complex [GO:0000148];integral component of membrane [GO:0016021];plasma membrane [GO:0005886]" "1,3-beta-D-glucan synthase complex [GO:0000148];integral component of membrane [GO:0016021];plasma membrane [GO:0005886];1,3-beta-D-glucan synthase activity [GO:0003843];glucosyltransferase activity [GO:0046527];(1->3)-beta-D-glucan biosynthetic process [GO:0006075]" "1,3-beta-D-glucan synthase activity [GO:0003843];glucosyltransferase activity [GO:0046527]" GFVVFHAKFAENYRLYSR 0.99914 13.3491 0 0 13.3491 0 0 0 0 A0A2C9VK64 MLO-like protein MLO MANES_07G104100 A0A2C9VK64_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];response to biotic stimulus [GO:0009607] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];calmodulin binding [GO:0005516];defense response [GO:0006952];response to biotic stimulus [GO:0009607] calmodulin binding [GO:0005516] MSDTSKERSLGETPTWAVAVVCLVMIAISIFIEK 0.95161 13.3556 0 13.3556 0 0 0 0 0 A0A2C9UX10 Uncharacterized protein MANES_11G003300 A0A2C9UX10_MANES Manihot esculenta (Cassava) (Jatropha manihot) methylation [GO:0032259] O-methyltransferase activity [GO:0008171];protein dimerization activity [GO:0046983];S-adenosylmethionine-dependent methyltransferase activity [GO:0008757];methylation [GO:0032259] O-methyltransferase activity [GO:0008171];protein dimerization activity [GO:0046983];S-adenosylmethionine-dependent methyltransferase activity [GO:0008757] AHGVPMYK 0.96951 13.364 0 13.364 0 0 0 0 0 A0A2C9VTH0 Fn3_like domain-containing protein MANES_05G002500 A0A2C9VTH0_MANES Manihot esculenta (Cassava) (Jatropha manihot) arabinan catabolic process [GO:0031222];xylan catabolic process [GO:0045493] extracellular region [GO:0005576] "extracellular region [GO:0005576];alpha-L-arabinofuranosidase activity [GO:0046556];xylan 1,4-beta-xylosidase activity [GO:0009044];arabinan catabolic process [GO:0031222];xylan catabolic process [GO:0045493]" "alpha-L-arabinofuranosidase activity [GO:0046556];xylan 1,4-beta-xylosidase activity [GO:0009044]" LTLGIEVDVK 0.98498 13.3666 0 0 13.3666 0 0 0 0 A0A2C9WFI8 O-fucosyltransferase family protein MANES_02G149400 A0A2C9WFI8_MANES Manihot esculenta (Cassava) (Jatropha manihot) fucose metabolic process [GO:0006004] cytoplasm [GO:0005737] cytoplasm [GO:0005737];transferase activity [GO:0016740];fucose metabolic process [GO:0006004] transferase activity [GO:0016740] GPISGTK 0.95435 13.371 0 0 13.371 0 0 0 0 A0A2C9UZW0 Uncharacterized protein MANES_11G054000 A0A2C9UZW0_MANES Manihot esculenta (Cassava) (Jatropha manihot) EEATMKSSFSSQCQISK 0.99088 13.3723 0 0 0 13.3723 0 0 0 A0A2C9WNA3 Uncharacterized protein MANES_01G150500 A0A2C9WNA3_MANES Manihot esculenta (Cassava) (Jatropha manihot) LAVERRYAFADAQFK 0.97891 13.3761 0 0 13.3761 0 0 0 0 A0A2C9U5G3 Uncharacterized protein MANES_17G072100 A0A2C9U5G3_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] CFSFCSVLPKDYEFEEK 1 13.3775 0 13.3775 0 0 0 0 0 A0A2C9UHE7 Uncharacterized protein MANES_15G158200 A0A2C9UHE7_MANES Manihot esculenta (Cassava) (Jatropha manihot) "developmental process [GO:0032502];DNA-templated transcription, termination [GO:0006353];regulation of transcription, DNA-templated [GO:0006355]" "double-stranded DNA binding [GO:0003690];developmental process [GO:0032502];DNA-templated transcription, termination [GO:0006353];regulation of transcription, DNA-templated [GO:0006355]" double-stranded DNA binding [GO:0003690] ELNSDTS 0.95557 13.3877 0 0 0 13.3877 0 0 0 A0A2C9UIT4 BHLH domain-containing protein MANES_14G013300 A0A2C9UIT4_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];regulation of transcription by RNA polymerase II [GO:0006357]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]" CTCTSKQES 0.99923 13.4053 0 0 0 13.4053 0 0 0 A0A251KYS2 Uncharacterized protein MANES_05G204100 A0A251KYS2_MANES Manihot esculenta (Cassava) (Jatropha manihot) "maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463]" cytosolic large ribosomal subunit [GO:0022625] "cytosolic large ribosomal subunit [GO:0022625];RNA binding [GO:0003723];structural constituent of ribosome [GO:0003735];maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463]" RNA binding [GO:0003723];structural constituent of ribosome [GO:0003735] YGKEYREQER 0.96684 13.4085 0 0 0 13.4085 0 0 0 A0A2C9VB54 Uncharacterized protein MANES_09G156100 A0A2C9VB54_MANES Manihot esculenta (Cassava) (Jatropha manihot) LTWKFRGNER 0.95335 13.4099 0 0 13.4099 0 0 0 0 A0A2C9VCK5 Uncharacterized protein MANES_08G011300 A0A2C9VCK5_MANES Manihot esculenta (Cassava) (Jatropha manihot) WSIIAAQLPGRTDNDIK 0.99922 13.4219 0 0 0 13.4219 0 0 0 A0A2C9VV47 S-acyltransferase (EC 2.3.1.225) (Palmitoyltransferase) MANES_05G106700 A0A2C9VV47_MANES Manihot esculenta (Cassava) (Jatropha manihot) peptidyl-L-cysteine S-palmitoylation [GO:0018230];protein targeting to membrane [GO:0006612] endoplasmic reticulum [GO:0005783];Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] endoplasmic reticulum [GO:0005783];Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];protein-cysteine S-palmitoyltransferase activity [GO:0019706];peptidyl-L-cysteine S-palmitoylation [GO:0018230];protein targeting to membrane [GO:0006612] protein-cysteine S-palmitoyltransferase activity [GO:0019706] CVDRFDHHCRWLNNCIGR 0.99431 13.4234 0 13.4234 0 0 0 0 0 A0A2C9V5F9 Uncharacterized protein MANES_10G116100 A0A2C9V5F9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] QQASNPQTTK 0.9856 13.4246 0 13.4246 0 0 0 0 0 A0A2C9WCB9 MFS domain-containing protein MANES_02G094100 A0A2C9WCB9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];sugar transmembrane transporter activity [GO:0051119] sugar transmembrane transporter activity [GO:0051119] TTIHFSDLR 0.97967 13.4301 0 13.4301 0 0 0 0 0 A0A2C9VYI9 HSF_DOMAIN domain-containing protein MANES_05G174900 A0A2C9VYI9_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];methyltransferase activity [GO:0008168];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];regulation of transcription by RNA polymerase II [GO:0006357] DNA-binding transcription factor activity [GO:0003700];methyltransferase activity [GO:0008168];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978] PPEFARDLLPNYFK 0.95452 13.4407 0 13.4407 0 0 0 0 0 A0A2C9WAJ0 BRCT domain-containing protein MANES_03G190200 A0A2C9WAJ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) FVRTRNMLEAIASGK 0.95997 13.4439 0 0 0 13.4439 0 0 0 A0A2C9WBK6 Uncharacterized protein MANES_03G204600 A0A2C9WBK6_MANES Manihot esculenta (Cassava) (Jatropha manihot) mRNA processing [GO:0006397];negative regulation of exoribonuclease activity [GO:1901918];plastid organization [GO:0009657];regulation of translation [GO:0006417];response to red light [GO:0010114] chloroplast [GO:0009507];chloroplast membrane [GO:0031969];chloroplast stroma [GO:0009570] chloroplast [GO:0009507];chloroplast membrane [GO:0031969];chloroplast stroma [GO:0009570];mRNA binding [GO:0003729];protein self-association [GO:0043621];single-stranded RNA binding [GO:0003727];mRNA processing [GO:0006397];negative regulation of exoribonuclease activity [GO:1901918];plastid organization [GO:0009657];regulation of translation [GO:0006417];response to red light [GO:0010114] mRNA binding [GO:0003729];protein self-association [GO:0043621];single-stranded RNA binding [GO:0003727] KARQLLAK 0.96328 13.4446 0 13.4446 0 0 0 0 0 A0A2C9U4Y6 Uncharacterized protein MANES_17G019900 A0A2C9U4Y6_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA integration [GO:0015074] nucleic acid binding [GO:0003676];DNA integration [GO:0015074] nucleic acid binding [GO:0003676] NVFLYGDLEKEVFMEILSRFTNEK 1.0108 13.4519 0 0 13.4519 0 0 0 0 A0A2C9UNQ3 Uncharacterized protein MANES_13G039900 A0A2C9UNQ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) NTVKFGK 0.96261 13.4528 0 0 0 13.4528 0 0 0 A0A2C9VXR9 Sulfate adenylyltransferase (EC 2.7.7.4) MANES_05G149200 A0A2C9VXR9_MANES Manihot esculenta (Cassava) (Jatropha manihot) sulfate assimilation [GO:0000103] adenylylsulfate kinase activity [GO:0004020];ATP binding [GO:0005524];sulfate adenylyltransferase (ATP) activity [GO:0004781];sulfate assimilation [GO:0000103] adenylylsulfate kinase activity [GO:0004020];ATP binding [GO:0005524];sulfate adenylyltransferase (ATP) activity [GO:0004781] VLEDGVLDPK 0.98431 13.4616 0 0 13.4616 0 0 0 0 A0A2C9VJY7 Uncharacterized protein MANES_07G097900 A0A2C9VJY7_MANES Manihot esculenta (Cassava) (Jatropha manihot) STELTGCAKQCMPSCLQQTQASADTCAK 1.0449 13.4684 0 0 13.4684 0 0 0 0 A0A2C9U730 Peptide deformylase (EC 3.5.1.88) MANES_17G113300 A0A2C9U730_MANES Manihot esculenta (Cassava) (Jatropha manihot) peptidyl-methionine modification [GO:0018206];translation [GO:0006412] chloroplast [GO:0009507];mitochondrion [GO:0005739] chloroplast [GO:0009507];mitochondrion [GO:0005739];metal ion binding [GO:0046872];peptide deformylase activity [GO:0042586];peptidyl-methionine modification [GO:0018206];translation [GO:0006412] metal ion binding [GO:0046872];peptide deformylase activity [GO:0042586] TSIFCFK 0.95598 13.4742 0 0 13.4742 0 0 0 0 A0A2C9UN97 Uncharacterized protein MANES_13G018100 A0A2C9UN97_MANES Manihot esculenta (Cassava) (Jatropha manihot) oligosaccharide metabolic process [GO:0009311] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];mannosyl-oligosaccharide glucosidase activity [GO:0004573];oligosaccharide metabolic process [GO:0009311] mannosyl-oligosaccharide glucosidase activity [GO:0004573] KDDIDIHENSLLASGSRSDIGDWQLHLESK 1.0101 13.4793 0 0 0 13.4793 0 0 0 A0A2C9VU64 PMR5N domain-containing protein MANES_05G003900 A0A2C9VU64_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] DYMKWRWQPQDCDIPR 0.98097 13.4834 0 13.4834 0 0 0 0 0 A0A2C9V9J3 Uncharacterized protein MANES_09G096400 A0A2C9V9J3_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650];carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650] SECIDVKPIITGKMIPEGCK 0.96195 13.4896 0 0 0 13.4896 0 0 0 A0A2C9U7Y6 Non-specific serine/threonine protein kinase (EC 2.7.11.1) (Fragment) MANES_16G018400 A0A2C9U7Y6_MANES Manihot esculenta (Cassava) (Jatropha manihot) recognition of pollen [GO:0048544] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];recognition of pollen [GO:0048544] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] SFRNWVLMRDGSGGCVR 0.96566 13.494 0 13.494 0 0 0 0 0 A0A251L599 GHMP_kinases_N domain-containing protein MANES_03G001300 A0A251L599_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524] ATP binding [GO:0005524] NMLEYFQSGVEMIRR 0.97754 13.497 0 13.497 0 0 0 0 0 A0A2C9VII4 Protein kinase domain-containing protein MANES_07G046400 A0A2C9VII4_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein autophosphorylation [GO:0046777] plasma membrane [GO:0005886] plasma membrane [GO:0005886];ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674];protein autophosphorylation [GO:0046777] ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] RANPSSHQGFK 1 13.5201 0 13.5201 0 0 0 0 0 A0A2C9VHX3 Uncharacterized protein MANES_07G023200 A0A2C9VHX3_MANES Manihot esculenta (Cassava) (Jatropha manihot) endoplasmic reticulum calcium ion homeostasis [GO:0032469];ERAD pathway [GO:0036503] endoplasmic reticulum [GO:0005783];endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021] endoplasmic reticulum [GO:0005783];endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021];calcium ion binding [GO:0005509];endoplasmic reticulum calcium ion homeostasis [GO:0032469];ERAD pathway [GO:0036503] calcium ion binding [GO:0005509] IKMTRAH 0.96766 13.5231 0 0 0 13.5231 0 0 0 A0A199UC37 ZnMc domain-containing protein MANES_S021500 A0A199UC37_MANES Manihot esculenta (Cassava) (Jatropha manihot) collagen catabolic process [GO:0030574];extracellular matrix organization [GO:0030198] anchored component of membrane [GO:0031225];extracellular matrix [GO:0031012] anchored component of membrane [GO:0031225];extracellular matrix [GO:0031012];metalloendopeptidase activity [GO:0004222];zinc ion binding [GO:0008270];collagen catabolic process [GO:0030574];extracellular matrix organization [GO:0030198] metalloendopeptidase activity [GO:0004222];zinc ion binding [GO:0008270] GDKLKGIHK 0.95639 13.5296 0 0 13.5296 0 0 0 0 A0A2C9W835 Uncharacterized protein MANES_03G079100 A0A2C9W835_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATFATLSRMKR 0.96059 13.5319 0 0 0 13.5319 0 0 0 A0A2C9VKA3 Uncharacterized protein MANES_07G103600 A0A2C9VKA3_MANES Manihot esculenta (Cassava) (Jatropha manihot) LVTASSVLQDSAGIECR 0.99252 13.5361 0 0 13.5361 0 0 0 0 A0A2C9VNV5 PA domain-containing protein MANES_06G032400 A0A2C9VNV5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];aspartic-type endopeptidase activity [GO:0004190] aspartic-type endopeptidase activity [GO:0004190] PADSSNA 0.95302 13.5441 0 13.5441 0 0 0 0 0 A0A0M4G3P7 NAC transcription factors 44 A0A0M4G3P7_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" "DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] GFQWLCGFCFKPTNENLVHFYLQRK 1.0246 13.5473 0 13.5473 0 0 0 0 0 A0A199UBB6 Uncharacterized protein MANES_S033800 A0A199UBB6_MANES Manihot esculenta (Cassava) (Jatropha manihot) MMKQMSIAGQDDETNGCRK 1.0028 13.5498 0 0 0 13.5498 0 0 0 A0A2C9W8V7 Uncharacterized protein MANES_03G192300 A0A2C9W8V7_MANES Manihot esculenta (Cassava) (Jatropha manihot) cortical cytoskeleton organization [GO:0030865];microtubule cytoskeleton organization [GO:0000226];regulation of dephosphorylation [GO:0035303] cytoplasm [GO:0005737] cytoplasm [GO:0005737];calcium ion binding [GO:0005509];cortical cytoskeleton organization [GO:0030865];microtubule cytoskeleton organization [GO:0000226];regulation of dephosphorylation [GO:0035303] calcium ion binding [GO:0005509] DMPAQFVQMYCRIAAHK 0.95615 13.5678 0 0 0 13.5678 0 0 0 A0A2C9U8R8 Uncharacterized protein MANES_16G040300 A0A2C9U8R8_MANES Manihot esculenta (Cassava) (Jatropha manihot) PCSPSDDGMVPK 0.9553 13.5742 0 0 0 13.5742 0 0 0 A0A2C9V164 Uncharacterized protein MANES_11G088000 A0A2C9V164_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777] EEPLVVRLK 0.96707 13.5805 0 0 13.5805 0 0 0 0 A0A2C9VH59 Fructose-bisphosphate aldolase (EC 4.1.2.13) MANES_07G000100 A0A2C9VH59_MANES Manihot esculenta (Cassava) (Jatropha manihot) "fructose 1,6-bisphosphate metabolic process [GO:0030388];glycolytic process [GO:0006096]" cytosol [GO:0005829] "cytosol [GO:0005829];fructose-bisphosphate aldolase activity [GO:0004332];fructose 1,6-bisphosphate metabolic process [GO:0030388];glycolytic process [GO:0006096]" fructose-bisphosphate aldolase activity [GO:0004332] LASINVENVEDNRR 0.96751 13.5914 0 0 13.5914 0 0 0 0 A0A2C9W7S8 Uncharacterized protein MANES_03G155400 A0A2C9W7S8_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of growth [GO:0040008] regulation of growth [GO:0040008] TYASTSAQNSASQLKIK 0.95646 13.5969 0 0 13.5969 0 0 0 0 A0A251K8T1 RPAP3_C domain-containing protein MANES_09G177200 A0A251K8T1_MANES Manihot esculenta (Cassava) (Jatropha manihot) NITPPNSAYQFEVVWR 0.99574 13.6028 0 0 13.6028 0 0 0 0 A0A2C9UI42 Uncharacterized protein MANES_14G023100 A0A2C9UI42_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] LFRFDLK 0.96593 13.6033 0 0 0 13.6033 0 0 0 A0A2C9WG48 Uncharacterized protein MANES_02G130900 A0A2C9WG48_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565];regulation of transcription, DNA-templated [GO:0006355]" DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] DIMNVIACEGTER 0.95966 13.6278 0 0 0 13.6278 0 0 0 A0A2C9W5Z1 Protein kinase domain-containing protein MANES_03G096300 A0A2C9W5Z1_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to bacterium [GO:0042742];defense response to oomycetes [GO:0002229] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];carbohydrate binding [GO:0030246];transmembrane receptor protein serine/threonine kinase activity [GO:0004675];defense response to bacterium [GO:0042742];defense response to oomycetes [GO:0002229] ATP binding [GO:0005524];carbohydrate binding [GO:0030246];transmembrane receptor protein serine/threonine kinase activity [GO:0004675] VLEGTASALHYLHNEYDQK 1.0019 13.6297 0 0 13.6297 0 0 0 0 A0A2C9UGN3 Polynucleotide phosphorylase 1 (EC 2.7.7.8) MANES_15G166700 A0A2C9UGN3_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial mRNA catabolic process [GO:0000958];mitochondrial RNA 3'-end processing [GO:0000965];RNA catabolic process [GO:0006401] cytosol [GO:0005829];mitochondrion [GO:0005739] cytosol [GO:0005829];mitochondrion [GO:0005739];3'-5'-exoribonuclease activity [GO:0000175];polyribonucleotide nucleotidyltransferase activity [GO:0004654];RNA binding [GO:0003723];mitochondrial mRNA catabolic process [GO:0000958];mitochondrial RNA 3'-end processing [GO:0000965];RNA catabolic process [GO:0006401] 3'-5'-exoribonuclease activity [GO:0000175];polyribonucleotide nucleotidyltransferase activity [GO:0004654];RNA binding [GO:0003723] LGTKVTAK 0.9664 13.6305 0 13.6305 0 0 0 0 0 A0A2C9VJI7 Protein kinase domain-containing protein MANES_07G080500 A0A2C9VJI7_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] KENRESEVFDPFICDK 0.97549 13.6328 0 0 13.6328 0 0 0 0 A0A251JKM0 DUF641 domain-containing protein MANES_15G096500 A0A251JKM0_MANES Manihot esculenta (Cassava) (Jatropha manihot) negative gravitropism [GO:0009959];response to red or far red light [GO:0009639] negative gravitropism [GO:0009959];response to red or far red light [GO:0009639] AKEYLAEYPK 0.95986 13.6334 0 0 13.6334 0 0 0 0 A0A2C9V9N2 SBP-type domain-containing protein MANES_09G032800 A0A2C9V9N2_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];metal ion binding [GO:0046872] DNA binding [GO:0003677];metal ion binding [GO:0046872] VDLSDAK 0.95559 13.6423 0 13.6423 0 0 0 0 0 A0A2C9WGX0 Uncharacterized protein MANES_02G165600 A0A2C9WGX0_MANES Manihot esculenta (Cassava) (Jatropha manihot) rRNA base methylation [GO:0070475] rRNA (cytosine-N4-)-methyltransferase activity [GO:0071424];rRNA base methylation [GO:0070475] rRNA (cytosine-N4-)-methyltransferase activity [GO:0071424] GDGDVDVEERGERDIR 0.96699 13.6452 0 0 0 13.6452 0 0 0 A0A251K8M7 MBD domain-containing protein MANES_11G056200 A0A251K8M7_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677] DNA binding [GO:0003677] ETVPDAATVEANGGAEK 0.97216 13.6478 0 0 0 13.6478 0 0 0 A0A2C9UQW4 Dus domain-containing protein MANES_13G119800 A0A2C9UQW4_MANES Manihot esculenta (Cassava) (Jatropha manihot) flavin adenine dinucleotide binding [GO:0050660];tRNA dihydrouridine synthase activity [GO:0017150] flavin adenine dinucleotide binding [GO:0050660];tRNA dihydrouridine synthase activity [GO:0017150] IFTENEKYRNQEFTTCQEDR 1.012 13.6481 0 13.6481 0 0 0 0 0 A0A2C9U5A3 Pyruvate decarboxylase (EC 4.1.1.1) MANES_17G053600 A0A2C9U5A3_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytosol [GO:0005829] cytosol [GO:0005829];carboxy-lyase activity [GO:0016831];magnesium ion binding [GO:0000287];pyruvate decarboxylase activity [GO:0004737];thiamine pyrophosphate binding [GO:0030976] carboxy-lyase activity [GO:0016831];magnesium ion binding [GO:0000287];pyruvate decarboxylase activity [GO:0004737];thiamine pyrophosphate binding [GO:0030976] HIQQMLSGDTAVIAETGDSWFNCQKLR 0.95548 13.6525 0 0 13.6525 0 0 0 0 A0A2C9UZ41 Uncharacterized protein MANES_11G066800 A0A2C9UZ41_MANES Manihot esculenta (Cassava) (Jatropha manihot) transmembrane transport [GO:0055085] integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524];ATPase-coupled transmembrane transporter activity [GO:0042626];transmembrane transport [GO:0055085] ABC-type transporter activity [GO:0140359];ATPase-coupled transmembrane transporter activity [GO:0042626];ATP binding [GO:0005524] DNILFGKNYESK 0.96633 13.6597 0 0 0 13.6597 0 0 0 A0A2C9UHP4 Phosphoglycerate kinase (EC 2.7.2.3) MANES_14G009000 A0A2C9UHP4_MANES Manihot esculenta (Cassava) (Jatropha manihot) gluconeogenesis [GO:0006094];glycolytic process [GO:0006096] cytosol [GO:0005829] cytosol [GO:0005829];ADP binding [GO:0043531];ATP binding [GO:0005524];phosphoglycerate kinase activity [GO:0004618];gluconeogenesis [GO:0006094];glycolytic process [GO:0006096] ADP binding [GO:0043531];ATP binding [GO:0005524];phosphoglycerate kinase activity [GO:0004618] FSLAPLVPR 0.96188 13.6715 0 0 13.6715 0 0 0 0 A0A2C9V7T6 RING-type domain-containing protein MANES_10G143800 A0A2C9V7T6_MANES Manihot esculenta (Cassava) (Jatropha manihot) floral organ development [GO:0048437];negative regulation of cell population proliferation [GO:0008285];negative regulation of organ growth [GO:0046621];positive regulation of leaf senescence [GO:1900057];protein autoubiquitination [GO:0051865] ubiquitin conjugating enzyme binding [GO:0031624];ubiquitin-protein transferase activity [GO:0004842];floral organ development [GO:0048437];negative regulation of cell population proliferation [GO:0008285];negative regulation of organ growth [GO:0046621];positive regulation of leaf senescence [GO:1900057];protein autoubiquitination [GO:0051865] ubiquitin conjugating enzyme binding [GO:0031624];ubiquitin-protein transferase activity [GO:0004842] CKFGSFFSR 0.95508 13.6755 0 13.6755 0 0 0 0 0 B1NWG3 Cytochrome f petA CYF_MANES Manihot esculenta (Cassava) (Jatropha manihot) photosynthesis [GO:0015979] chloroplast thylakoid membrane [GO:0009535];integral component of thylakoid membrane [GO:0031361] chloroplast thylakoid membrane [GO:0009535];integral component of thylakoid membrane [GO:0031361];electron transfer activity [GO:0009055];heme binding [GO:0020037];iron ion binding [GO:0005506];photosynthesis [GO:0015979] electron transfer activity [GO:0009055];heme binding [GO:0020037];iron ion binding [GO:0005506] GGYEITITDASEGR 0.95238 13.6828 0 0 13.6828 0 0 0 0 A0A2C9V1W2 Fatty acyl-CoA reductase (EC 1.2.1.84) MANES_11G160200 A0A2C9V1W2_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid metabolic process [GO:0006629];long-chain fatty-acyl-CoA metabolic process [GO:0035336];suberin biosynthetic process [GO:0010345] intracellular membrane-bounded organelle [GO:0043231] intracellular membrane-bounded organelle [GO:0043231];alcohol-forming fatty acyl-CoA reductase activity [GO:0102965];fatty-acyl-CoA reductase (alcohol-forming) activity [GO:0080019];lipid metabolic process [GO:0006629];long-chain fatty-acyl-CoA metabolic process [GO:0035336];suberin biosynthetic process [GO:0010345] alcohol-forming fatty acyl-CoA reductase activity [GO:0102965];fatty-acyl-CoA reductase (alcohol-forming) activity [GO:0080019] VQPKVKK 0.97987 13.6852 0 0 13.6852 0 0 0 0 A0A2C9W3Y1 MADS-box domain-containing protein MANES_03G020700 A0A2C9W3Y1_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];regulation of transcription by RNA polymerase II [GO:0006357]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]" LEVATSR 0.96022 13.6857 0 0 13.6857 0 0 0 0 A0A2C9UNJ3 Uncharacterized protein MANES_14G172600 A0A2C9UNJ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] KSDASSPDGSNSPR 0.96718 13.6909 0 13.6909 0 0 0 0 0 A0A2C9WN86 Uncharacterized protein MANES_01G224500 A0A2C9WN86_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] TMYMEEHNVLRSQQSGFCVYDSMGFSYDK 1.0643 13.6922 0 0 0 13.6922 0 0 0 A0A2C9UA58 RING-type domain-containing protein MANES_16G088400 A0A2C9UA58_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ubiquitin protein ligase activity [GO:0061630];protein ubiquitination [GO:0016567] ubiquitin protein ligase activity [GO:0061630] NCCHVFHKECIDRWVDHDHDHDHDDNHK 1.0646 13.6939 0 0 13.6939 0 0 0 0 A0A2C9WEY1 Uncharacterized protein MANES_02G177300 A0A2C9WEY1_MANES Manihot esculenta (Cassava) (Jatropha manihot) recognition of pollen [GO:0048544] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672];recognition of pollen [GO:0048544] ATP binding [GO:0005524];protein kinase activity [GO:0004672] NGNLVMFPVEDPDQFDYIYWR 0.95407 13.7044 0 13.7044 0 0 0 0 0 A0A2C9WC68 Uncharacterized protein MANES_02G089300 A0A2C9WC68_MANES Manihot esculenta (Cassava) (Jatropha manihot) male meiosis II [GO:0007142] male meiosis II [GO:0007142] TATDVLPK 0.95074 13.7046 0 13.7046 0 0 0 0 0 A0A2C9UMG1 RRM domain-containing protein MANES_14G165400 A0A2C9UMG1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA splicing, via spliceosome [GO:0000398]" cytoplasm [GO:0005737];nuclear speck [GO:0016607] "cytoplasm [GO:0005737];nuclear speck [GO:0016607];mRNA binding [GO:0003729];RNA binding [GO:0003723];mRNA splicing, via spliceosome [GO:0000398]" mRNA binding [GO:0003729];RNA binding [GO:0003723] DDRSPTPR 0.96183 13.7172 0 13.7172 0 0 0 0 0 A0A2C9UIZ3 Amine oxidase (EC 1.4.3.-) MANES_14G061500 A0A2C9UIZ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) amine metabolic process [GO:0009308] aliphatic-amine oxidase activity [GO:0052595];aminoacetone:oxygen oxidoreductase(deaminating) activity [GO:0052594];copper ion binding [GO:0005507];phenethylamine:oxygen oxidoreductase (deaminating) activity [GO:0052596];primary amine oxidase activity [GO:0008131];quinone binding [GO:0048038];tryptamine:oxygen oxidoreductase (deaminating) activity [GO:0052593];amine metabolic process [GO:0009308] aliphatic-amine oxidase activity [GO:0052595];aminoacetone:oxygen oxidoreductase(deaminating) activity [GO:0052594];copper ion binding [GO:0005507];phenethylamine:oxygen oxidoreductase (deaminating) activity [GO:0052596];primary amine oxidase activity [GO:0008131];quinone binding [GO:0048038];tryptamine:oxygen oxidoreductase (deaminating) activity [GO:0052593] VNGYFVEWQKWNFR 0.97647 13.7179 0 13.7179 0 0 0 0 0 A0A2C9VQJ5 Uncharacterized protein MANES_06G132400 A0A2C9VQJ5_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein deglycosylation [GO:0006517] cytoplasm [GO:0005737] cytoplasm [GO:0005737];N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity [GO:0003948];protein deglycosylation [GO:0006517] N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity [GO:0003948] FLPCYQVVESMR 0.94844 13.7215 0 0 13.7215 0 0 0 0 A0A2C9UKN7 Uncharacterized protein MANES_14G074100 A0A2C9UKN7_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] PCNLAFGADQFNPEKR 1.0423 13.7249 0 13.7249 0 0 0 0 0 A0A2C9UP70 Uncharacterized protein MANES_13G021700 A0A2C9UP70_MANES Manihot esculenta (Cassava) (Jatropha manihot) "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" LTEDDIDKLEYLK 0.96145 13.735 0 13.735 0 0 0 0 0 A0A2C9U9H0 Ketol-acid reductoisomerase (EC 1.1.1.86) (Acetohydroxy-acid reductoisomerase) (Alpha-keto-beta-hydroxylacyl reductoisomerase) MANES_16G038300 A0A2C9U9H0_MANES Manihot esculenta (Cassava) (Jatropha manihot) isoleucine biosynthetic process [GO:0009097];valine biosynthetic process [GO:0009099] ketol-acid reductoisomerase activity [GO:0004455];metal ion binding [GO:0046872];isoleucine biosynthetic process [GO:0009097];valine biosynthetic process [GO:0009099] ketol-acid reductoisomerase activity [GO:0004455];metal ion binding [GO:0046872] GMLAVYNSLSEEGK 0.97778 13.737 0 13.737 0 0 0 0 0 A0A140H8M8 WRKY transcription factor 24 A0A140H8M8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];nucleus [GO:0005634] integral component of membrane [GO:0016021];nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] ARCETPTINDGCQWR 0.95649 13.7437 0 0 0 13.7437 0 0 0 A0A2C9UUQ2 Uncharacterized protein MANES_12G043400 A0A2C9UUQ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) nutrient reservoir activity [GO:0045735] nutrient reservoir activity [GO:0045735] RPFMEPTQR 0.96437 13.7453 0 13.7453 0 0 0 0 0 A0A2C9UA53 Uncharacterized protein MANES_16G092100 A0A2C9UA53_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];calcium ion binding [GO:0005509];NAD(P)H oxidase H2O2-forming activity [GO:0016174];peroxidase activity [GO:0004601] calcium ion binding [GO:0005509];NAD(P)H oxidase H2O2-forming activity [GO:0016174];peroxidase activity [GO:0004601] KSSPPSFGGSSSK 0.96131 13.7526 0 13.7526 0 0 0 0 0 A0A2C9WAT0 ZnMc domain-containing protein MANES_02G040400 A0A2C9WAT0_MANES Manihot esculenta (Cassava) (Jatropha manihot) collagen catabolic process [GO:0030574];extracellular matrix organization [GO:0030198] anchored component of membrane [GO:0031225];extracellular matrix [GO:0031012] anchored component of membrane [GO:0031225];extracellular matrix [GO:0031012];metalloendopeptidase activity [GO:0004222];zinc ion binding [GO:0008270];collagen catabolic process [GO:0030574];extracellular matrix organization [GO:0030198] metalloendopeptidase activity [GO:0004222];zinc ion binding [GO:0008270] HFAYFYGK 0.95168 13.755 0 0 13.755 0 0 0 0 A0A2C9V151 DEUBAD domain-containing protein MANES_11G137500 A0A2C9V151_MANES Manihot esculenta (Cassava) (Jatropha manihot) Ino80 complex [GO:0031011] Ino80 complex [GO:0031011] ALGVYEK 0.95305 13.7613 0 13.7613 0 0 0 0 0 A0A2C9WKI9 Uncharacterized protein MANES_01G060600 A0A2C9WKI9_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] ATP binding [GO:0005524];cytoskeletal motor activity [GO:0003774];microtubule binding [GO:0008017];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];cytoskeletal motor activity [GO:0003774];microtubule binding [GO:0008017] YVSQNPKEDIDFLGFGDADSDER 0.95768 13.7762 0 0 0 13.7762 0 0 0 A0A2C9U3S1 Uncharacterized protein MANES_18G124700 A0A2C9U3S1_MANES Manihot esculenta (Cassava) (Jatropha manihot) SAAPPSS 0.95628 13.7768 0 13.7768 0 13.069 0 0 0 A0A2C9W8Q4 Uncharacterized protein MANES_03G184600 A0A2C9W8Q4_MANES Manihot esculenta (Cassava) (Jatropha manihot) GFSIFPLGGCFDGCR 1.0137 13.7822 0 13.7822 0 0 0 0 0 A0A2C9U9F5 TAFII28 domain-containing protein MANES_16G060700 A0A2C9U9F5_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA polymerase II preinitiation complex assembly [GO:0051123] transcription factor TFIID complex [GO:0005669] transcription factor TFIID complex [GO:0005669];protein heterodimerization activity [GO:0046982];transcription coactivator activity [GO:0003713];RNA polymerase II preinitiation complex assembly [GO:0051123] protein heterodimerization activity [GO:0046982];transcription coactivator activity [GO:0003713] MQSILSQFTEDQMSR 0.97421 13.7879 0 0 0 13.7879 0 0 0 A0A2C9W4T0 F-box domain-containing protein MANES_03G053000 A0A2C9W4T0_MANES Manihot esculenta (Cassava) (Jatropha manihot) auxin homeostasis [GO:0010252];plant organ formation [GO:1905393] auxin homeostasis [GO:0010252];plant organ formation [GO:1905393] LHHLQLTKCR 0.9595 13.7913 0 0 13.7913 0 0 0 0 A0A2C9W6I6 Uncharacterized protein MANES_03G115700 A0A2C9W6I6_MANES Manihot esculenta (Cassava) (Jatropha manihot) catalytic activity [GO:0003824] catalytic activity [GO:0003824] SCGYSWRRSLSVNEIGR 0.97947 13.8099 0 0 13.8099 0 0 0 0 A0A2C9W751 Uncharacterized protein (Fragment) MANES_03G083100 A0A2C9W751_MANES Manihot esculenta (Cassava) (Jatropha manihot) ARDNVVSFDELHEK 0.97572 13.8155 0 0 0 13.8155 0 0 0 A0A2C9W1W1 RanBD1 domain-containing protein MANES_04G122500 A0A2C9W1W1_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular transport [GO:0046907];mRNA transport [GO:0051028];protein transport [GO:0015031];regulation of catalytic activity [GO:0050790] cytoplasm [GO:0005737];nuclear pore [GO:0005643] cytoplasm [GO:0005737];nuclear pore [GO:0005643];intracellular transport [GO:0046907];mRNA transport [GO:0051028];protein transport [GO:0015031];regulation of catalytic activity [GO:0050790] GNYRLILNASLYSDMK 0.9557 13.8159 0 0 13.8159 0 0 0 0 A0A2C9WPM1 Uncharacterized protein MANES_01G260000 A0A2C9WPM1_MANES Manihot esculenta (Cassava) (Jatropha manihot) oxidoreductase activity [GO:0016491] oxidoreductase activity [GO:0016491] LALLPNDGPSGCFFDRK 0.98054 13.8159 0 0 0 13.8159 0 0 0 A0A2C9UCK7 LisH domain-containing protein MANES_16G138600 A0A2C9UCK7_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567] nucleus [GO:0005634] nucleus [GO:0005634];protein ubiquitination [GO:0016567] LQGRDPRDGK 0.96509 13.8218 0 13.8218 0 0 0 0 0 A0A2C9U8V9 Uncharacterized protein MANES_16G016900 A0A2C9U8V9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];regulation of transcription, DNA-templated [GO:0006355]" LMLAAYKTE 0.94783 13.8338 0 13.8338 0 0 0 0 0 A0A2C9URW7 "Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 [Includes: Methylthioribulose-1-phosphate dehydratase (MTRu-1-P dehydratase) (EC 4.2.1.109);Enolase-phosphatase E1 (EC 3.1.3.77) (2,3-diketo-5-methylthio-1-phosphopentane phosphatase)]" MANES_13G145200 A0A2C9URW7_MANES Manihot esculenta (Cassava) (Jatropha manihot) L-methionine salvage from methylthioadenosine [GO:0019509];L-methionine salvage from S-adenosylmethionine [GO:0019284] cytoplasm [GO:0005737] "cytoplasm [GO:0005737];2,3-diketo-5-methylthiopentyl-1-phosphate enolase activity [GO:0043715];2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase activity [GO:0043716];acireductone synthase activity [GO:0043874];magnesium ion binding [GO:0000287];methylthioribulose 1-phosphate dehydratase activity [GO:0046570];zinc ion binding [GO:0008270];L-methionine salvage from methylthioadenosine [GO:0019509];L-methionine salvage from S-adenosylmethionine [GO:0019284]" "2,3-diketo-5-methylthiopentyl-1-phosphate enolase activity [GO:0043715];2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase activity [GO:0043716];acireductone synthase activity [GO:0043874];magnesium ion binding [GO:0000287];methylthioribulose 1-phosphate dehydratase activity [GO:0046570];zinc ion binding [GO:0008270]" WDASGIKVYVYSSGSR 1.0015 13.841 0 13.841 0 0 0 0 0 A0A2C9W1M8 Mechanosensitive ion channel protein MANES_04G069700 A0A2C9W1M8_MANES Manihot esculenta (Cassava) (Jatropha manihot) anion transport [GO:0006820] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];mechanosensitive ion channel activity [GO:0008381];anion transport [GO:0006820] mechanosensitive ion channel activity [GO:0008381] LNHKNISAWNMKR 0.9584 13.8512 0 0 0 13.8512 0 0 0 A0A251KSD1 Protein ARV MANES_05G014900 A0A251KSD1_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular sterol transport [GO:0032366] endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021] endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021];intracellular sterol transport [GO:0032366] VFTGSATSKCIGACFCAHALK 0.97914 13.8526 0 0 0 13.8526 0 0 0 A0A251IU11 Uncharacterized protein MANES_17G018400 A0A251IU11_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive gravitropism [GO:0009958];regulation of actin polymerization or depolymerization [GO:0008064];regulation of auxin mediated signaling pathway [GO:0010928];regulation of cell shape [GO:0008360];small GTPase mediated signal transduction [GO:0007264];vesicle-mediated transport [GO:0016192] endoplasmic reticulum exit site [GO:0070971];extrinsic component of membrane [GO:0019898];nucleus [GO:0005634] endoplasmic reticulum exit site [GO:0070971];extrinsic component of membrane [GO:0019898];nucleus [GO:0005634];guanyl-nucleotide exchange factor activity [GO:0005085];positive gravitropism [GO:0009958];regulation of actin polymerization or depolymerization [GO:0008064];regulation of auxin mediated signaling pathway [GO:0010928];regulation of cell shape [GO:0008360];small GTPase mediated signal transduction [GO:0007264];vesicle-mediated transport [GO:0016192] guanyl-nucleotide exchange factor activity [GO:0005085] AKGYRVGPVYDDVLAMAWFFLELIVK 1.0392 13.8625 0 13.8625 0 0 0 0 0 A0A2C9VHK6 Uncharacterized protein MANES_08G108800 A0A2C9VHK6_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650];carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650] ALSLIFLLVFALSLCSFFTSIEGRFHGLTK 1.0054 13.8692 0 0 13.8692 0 0 0 0 A0A2C9W9W6 Pectinesterase (EC 3.1.1.11) MANES_02G011700 A0A2C9W9W6_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910];cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910] CRINGHQDTLYAHSFRQFYR 0.97488 13.8736 0 0 13.8736 0 0 0 0 A0A251LMV0 Uncharacterized protein MANES_03G077400 A0A251LMV0_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] LANKCKGLPFAAK 0.95846 13.8752 0 13.8752 0 0 0 0 0 A0A2C9UAR1 Uncharacterized protein MANES_16G079600 A0A2C9UAR1_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to auxin [GO:0009733];response to ethylene [GO:0009723];response to gibberellin [GO:0009739] DNA binding [GO:0003677];zinc ion binding [GO:0008270];response to auxin [GO:0009733];response to ethylene [GO:0009723];response to gibberellin [GO:0009739] DNA binding [GO:0003677];zinc ion binding [GO:0008270] GVAWSKEEHR 0.96482 13.8859 0 13.8859 0 0 0 0 0 A0A2C9VHK9 Aldo_ket_red domain-containing protein MANES_08G133600 A0A2C9VHK9_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] cytoplasm [GO:0005737];aldo-keto reductase (NADP) activity [GO:0004033];D-threo-aldose 1-dehydrogenase activity [GO:0047834] aldo-keto reductase (NADP) activity [GO:0004033];D-threo-aldose 1-dehydrogenase activity [GO:0047834] LVIIPRVK 0.9621 13.8862 0 13.8862 0 0 0 0 0 A0A2C9VJR5 HPt domain-containing protein MANES_07G089000 A0A2C9VJR5_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytokinin-activated signaling pathway [GO:0009736];phosphorelay signal transduction system [GO:0000160];phosphorylation [GO:0016310] cytoplasm [GO:0005737];cytosol [GO:0005829];nucleus [GO:0005634] cytoplasm [GO:0005737];cytosol [GO:0005829];nucleus [GO:0005634];histidine phosphotransfer kinase activity [GO:0009927];protein histidine kinase binding [GO:0043424];cytokinin-activated signaling pathway [GO:0009736];phosphorelay signal transduction system [GO:0000160];phosphorylation [GO:0016310] histidine phosphotransfer kinase activity [GO:0009927];protein histidine kinase binding [GO:0043424] LIIKELTNSLGQNNIDYNQLDNLCLK 1.0214 13.8935 0 0 13.8935 0 0 0 0 A0A2C9WL05 RING-type domain-containing protein MANES_01G105300 A0A2C9WL05_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ubiquitin protein ligase activity [GO:0061630];protein ubiquitination [GO:0016567] ubiquitin protein ligase activity [GO:0061630] GSPPAAK 0.95311 13.8943 0 13.8943 0 0 0 0 0 A0A2C9VNR8 Uncharacterized protein MANES_06G078200 A0A2C9VNR8_MANES Manihot esculenta (Cassava) (Jatropha manihot) ADADLAYSSEK 0.95865 13.9072 0 13.9072 0 0 0 0 0 A0A2C9UPN0 Uncharacterized protein MANES_13G065100 A0A2C9UPN0_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to virus [GO:0051607];gene silencing by RNA [GO:0031047];immune response [GO:0006955] nucleic acid binding [GO:0003676];defense response to virus [GO:0051607];gene silencing by RNA [GO:0031047];immune response [GO:0006955] nucleic acid binding [GO:0003676] PCNQQYFPMRMK 0.9678 13.9074 0 13.9074 0 0 0 0 0 A0A2C9VSE8 C2 NT-type domain-containing protein MANES_06G147000 A0A2C9VSE8_MANES Manihot esculenta (Cassava) (Jatropha manihot) ASIGSNASIQSTPR 0.9666 13.9125 0 0 13.9125 0 0 0 0 A0A2C9UVR4 Uncharacterized protein MANES_12G117800 A0A2C9UVR4_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] SDGSLCLMEALTRSQLK 1 13.919 0 0 13.919 0 0 0 0 A0A2C9UMA7 Clp R domain-containing protein MANES_14G163200 A0A2C9UMA7_MANES Manihot esculenta (Cassava) (Jatropha manihot) HTQFVKFQFAPVSLR 0.96992 13.9238 0 13.9238 0 0 0 0 0 B1NWF9 "Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15)" accD B1NWF9_MANES Manihot esculenta (Cassava) (Jatropha manihot) fatty acid biosynthetic process [GO:0006633];malonyl-CoA biosynthetic process [GO:2001295] acetyl-CoA carboxylase complex [GO:0009317];chloroplast stroma [GO:0009570] acetyl-CoA carboxylase complex [GO:0009317];chloroplast stroma [GO:0009570];acetyl-CoA carboxylase activity [GO:0003989];ATP binding [GO:0005524];carboxyl- or carbamoyltransferase activity [GO:0016743];zinc ion binding [GO:0008270];fatty acid biosynthetic process [GO:0006633];malonyl-CoA biosynthetic process [GO:2001295] acetyl-CoA carboxylase activity [GO:0003989];ATP binding [GO:0005524];carboxyl- or carbamoyltransferase activity [GO:0016743];zinc ion binding [GO:0008270] SSFYSYWNSSYLNNGSR 0.99921 13.9249 0 0 0 13.9249 0 0 0 A0A2C9W7N2 DUF3883 domain-containing protein MANES_03G146000 A0A2C9W7N2_MANES Manihot esculenta (Cassava) (Jatropha manihot) embryo development ending in seed dormancy [GO:0009793];leaf vascular tissue pattern formation [GO:0010305];root development [GO:0048364] nucleus [GO:0005634] nucleus [GO:0005634];embryo development ending in seed dormancy [GO:0009793];leaf vascular tissue pattern formation [GO:0010305];root development [GO:0048364] KVGISSNWPPVDWK 0.96403 13.9299 0 13.9299 0 0 0 0 0 A0A2C9VD94 Dof-type domain-containing protein MANES_08G034200 A0A2C9VD94_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] MDSGWKTNVEISPSCPR 0.96021 13.9305 0 0 13.9305 0 0 0 0 A0A2C9WIY4 PPM-type phosphatase domain-containing protein MANES_01G007900 A0A2C9WIY4_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytosol [GO:0005829];nucleus [GO:0005634] cytosol [GO:0005829];nucleus [GO:0005634];phosphatase activity [GO:0016791] phosphatase activity [GO:0016791] LMDKELKLHPTIDCFCSGTTAVTLIK 1.028 13.9362 0 13.9362 0 0 0 0 0 A0A2C9U824 PKS_ER domain-containing protein MANES_16G022000 A0A2C9U824_MANES Manihot esculenta (Cassava) (Jatropha manihot) oxidoreductase activity [GO:0016491] oxidoreductase activity [GO:0016491] MRSPENKAEIVNEVEK 1.0114 13.9406 0 0 13.9406 0 0 0 0 A0A251IVR3 Uncharacterized protein MANES_17G073200 A0A251IVR3_MANES Manihot esculenta (Cassava) (Jatropha manihot) EQTKPPKR 0.96984 13.9433 0 0 13.9433 0 0 0 0 A0A2C9VNG9 Uncharacterized protein MANES_06G065800 A0A2C9VNG9_MANES Manihot esculenta (Cassava) (Jatropha manihot) iron ion homeostasis [GO:0055072] zinc ion binding [GO:0008270];iron ion homeostasis [GO:0055072] zinc ion binding [GO:0008270] VGNGLGVDFFHCMKCNCCLAMK 0.94876 13.9504 0 13.9504 0 0 0 0 0 A0A2C9VM70 "alpha-1,2-Mannosidase (EC 3.2.1.-)" MANES_06G018400 A0A2C9VM70_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975];N-glycan processing [GO:0006491] endoplasmic reticulum [GO:0005783];Golgi membrane [GO:0000139] "endoplasmic reticulum [GO:0005783];Golgi membrane [GO:0000139];calcium ion binding [GO:0005509];mannosyl-oligosaccharide 1,2-alpha-mannosidase activity [GO:0004571];carbohydrate metabolic process [GO:0005975];N-glycan processing [GO:0006491]" "calcium ion binding [GO:0005509];mannosyl-oligosaccharide 1,2-alpha-mannosidase activity [GO:0004571]" DENVQFDR 0.96705 13.9511 0 0 0 13.9511 0 0 0 I0CL54 Alkaline/neutral invertase (EC 3.2.1.26) NINV8 I0CL54_MANES Manihot esculenta (Cassava) (Jatropha manihot) sucrose catabolic process [GO:0005987] glycopeptide alpha-N-acetylgalactosaminidase activity [GO:0033926];sucrose alpha-glucosidase activity [GO:0004575];sucrose catabolic process [GO:0005987] glycopeptide alpha-N-acetylgalactosaminidase activity [GO:0033926];sucrose alpha-glucosidase activity [GO:0004575] FHINCVKK 0.96825 13.9564 0 0 0 13.9564 0 0 0 A0A2C9VBP2 Exonuclease domain-containing protein MANES_09G174800 A0A2C9VBP2_MANES Manihot esculenta (Cassava) (Jatropha manihot) "DNA catabolic process, exonucleolytic [GO:0000738]" cytoplasm [GO:0005737] "cytoplasm [GO:0005737];3'-5'-exodeoxyribonuclease activity [GO:0008296];nucleic acid binding [GO:0003676];DNA catabolic process, exonucleolytic [GO:0000738]" 3'-5'-exodeoxyribonuclease activity [GO:0008296];nucleic acid binding [GO:0003676] LVGSKANGTEGGYSR 0.97878 13.9632 0 0 0 13.9632 0 0 0 A0A2C9U5M6 Cysteine-rich PDZ-binding protein (Cysteine-rich interactor of PDZ three) MANES_17G035700 A0A2C9U5M6_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] cytoplasm [GO:0005737] MVCEKCEKK 0.96454 13.9656 0 0 0 13.9656 0 0 0 A0A2C9VZW4 Uncharacterized protein MANES_04G010700 A0A2C9VZW4_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid metabolic process [GO:0006629] cytoplasm [GO:0005737];integral component of membrane [GO:0016021] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];O-acyltransferase activity [GO:0008374];lipid metabolic process [GO:0006629] O-acyltransferase activity [GO:0008374] VSPTDRCKSIPFR 0.96015 13.9674 0 0 13.9674 0 0 0 0 A0A199UAL9 Uncharacterized protein MANES_S056100 A0A199UAL9_MANES Manihot esculenta (Cassava) (Jatropha manihot) DKYMDIGS 0.97663 13.9718 0 0 0 13.9718 0 0 0 A0A251KTL9 F-box domain-containing protein MANES_05G053400 A0A251KTL9_MANES Manihot esculenta (Cassava) (Jatropha manihot) VVVPSFPEIEDEVSCSYSNK 0.99302 13.9738 0 0 0 13.9738 0 0 0 A0A2C9U6Y9 Uncharacterized protein MANES_17G107800 A0A2C9U6Y9_MANES Manihot esculenta (Cassava) (Jatropha manihot) HIEQTQMSINGGNNETIPER 1.0178 13.9785 0 0 0 13.9785 0 0 0 A0A2C9UIY6 Receptor-like serine/threonine-protein kinase (EC 2.7.11.1) MANES_14G015000 A0A2C9UIY6_MANES Manihot esculenta (Cassava) (Jatropha manihot) recognition of pollen [GO:0048544] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];recognition of pollen [GO:0048544] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] TQHKNLVR 0.95973 13.9833 0 13.9833 0 0 0 0 0 A0A2C9UAE9 Uncharacterized protein MANES_16G093600 A0A2C9UAE9_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650];carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650] DSPFWTLHPYDCKNVTVR 0.97928 13.9882 0 0 0 13.9882 0 0 0 A0A2C9VT21 Uncharacterized protein MANES_05G036000 A0A2C9VT21_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of photosynthesis, light reaction [GO:0042548]" integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];voltage-gated chloride channel activity [GO:0005247];regulation of photosynthesis, light reaction [GO:0042548]" voltage-gated chloride channel activity [GO:0005247] SLYTHQKWVEHRSSLR 0.97548 13.9905 0 0 13.9905 0 0 0 0 A0A2C9WDV2 NAB domain-containing protein MANES_02G144700 A0A2C9WDV2_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin binding [GO:0003779] actin binding [GO:0003779] AATNAYSWWCASHIR 0.97444 13.9946 0 13.9946 0 0 0 0 0 A0A2C9VRY8 F-box domain-containing protein MANES_06G131800 A0A2C9VRY8_MANES Manihot esculenta (Cassava) (Jatropha manihot) IYDLYLAFDPR 1 13.9951 0 13.9951 0 0 0 0 0 A0A2C9VF01 Uncharacterized protein MANES_08G020000 A0A2C9VF01_MANES Manihot esculenta (Cassava) (Jatropha manihot) VQLISYSK 0.96953 14.0046 0 0 14.0046 0 0 0 0 A0A2C9U9M2 RING-type domain-containing protein MANES_16G068000 A0A2C9U9M2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];zinc ion binding [GO:0008270] zinc ion binding [GO:0008270] YRHRNQVLEQESTQSR 0.96319 14.0112 0 0 0 14.0112 0 0 0 A0A2C9U9K2 Uncharacterized protein MANES_16G036300 A0A2C9U9K2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] APILIMKWFTSKIPC 0.95962 14.017 0 0 14.017 0 0 0 0 A0A2C9VZS7 Uncharacterized protein MANES_05G178700 A0A2C9VZS7_MANES Manihot esculenta (Cassava) (Jatropha manihot) "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" HLNYNSSTMGFSSYGDHWRNLR 0.98049 14.0174 0 0 0 14.0174 0 0 0 A0A2C9UE68 RRM domain-containing protein MANES_15G079200 A0A2C9UE68_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] AEPNTNLFVCGLSK 0.97928 14.0205 0 14.0205 0 0 0 0 0 A0A251KEE4 Glycosyltransferase (EC 2.4.1.-) MANES_08G163200 A0A251KEE4_MANES Manihot esculenta (Cassava) (Jatropha manihot) anthocyanin-containing compound biosynthetic process [GO:0009718] anthocyanidin 3-O-glucosyltransferase activity [GO:0047213];anthocyanin-containing compound biosynthetic process [GO:0009718] anthocyanidin 3-O-glucosyltransferase activity [GO:0047213] AAPECFRK 0.95328 14.0248 0 0 14.0248 0 0 0 0 A0A2C9UQU9 Uncharacterized protein MANES_13G106800 A0A2C9UQU9_MANES Manihot esculenta (Cassava) (Jatropha manihot) RDDSTDGESK 0.96221 14.026 0 0 0 14.026 0 0 0 A0A2C9UUP8 Uncharacterized protein MANES_12G078000 A0A2C9UUP8_MANES Manihot esculenta (Cassava) (Jatropha manihot) acetylglucosaminyltransferase activity [GO:0008375] acetylglucosaminyltransferase activity [GO:0008375] VLDSCLVR 0.94904 14.0302 0 0 0 14.0302 0 0 0 A0A2C9U9D7 AAA domain-containing protein MANES_16G008400 A0A2C9U9D7_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] PFNTIGKLTNPR 0.95024 14.0314 0 0 14.0314 0 0 0 0 A0A2C9UEC6 NADPH-protochlorophyllide oxidoreductase (EC 1.3.1.33) MANES_15G085400 A0A2C9UEC6_MANES Manihot esculenta (Cassava) (Jatropha manihot) chlorophyll biosynthetic process [GO:0015995];photosynthesis [GO:0015979] chloroplast [GO:0009507] chloroplast [GO:0009507];protochlorophyllide reductase activity [GO:0016630];chlorophyll biosynthetic process [GO:0015995];photosynthesis [GO:0015979] protochlorophyllide reductase activity [GO:0016630] WHIIMACRDFLK 0.96741 14.0344 0 0 0 14.0344 0 0 0 A0A2C9UH42 Glutaredoxin domain-containing protein MANES_15G174900 A0A2C9UH42_MANES Manihot esculenta (Cassava) (Jatropha manihot) glutathione oxidoreductase activity [GO:0097573] glutathione oxidoreductase activity [GO:0097573] SGKEKVVVYFTSLR 0.96245 14.0366 0 0 14.0366 0 0 0 0 A0A2C9VJC0 Uncharacterized protein MANES_07G071200 A0A2C9VJC0_MANES Manihot esculenta (Cassava) (Jatropha manihot) TSLEDLKNIVCQHF 0.97762 14.0387 0 0 0 14.0387 0 0 0 A0A2C9WA53 CS domain-containing protein MANES_02G016700 A0A2C9WA53_MANES Manihot esculenta (Cassava) (Jatropha manihot) chaperone binding [GO:0051087] chaperone binding [GO:0051087] IAEDCYDQR 0.9616 14.0474 0 0 0 14.0474 0 0 0 A0A2C9WAL0 Uncharacterized protein MANES_02G036200 A0A2C9WAL0_MANES Manihot esculenta (Cassava) (Jatropha manihot) fatty acid biosynthetic process [GO:0006633] 3-oxoacyl-[acyl-carrier-protein] synthase activity [GO:0004315];fatty acid biosynthetic process [GO:0006633] 3-oxoacyl-[acyl-carrier-protein] synthase activity [GO:0004315] LVDTSDEWISVR 0.99634 14.0558 0 0 0 14.0558 0 0 0 A0A251LGV0 Uncharacterized protein MANES_02G089800 A0A251LGV0_MANES Manihot esculenta (Cassava) (Jatropha manihot) VNNGRIR 0.97876 14.0582 0 14.0582 0 0 0 0 0 A0A2C9W5C8 DUF676 domain-containing protein MANES_03G070300 A0A2C9W5C8_MANES Manihot esculenta (Cassava) (Jatropha manihot) LKGSQCFHQLTFTDDVDLR 0.99906 14.0607 0 0 0 14.0607 0 0 0 A0A2C9UPB8 PB1 domain-containing protein MANES_13G024300 A0A2C9UPB8_MANES Manihot esculenta (Cassava) (Jatropha manihot) QPSSTATTIK 0.98182 14.0626 0 0 0 14.0626 0 0 0 A0A2C9UMH7 Glycosyltransferase (EC 2.4.2.-) MANES_14G173300 A0A2C9UMH7_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall organization [GO:0071555] Golgi membrane [GO:0000139] Golgi membrane [GO:0000139];glycosyltransferase activity [GO:0016757];cell wall organization [GO:0071555] glycosyltransferase activity [GO:0016757] FWYLSRK 0.94913 14.0728 0 0 0 14.0728 0 0 0 A0A2C9W2G4 Uncharacterized protein MANES_04G067500 A0A2C9W2G4_MANES Manihot esculenta (Cassava) (Jatropha manihot) KTSHMNQFLHR 0.95982 14.0762 0 14.0762 0 0 0 0 0 A0A2C9URS6 BHLH domain-containing protein MANES_13G105700 A0A2C9URS6_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];protein dimerization activity [GO:0046983] protein dimerization activity [GO:0046983] PYSMTRTPAHAQDHILAER 1.0029 14.0767 0 14.0767 0 0 0 0 0 A0A199UAK3 Uncharacterized protein MANES_S064200 A0A199UAK3_MANES Manihot esculenta (Cassava) (Jatropha manihot) SLKHISFCTLYR 0.96345 14.0811 0 0 0 14.0811 0 0 0 A0A2C9VU96 Uncharacterized protein MANES_05G076300 A0A2C9VU96_MANES Manihot esculenta (Cassava) (Jatropha manihot) LEYALGKIEVYENR 0.97591 14.0821 0 0 0 14.0821 0 0 0 A0A2C9VLF0 NAD_Gly3P_dh_N domain-containing protein MANES_07G142700 A0A2C9VLF0_MANES Manihot esculenta (Cassava) (Jatropha manihot) glycerol-3-phosphate catabolic process [GO:0046168] glycerol-3-phosphate dehydrogenase complex [GO:0009331] glycerol-3-phosphate dehydrogenase complex [GO:0009331];glycerol-3-phosphate dehydrogenase [NAD+] activity [GO:0004367];NAD binding [GO:0051287];glycerol-3-phosphate catabolic process [GO:0046168] glycerol-3-phosphate dehydrogenase [NAD+] activity [GO:0004367];NAD binding [GO:0051287] CACHCSWDCGR 1.0159 14.1071 0 0 0 14.1071 0 0 0 A0A251LFC0 Uncharacterized protein MANES_02G040900 A0A251LFC0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] CKSKIHK 0.96934 14.1172 0 0 14.1172 0 0 0 0 A0A2C9UL13 FCP1 homology domain-containing protein MANES_14G086700 A0A2C9UL13_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphoprotein phosphatase activity [GO:0004721] phosphoprotein phosphatase activity [GO:0004721] LEPGLPWK 0.97027 14.1197 0 0 0 14.1197 0 0 0 A0A251K5N0 HTH myb-type domain-containing protein MANES_09G109300 A0A251K5N0_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] NGGSSSNSTVEESEK 0.97387 14.126 0 14.126 0 0 0 0 0 A0A2C9UH61 Long-chain-alcohol oxidase (EC 1.1.3.20) MANES_15G184700 A0A2C9UH61_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];flavin adenine dinucleotide binding [GO:0050660];long-chain-alcohol oxidase activity [GO:0046577] flavin adenine dinucleotide binding [GO:0050660];long-chain-alcohol oxidase activity [GO:0046577] KVSYNEFEK 0.96415 14.1309 0 14.1309 0 0 0 0 0 A0A2C9UN10 SHSP domain-containing protein MANES_14G149200 A0A2C9UN10_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein complex oligomerization [GO:0051259];protein folding [GO:0006457];response to heat [GO:0009408];response to hydrogen peroxide [GO:0042542];response to salt stress [GO:0009651] protein self-association [GO:0043621];unfolded protein binding [GO:0051082];protein complex oligomerization [GO:0051259];protein folding [GO:0006457];response to heat [GO:0009408];response to hydrogen peroxide [GO:0042542];response to salt stress [GO:0009651] protein self-association [GO:0043621];unfolded protein binding [GO:0051082] EEKNEKWHR 0.96425 14.1383 0 14.1383 0 0 0 0 0 A0A2C9WFP0 TIR domain-containing protein MANES_02G202000 A0A2C9WFP0_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];signal transduction [GO:0007165] NAD+ nucleosidase activity [GO:0003953];defense response [GO:0006952];signal transduction [GO:0007165] NAD+ nucleosidase activity [GO:0003953] QWKYDVFLSFR 0.96415 14.1521 0 0 0 14.1521 0 0 0 A0A2C9W7R7 Protein kinase domain-containing protein MANES_03G154400 A0A2C9W7R7_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] LRDYKMSSR 0.94829 14.1604 0 0 14.1604 0 0 0 0 A0A2C9WFW6 Uncharacterized protein (Fragment) MANES_02G213100 A0A2C9WFW6_MANES Manihot esculenta (Cassava) (Jatropha manihot) MTRFECR 0.96393 14.1733 0 14.1733 0 0 0 0 0 A0A2C9VCH9 Uncharacterized protein MANES_08G014400 A0A2C9VCH9_MANES Manihot esculenta (Cassava) (Jatropha manihot) FFVGYAGWQLDQLR 0.9615 14.1758 0 0 0 14.1758 0 0 0 A0A2C9VZW5 Pectate lyase (EC 4.2.2.2) MANES_05G188400 A0A2C9VZW5_MANES Manihot esculenta (Cassava) (Jatropha manihot) pectin catabolic process [GO:0045490] metal ion binding [GO:0046872];pectate lyase activity [GO:0030570];pectin catabolic process [GO:0045490] metal ion binding [GO:0046872];pectate lyase activity [GO:0030570] NPIDSCWRQNRNWR 1.018 14.1789 0 0 14.1789 0 0 0 0 A0A2C9V402 Uncharacterized protein MANES_10G070100 A0A2C9V402_MANES Manihot esculenta (Cassava) (Jatropha manihot) IAFTRLATCPSFNK 0.9611 14.1886 0 14.1886 0 0 0 0 0 A0A2C9UBD8 RNA helicase (EC 3.6.4.13) MANES_16G136600 A0A2C9UBD8_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA splicing, via spliceosome [GO:0000398]" spliceosomal complex [GO:0005681] "spliceosomal complex [GO:0005681];ATP binding [GO:0005524];RNA binding [GO:0003723];RNA helicase activity [GO:0003724];mRNA splicing, via spliceosome [GO:0000398]" ATP binding [GO:0005524];RNA binding [GO:0003723];RNA helicase activity [GO:0003724] HGGKSHQLTFSSAR 0.96129 14.1924 0 0 0 14.1924 0 0 0 A0A2C9W7M1 Uncharacterized protein MANES_03G144700 A0A2C9W7M1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]" "acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]" EAPLFESLCAMMWQCIAK 0.99478 14.1975 0 0 14.1975 0 0 0 0 A0A2C9WHL2 AAA domain-containing protein MANES_01G037900 A0A2C9WHL2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] VWWSNEK 0.95533 14.1991 0 0 14.1991 0 0 0 0 A0A2C9UIK2 Morc6_S5 domain-containing protein MANES_14G048300 A0A2C9UIK2_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive regulation of defense response [GO:0031349];positive regulation of immune response [GO:0050778];positive regulation of response to biotic stimulus [GO:0002833];positive regulation of response to external stimulus [GO:0032103] endonuclease activity [GO:0004519];positive regulation of defense response [GO:0031349];positive regulation of immune response [GO:0050778];positive regulation of response to biotic stimulus [GO:0002833];positive regulation of response to external stimulus [GO:0032103] endonuclease activity [GO:0004519] SSERSSPSLEDVSDDDACIAR 0.9722 14.2056 0 14.2056 0 0 0 0 0 A0A2C9U3H3 Uncharacterized protein MANES_17G008100 A0A2C9U3H3_MANES Manihot esculenta (Cassava) (Jatropha manihot) RFKMQSQICQQVMDEADK 1 14.2088 0 14.2088 0 0 0 0 0 A0A251JWB1 Uncharacterized protein MANES_11G142100 A0A251JWB1_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein sumoylation [GO:0016925] SUMO ligase activity [GO:0061665];zinc ion binding [GO:0008270];protein sumoylation [GO:0016925] SUMO ligase activity [GO:0061665];zinc ion binding [GO:0008270] GQGVLDSSK 0.96156 14.2371 0 14.2371 0 0 0 0 0 A0A2C9VEQ2 "1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase, chloroplastic (EC 5.3.1.16) (5-proFAR isomerase) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase)" MANES_08G025500 A0A2C9VEQ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) histidine biosynthetic process [GO:0000105];tryptophan biosynthetic process [GO:0000162] chloroplast [GO:0009507];cytoplasm [GO:0005737] chloroplast [GO:0009507];cytoplasm [GO:0005737];1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity [GO:0003949];histidine biosynthetic process [GO:0000105];tryptophan biosynthetic process [GO:0000162] 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity [GO:0003949] LVLDLSCR 0.96898 14.2652 0 14.2652 0 0 0 0 0 A0A2C9U5Z7 NmrA domain-containing protein MANES_17G074600 A0A2C9U5Z7_MANES Manihot esculenta (Cassava) (Jatropha manihot) lignan biosynthetic process [GO:0009807] oxidoreductase activity [GO:0016491];lignan biosynthetic process [GO:0009807] oxidoreductase activity [GO:0016491] SKIIHSFK 0.96292 14.2797 0 14.2797 0 0 0 0 0 A0A2C9V690 Uncharacterized protein MANES_10G146900 A0A2C9V690_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] beta-glucosidase activity [GO:0008422];carbohydrate metabolic process [GO:0005975] beta-glucosidase activity [GO:0008422] NELEPFVTIFHWDTPQALEDK 0.80392 14.2926 0 14.2926 0 0 0 0 0 A0A2C9UZE9 Alpha-mannosidase (EC 3.2.1.-) MANES_11G076900 A0A2C9UZE9_MANES Manihot esculenta (Cassava) (Jatropha manihot) mannose metabolic process [GO:0006013] alpha-mannosidase activity [GO:0004559];carbohydrate binding [GO:0030246];metal ion binding [GO:0046872];mannose metabolic process [GO:0006013] alpha-mannosidase activity [GO:0004559];carbohydrate binding [GO:0030246];metal ion binding [GO:0046872] LSIGYTEAEK 0.95591 14.2956 0 12.5855 0 14.2956 0 0 0 A0A2C9VIB4 Uncharacterized protein MANES_07G041100 A0A2C9VIB4_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial fission [GO:0000266];peroxisome fission [GO:0016559] cytoplasm [GO:0005737];membrane [GO:0016020];microtubule [GO:0005874];mitochondrion [GO:0005739];peroxisome [GO:0005777] cytoplasm [GO:0005737];membrane [GO:0016020];microtubule [GO:0005874];mitochondrion [GO:0005739];peroxisome [GO:0005777];GTP binding [GO:0005525];GTPase activity [GO:0003924];microtubule binding [GO:0008017];mitochondrial fission [GO:0000266];peroxisome fission [GO:0016559] GTPase activity [GO:0003924];GTP binding [GO:0005525];microtubule binding [GO:0008017] KNVEDSVPK 0.96438 14.297 0 0 0 14.297 0 0 0 A0A2C9VDA7 ZT_dimer domain-containing protein MANES_08G042500 A0A2C9VDA7_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];cation transmembrane transporter activity [GO:0008324];manganese ion transmembrane transporter activity [GO:0005384] cation transmembrane transporter activity [GO:0008324];manganese ion transmembrane transporter activity [GO:0005384] GFVQGEKEYYEK 0.9676 14.2973 0 0 0 14.2973 0 0 0 B1NWE9 Photosystem I P700 chlorophyll a apoprotein A2 (EC 1.97.1.12) (PSI-B) (PsaB) psaB B1NWE9_MANES Manihot esculenta (Cassava) (Jatropha manihot) photosynthesis [GO:0015979];protein-chromophore linkage [GO:0018298] chloroplast thylakoid membrane [GO:0009535];integral component of membrane [GO:0016021];photosystem I [GO:0009522] "chloroplast thylakoid membrane [GO:0009535];integral component of membrane [GO:0016021];photosystem I [GO:0009522];4 iron, 4 sulfur cluster binding [GO:0051539];chlorophyll binding [GO:0016168];electron transfer activity [GO:0009055];magnesium ion binding [GO:0000287];photosynthesis [GO:0015979];protein-chromophore linkage [GO:0018298]" "4 iron, 4 sulfur cluster binding [GO:0051539];chlorophyll binding [GO:0016168];electron transfer activity [GO:0009055];magnesium ion binding [GO:0000287]" TPLANLIR 0.96896 14.2976 0 0 0 14.2976 0 0 0 A0A2C9V555 Auxin response factor MANES_10G108100 A0A2C9V555_MANES Manihot esculenta (Cassava) (Jatropha manihot) "auxin-activated signaling pathway [GO:0009734];regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA binding [GO:0003677];auxin-activated signaling pathway [GO:0009734];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] ILCKVVNVQR 0.95304 14.3049 0 14.3049 0 0 0 0 0 A0A2C9WEU3 Uncharacterized protein MANES_02G100900 A0A2C9WEU3_MANES Manihot esculenta (Cassava) (Jatropha manihot) ENVDDILYPYRK 0.99182 14.3049 0 0 14.3049 0 0 0 0 A0A2C9VBW6 Uncharacterized protein MANES_09G139300 A0A2C9VBW6_MANES Manihot esculenta (Cassava) (Jatropha manihot) endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021] LEGSGAHR 0.99174 14.3302 0 0 14.3302 0 0 0 0 A0A2C9W1G3 XH domain-containing protein MANES_04G104000 A0A2C9W1G3_MANES Manihot esculenta (Cassava) (Jatropha manihot) LELEIEELKWELEVMK 0.95539 14.3309 0 0 14.3309 0 0 0 0 A0A2C9VAX8 YTH domain-containing protein MANES_09G141700 A0A2C9VAX8_MANES Manihot esculenta (Cassava) (Jatropha manihot) mRNA destabilization [GO:0061157] cytoplasm [GO:0005737] cytoplasm [GO:0005737];mRNA binding [GO:0003729];mRNA destabilization [GO:0061157] mRNA binding [GO:0003729] IMQEKRAK 0.97012 14.3444 0 0 14.3444 0 0 0 0 A0A2C9U2V1 Tubby-like F-box protein MANES_18G091900 A0A2C9U2V1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" "regulation of transcription, DNA-templated [GO:0006355]" DVRDGFGSLSR 0.9706 14.3449 0 0 0 14.3449 0 0 0 A0A2C9W783 MBOAT_2 domain-containing protein MANES_03G134900 A0A2C9W783_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid metabolic process [GO:0006629] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];O-acyltransferase activity [GO:0008374];lipid metabolic process [GO:0006629] O-acyltransferase activity [GO:0008374] DMDMELK 0.96785 14.3483 0 14.3483 0 0 0 0 0 A0A2C9V610 Structural maintenance of chromosomes protein 5 MANES_10G136400 A0A2C9V610_MANES Manihot esculenta (Cassava) (Jatropha manihot) double-strand break repair via homologous recombination [GO:0000724];sister chromatid cohesion [GO:0007062] nucleus [GO:0005634];Smc5-Smc6 complex [GO:0030915] nucleus [GO:0005634];Smc5-Smc6 complex [GO:0030915];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];double-strand break repair via homologous recombination [GO:0000724];sister chromatid cohesion [GO:0007062] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] LPWLKYDMK 0.9602 14.3535 0 14.3535 0 0 0 0 0 A0A2C9U0V8 Uncharacterized protein MANES_18G027500 A0A2C9U0V8_MANES Manihot esculenta (Cassava) (Jatropha manihot) VASCALK 0.95604 14.36 0 0 14.36 0 0 0 0 A0A2C9UR73 Prolyl endopeptidase (EC 3.4.21.-) MANES_13G130700 A0A2C9UR73_MANES Manihot esculenta (Cassava) (Jatropha manihot) serine-type endopeptidase activity [GO:0004252] serine-type endopeptidase activity [GO:0004252] DGQALLYVVTDQYK 0.98123 14.3619 0 14.3619 0 0 0 0 0 A0A199UBJ8 Receptor-like serine/threonine-protein kinase (EC 2.7.11.1) MANES_S052400 A0A199UBJ8_MANES Manihot esculenta (Cassava) (Jatropha manihot) recognition of pollen [GO:0048544] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];recognition of pollen [GO:0048544] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] FNIIVGIAR 0.9434 14.363 0 0 14.363 0 0 0 0 A0A251JU07 YL1_C domain-containing protein MANES_11G097800 A0A251JU07_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin remodeling [GO:0006338] Ino80 complex [GO:0031011] Ino80 complex [GO:0031011];chromatin remodeling [GO:0006338] MEPEVVR 0.9674 14.3633 0 0 0 14.3633 0 0 0 A0A2C9VK12 Uncharacterized protein MANES_07G097600 A0A2C9VK12_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin remodeling [GO:0006338];regulation of macromolecule metabolic process [GO:0060255] nucleus [GO:0005634] nucleus [GO:0005634];histone demethylase activity [GO:0032452];histone H3-tri/di/monomethyl-lysine-4 demethylase activity [GO:0034647];chromatin remodeling [GO:0006338];regulation of macromolecule metabolic process [GO:0060255] histone demethylase activity [GO:0032452];histone H3-tri/di/monomethyl-lysine-4 demethylase activity [GO:0034647] EEITKRSHK 0.96397 14.3694 0 0 0 14.3694 0 0 0 A0A2C9VCK8 Uncharacterized protein MANES_09G146600 A0A2C9VCK8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] CLAIYHIR 0.96706 14.3862 0 14.3862 0 0 0 0 0 A0A2C9W9H3 Uncharacterized protein MANES_03G139900 A0A2C9W9H3_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872] metal ion binding [GO:0046872] FCTLHNSVK 0.96243 14.3894 0 14.3894 0 0 0 0 0 A0A251IW45 Uncharacterized protein MANES_17G093600 A0A251IW45_MANES Manihot esculenta (Cassava) (Jatropha manihot) GLMDEADR 0.94995 14.3914 0 0 14.3914 0 0 0 0 A0A2C9V9I7 Uncharacterized protein MANES_09G102700 A0A2C9V9I7_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA binding [GO:0003677] DNA binding [GO:0003677] WQKVAAMIPGK 0.95894 14.4049 0 0 0 14.4049 0 0 0 A0A251KHB9 SWIM-type domain-containing protein MANES_07G049700 A0A251KHB9_MANES Manihot esculenta (Cassava) (Jatropha manihot) zinc ion binding [GO:0008270] zinc ion binding [GO:0008270] NAIKEAAIAQHFELR 0.95672 14.4061 0 0 14.4061 0 0 0 0 A0A251L5Y0 Uncharacterized protein MANES_03G017400 A0A251L5Y0_MANES Manihot esculenta (Cassava) (Jatropha manihot) GGSLEEAFR 0.96233 14.4093 0 0 14.4093 0 0 0 0 A0A2C9UAR5 Uncharacterized protein MANES_16G105000 A0A2C9UAR5_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] cytosolic small ribosomal subunit [GO:0022627] cytosolic small ribosomal subunit [GO:0022627];structural constituent of ribosome [GO:0003735];translation [GO:0006412] structural constituent of ribosome [GO:0003735] AKDLEAYR 0.9638 14.4093 0 0 14.4093 0 0 0 0 A0A2C9WK57 TPX2 domain-containing protein MANES_01G121900 A0A2C9WK57_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitotic spindle assembly [GO:0090307];regulation of mitotic spindle organization [GO:0060236] cytoplasm [GO:0005737];mitotic spindle [GO:0072686];nuclear microtubule [GO:0005880] cytoplasm [GO:0005737];mitotic spindle [GO:0072686];nuclear microtubule [GO:0005880];microtubule binding [GO:0008017];protein kinase activator activity [GO:0030295];mitotic spindle assembly [GO:0090307];regulation of mitotic spindle organization [GO:0060236] microtubule binding [GO:0008017];protein kinase activator activity [GO:0030295] AQLMPFFDRPFFPQRSNR 0.96141 14.4165 0 0 0 14.4165 0 0 0 A0A2C9VBX3 Uncharacterized protein MANES_09G182600 A0A2C9VBX3_MANES Manihot esculenta (Cassava) (Jatropha manihot) GVIGNCLCLKK 0.96013 14.4192 0 0 0 14.4192 0 0 0 A0A2C9V213 Ferritin (EC 1.16.3.1) MANES_10G008900 A0A2C9V213_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular sequestering of iron ion [GO:0006880];iron ion transport [GO:0006826] chloroplast [GO:0009507];cytoplasm [GO:0005737] chloroplast [GO:0009507];cytoplasm [GO:0005737];ferric iron binding [GO:0008199];ferrous iron binding [GO:0008198];ferroxidase activity [GO:0004322];intracellular sequestering of iron ion [GO:0006880];iron ion transport [GO:0006826] ferric iron binding [GO:0008199];ferrous iron binding [GO:0008198];ferroxidase activity [GO:0004322] YSDECEIALNEQINVEYNVSYVYHAMFAYFDRDNVALK 1.0571 14.4262 0 14.4262 0 0 0 0 0 A0A251K3U8 Uncharacterized protein MANES_12G081200 A0A251K3U8_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to virus [GO:0051607];gene silencing by RNA [GO:0031047] defense response to virus [GO:0051607];gene silencing by RNA [GO:0031047] NNGGSGK 0.97911 14.4353 0 0 0 14.4353 0 0 0 A0A2C9VWB9 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) MANES_05G146600 A0A2C9VWB9_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein folding [GO:0006457];protein peptidyl-prolyl isomerization [GO:0000413] cytoplasm [GO:0005737] cytoplasm [GO:0005737];cyclosporin A binding [GO:0016018];peptidyl-prolyl cis-trans isomerase activity [GO:0003755];protein folding [GO:0006457];protein peptidyl-prolyl isomerization [GO:0000413] cyclosporin A binding [GO:0016018];peptidyl-prolyl cis-trans isomerase activity [GO:0003755] FADENFIK 0.96703 14.4355 0 14.4355 0 0 0 0 0 A0A2C9UBM0 Uncharacterized protein MANES_16G108200 A0A2C9UBM0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524] ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524] TVYSFTAEK 0.96299 14.4362 0 14.4362 0 0 0 0 0 A0A2C9UCK1 Uncharacterized protein MANES_16G137600 A0A2C9UCK1_MANES Manihot esculenta (Cassava) (Jatropha manihot) galactose metabolic process [GO:0006012] cytosol [GO:0005829] cytosol [GO:0005829];ATP binding [GO:0005524];L-arabinokinase activity [GO:0009702];galactose metabolic process [GO:0006012] ATP binding [GO:0005524];L-arabinokinase activity [GO:0009702] DVIDVPLVVR 0.97983 14.4391 0 0 0 14.4391 0 0 0 A0A2C9W3L9 Uncharacterized protein MANES_04G133500 A0A2C9W3L9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] MLLHVEIINLFRGFCSFVR 0.97123 14.4458 0 0 14.4458 0 0 0 0 A0A2C9VH45 Uncharacterized protein MANES_08G174000 A0A2C9VH45_MANES Manihot esculenta (Cassava) (Jatropha manihot) ILSQPEESISSELHK 0.96963 14.4679 0 0 0 14.4679 0 0 0 A0A2C9WMD6 NAB domain-containing protein MANES_01G204900 A0A2C9WMD6_MANES Manihot esculenta (Cassava) (Jatropha manihot) plasma membrane [GO:0005886] plasma membrane [GO:0005886];actin filament binding [GO:0051015] actin filament binding [GO:0051015] KVEITEK 0.94849 14.4775 0 0 14.4775 0 0 0 0 A0A2C9VBH5 Uncharacterized protein MANES_09G117800 A0A2C9VBH5_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleic acid binding [GO:0003676];RNA-DNA hybrid ribonuclease activity [GO:0004523] nucleic acid binding [GO:0003676];RNA-DNA hybrid ribonuclease activity [GO:0004523] EMEKICRDFLWHGR 0.96242 14.4816 0 14.4816 0 0 0 0 0 A0A2C9UZJ3 Protein kinase domain-containing protein MANES_11G042500 A0A2C9UZJ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] LIVYEFVSNNCLKSHIYVGR 0.96765 14.4882 0 0 14.4882 0 0 0 0 A0A2C9UDF8 TPT domain-containing protein MANES_15G057700 A0A2C9UDF8_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];antiporter activity [GO:0015297];nucleotide-sugar transmembrane transporter activity [GO:0005338];UDP-xylose transmembrane transporter activity [GO:0005464] antiporter activity [GO:0015297];nucleotide-sugar transmembrane transporter activity [GO:0005338];UDP-xylose transmembrane transporter activity [GO:0005464] TSEGAKR 0.94915 14.4995 0 0 0 14.4995 0 0 0 A0A2C9VSF7 Nop domain-containing protein MANES_06G117900 A0A2C9VSF7_MANES Manihot esculenta (Cassava) (Jatropha manihot) ribosome biogenesis [GO:0042254] box C/D RNP complex [GO:0031428];nucleolus [GO:0005730];small-subunit processome [GO:0032040] box C/D RNP complex [GO:0031428];nucleolus [GO:0005730];small-subunit processome [GO:0032040];snoRNA binding [GO:0030515];ribosome biogenesis [GO:0042254] snoRNA binding [GO:0030515] DLKPGDLEK 0.96019 14.5155 0 0 0 14.5155 0 0 0 A0A2C9VLS3 Pectate lyase (EC 4.2.2.2) MANES_07G107700 A0A2C9VLS3_MANES Manihot esculenta (Cassava) (Jatropha manihot) pectin catabolic process [GO:0045490] metal ion binding [GO:0046872];pectate lyase activity [GO:0030570];pectin catabolic process [GO:0045490] metal ion binding [GO:0046872];pectate lyase activity [GO:0030570] TFEYYTEKAADK 0.96402 14.5175 0 14.5175 0 0 0 0 0 A0A2C9V1A9 Uncharacterized protein MANES_11G104100 A0A2C9V1A9_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell surface receptor signaling pathway [GO:0007166] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];calcium ion binding [GO:0005509];polysaccharide binding [GO:0030247];protein serine/threonine kinase activity [GO:0004674];cell surface receptor signaling pathway [GO:0007166] ATP binding [GO:0005524];calcium ion binding [GO:0005509];polysaccharide binding [GO:0030247];protein serine/threonine kinase activity [GO:0004674] NTFGGYSCRCPLGMR 0.9634 14.5286 0 0 0 14.5286 0 0 0 A0A2C9WLQ9 Uncharacterized protein MANES_01G179100 A0A2C9WLQ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) PDIVTYNTLIDGFCK 0.97353 14.5435 0 0 14.5435 0 0 0 0 A0A2C9VWG5 Uncharacterized protein MANES_05G077400 A0A2C9VWG5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] RVTNGVEDTYGWR 0.97933 14.5436 0 0 0 14.5436 0 0 0 A0A140H8M2 WRKY transcription factor 18 MANES_08G170600 A0A140H8M2_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] ILNTFTSSLSILNR 0.97874 14.5449 0 0 14.5449 0 0 0 0 A0A2C9VVM8 F-box domain-containing protein MANES_05G124500 A0A2C9VVM8_MANES Manihot esculenta (Cassava) (Jatropha manihot) EKETPENGYQDSSPK 0.97699 14.5638 0 0 14.5638 0 0 0 0 A0A2C9VB41 Calcium-transporting ATPase (EC 7.2.2.10) MANES_09G155100 A0A2C9VB41_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of plasma membrane [GO:0005887];intracellular membrane-bounded organelle [GO:0043231] integral component of plasma membrane [GO:0005887];intracellular membrane-bounded organelle [GO:0043231];ATP binding [GO:0005524];ATPase-coupled cation transmembrane transporter activity [GO:0019829];P-type calcium transporter activity [GO:0005388] ATPase-coupled cation transmembrane transporter activity [GO:0019829];ATP binding [GO:0005524];P-type calcium transporter activity [GO:0005388] NLEERTPLQAR 0.95424 14.5664 0 0 14.5664 0 0 0 0 A0A2C9WNZ7 BTB domain-containing protein MANES_01G250200 A0A2C9WNZ7_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to red light [GO:0010114] nucleus [GO:0005634] nucleus [GO:0005634];response to red light [GO:0010114] IVEFELPR 0.96783 14.5754 0 0 0 14.5754 0 0 0 A0A2C9VSA8 Protein translocase subunit SecA MANES_05G009000 A0A2C9VSA8_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein import [GO:0017038];protein targeting [GO:0006605] membrane [GO:0016020] membrane [GO:0016020];ABC-type protein transporter activity [GO:0015462];ATP binding [GO:0005524];chloroplast protein-transporting ATPase activity [GO:0016464];protein import [GO:0017038];protein targeting [GO:0006605] ABC-type protein transporter activity [GO:0015462];ATP binding [GO:0005524];chloroplast protein-transporting ATPase activity [GO:0016464] VEDLPIESKMLTK 0.9745 14.5899 0 0 14.5899 0 0 0 0 A0A2C9UAK8 Uncharacterized protein MANES_16G106300 A0A2C9UAK8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] RADLPPR 0.96701 14.594 0 0 0 14.594 0 0 0 A0A2C9WC49 Receptor-like serine/threonine-protein kinase (EC 2.7.11.1) MANES_02G087600 A0A2C9WC49_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] MMKVAAWCLQKDHAMR 0.96254 14.6034 0 0 0 14.6034 0 0 0 A0A251KBI6 Uncharacterized protein MANES_08G061500 A0A251KBI6_MANES Manihot esculenta (Cassava) (Jatropha manihot) transmembrane transport [GO:0055085] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524];ATPase-coupled transmembrane transporter activity [GO:0042626];transmembrane transport [GO:0055085] ABC-type transporter activity [GO:0140359];ATPase-coupled transmembrane transporter activity [GO:0042626];ATP binding [GO:0005524] AFASGQAAAYKMFETINR 0.96686 14.6034 0 0 0 14.6034 0 0 0 A0A2C9VGX4 Cyclin MANES_08G121100 A0A2C9VGX4_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079] protein kinase binding [GO:0019901];regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079] protein kinase binding [GO:0019901] FLHQMDACLTSFNVHR 0.9709 14.6034 0 0 0 14.6034 0 0 0 A0A2C9VYJ8 Vacuolar protein sorting-associated protein 41 homolog MANES_04G011800 A0A2C9VYJ8_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular response to starvation [GO:0009267];endosomal vesicle fusion [GO:0034058];macroautophagy [GO:0016236];protein targeting to vacuole [GO:0006623] HOPS complex [GO:0030897];late endosome [GO:0005770] HOPS complex [GO:0030897];late endosome [GO:0005770];cellular response to starvation [GO:0009267];endosomal vesicle fusion [GO:0034058];macroautophagy [GO:0016236];protein targeting to vacuole [GO:0006623] EARRAVCLTSEGDGAR 0.96222 14.6057 0 0 14.6057 0 0 0 0 A0A2C9UT13 Uncharacterized protein MANES_13G118600 A0A2C9UT13_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell division [GO:0051301];protein localization to microtubule plus-end [GO:1904825];regulation of microtubule polymerization or depolymerization [GO:0031110];spindle assembly [GO:0051225];thigmotropism [GO:0009652] cytoplasmic microtubule [GO:0005881];microtubule organizing center [GO:0005815];microtubule plus-end [GO:0035371];spindle midzone [GO:0051233] cytoplasmic microtubule [GO:0005881];microtubule organizing center [GO:0005815];microtubule plus-end [GO:0035371];spindle midzone [GO:0051233];microtubule plus-end binding [GO:0051010];cell division [GO:0051301];protein localization to microtubule plus-end [GO:1904825];regulation of microtubule polymerization or depolymerization [GO:0031110];spindle assembly [GO:0051225];thigmotropism [GO:0009652] microtubule plus-end binding [GO:0051010] CGASQPSAK 0.97745 14.608 0 0 0 14.608 0 0 0 A0A2C9V1P8 Uncharacterized protein MANES_11G118300 A0A2C9V1P8_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872];ubiquitin-protein transferase activity [GO:0004842] metal ion binding [GO:0046872];ubiquitin-protein transferase activity [GO:0004842] ELEQFLNAEGPSKEFDEFR 1.0048 14.6296 0 14.6296 0 0 0 0 0 A0A2C9UXS7 GMC_OxRdtase_N domain-containing protein MANES_11G026400 A0A2C9UXS7_MANES Manihot esculenta (Cassava) (Jatropha manihot) "flavin adenine dinucleotide binding [GO:0050660];oxidoreductase activity, acting on CH-OH group of donors [GO:0016614]" "flavin adenine dinucleotide binding [GO:0050660];oxidoreductase activity, acting on CH-OH group of donors [GO:0016614]" VGWDERLVNESYPWIEKQIVHSPSVAPWQVALR 0.95455 14.6333 0 14.6333 0 0 0 0 0 A0A251L1B6 Bromo domain-containing protein MANES_04G067000 A0A251L1B6_MANES Manihot esculenta (Cassava) (Jatropha manihot) RGRPPTK 0.96119 14.6383 0 0 14.6383 0 0 0 0 A0A2C9V3Q0 Uncharacterized protein MANES_10G063900 A0A2C9V3Q0_MANES Manihot esculenta (Cassava) (Jatropha manihot) poly(A)+ mRNA export from nucleus [GO:0016973] DNA binding [GO:0003677];metal ion binding [GO:0046872];mRNA binding [GO:0003729];poly(A)+ mRNA export from nucleus [GO:0016973] DNA binding [GO:0003677];metal ion binding [GO:0046872];mRNA binding [GO:0003729] PDSPEPIDGSDLRYRLSK 0.96637 14.6435 0 0 0 14.6435 0 0 0 A0A2C9V3J1 Protein kinase domain-containing protein MANES_10G054200 A0A2C9V3J1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] SNKELPAGSSLNEDSLQR 0.97965 14.6585 0 14.6585 0 0 0 0 0 A0A2C9UGG1 Hydrolase_4 domain-containing protein MANES_15G153700 A0A2C9UGG1_MANES Manihot esculenta (Cassava) (Jatropha manihot) GGNHCDLEHFPEYIRHLKK 0.96012 14.6593 0 14.6593 0 0 0 0 0 A0A2C9UYE8 Uncharacterized protein MANES_11G043800 A0A2C9UYE8_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] QEDVFEEIK 0.96265 14.6749 0 0 0 14.6749 0 0 0 A0A2C9U8Y0 BTB domain-containing protein MANES_16G050900 A0A2C9U8Y0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "defense response to bacterium [GO:0042742];defense response to fungus [GO:0050832];regulation of jasmonic acid mediated signaling pathway [GO:2000022];regulation of salicylic acid mediated signaling pathway [GO:2000031];systemic acquired resistance, salicylic acid mediated signaling pathway [GO:0009862]" nucleus [GO:0005634] "nucleus [GO:0005634];defense response to bacterium [GO:0042742];defense response to fungus [GO:0050832];regulation of jasmonic acid mediated signaling pathway [GO:2000022];regulation of salicylic acid mediated signaling pathway [GO:2000031];systemic acquired resistance, salicylic acid mediated signaling pathway [GO:0009862]" GVNGNFREVDLNETPMIQKK 0.97595 14.6846 0 0 14.6846 0 0 0 0 A0A2C9V6Q7 Methyltransferase (EC 2.1.1.-) MANES_09G008600 A0A2C9V6Q7_MANES Manihot esculenta (Cassava) (Jatropha manihot) methylation [GO:0032259] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231];methyltransferase activity [GO:0008168];methylation [GO:0032259] methyltransferase activity [GO:0008168] LFCLVPPPEDYK 0.94791 14.688 0 14.688 0 0 0 0 0 A0A2C9W3U3 Flavin-containing monooxygenase (EC 1.-.-.-) MANES_03G020600 A0A2C9W3U3_MANES Manihot esculenta (Cassava) (Jatropha manihot) "flavin adenine dinucleotide binding [GO:0050660];N,N-dimethylaniline monooxygenase activity [GO:0004499];NADP binding [GO:0050661]" "flavin adenine dinucleotide binding [GO:0050660];N,N-dimethylaniline monooxygenase activity [GO:0004499];NADP binding [GO:0050661]" GGNGIYAAGFTK 0.95607 14.6909 0 0 14.6909 0 0 0 0 A0A2C9UQ58 AAA domain-containing protein MANES_13G083000 A0A2C9UQ58_MANES Manihot esculenta (Cassava) (Jatropha manihot) proteolysis [GO:0006508] chloroplast thylakoid [GO:0009534];membrane [GO:0016020] chloroplast thylakoid [GO:0009534];membrane [GO:0016020];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];ATP-dependent peptidase activity [GO:0004176];metalloendopeptidase activity [GO:0004222];proteolysis [GO:0006508] ATP binding [GO:0005524];ATP-dependent peptidase activity [GO:0004176];ATP hydrolysis activity [GO:0016887];metalloendopeptidase activity [GO:0004222] LEALRDEYMRYSVEK 0.9795 14.6964 0 14.6964 0 0 0 0 0 A0A2C9V2T5 Peroxidase (EC 1.11.1.7) MANES_11G126600 A0A2C9V2T5_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrogen peroxide catabolic process [GO:0042744];response to oxidative stress [GO:0006979] extracellular region [GO:0005576];plant-type cell wall [GO:0009505] extracellular region [GO:0005576];plant-type cell wall [GO:0009505];heme binding [GO:0020037];metal ion binding [GO:0046872];peroxidase activity [GO:0004601];hydrogen peroxide catabolic process [GO:0042744];response to oxidative stress [GO:0006979] heme binding [GO:0020037];metal ion binding [GO:0046872];peroxidase activity [GO:0004601] KLCPPRTK 0.96932 14.6969 0 14.6969 0 0 0 0 0 A0A2C9VXP0 Uncharacterized protein MANES_05G191200 A0A2C9VXP0_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to auxin [GO:0009733] response to auxin [GO:0009733] NVQGMIDKEK 0.95883 14.7118 0 0 0 14.7118 0 0 0 A0A2C9V7L2 HTH myb-type domain-containing protein MANES_09G033500 A0A2C9V7L2_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] IRWTQDLHEK 0.96936 14.7346 0 14.7346 0 0 0 0 0 A0A2C9UEQ9 Uncharacterized protein MANES_15G068700 A0A2C9UEQ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) endocytic recycling [GO:0032456];protein transport [GO:0015031] endosome [GO:0005768] endosome [GO:0005768];endocytic recycling [GO:0032456];protein transport [GO:0015031] AWHAEDRVTALK 0.96378 14.7394 0 14.7394 0 0 0 0 0 A0A2C9ULV0 Uncharacterized protein MANES_14G149100 A0A2C9ULV0_MANES Manihot esculenta (Cassava) (Jatropha manihot) VKPDGLACSVMIKELCLK 0.96598 14.7464 0 0 14.7464 0 0 0 0 A0A2C9VK83 Histidine kinase domain-containing protein MANES_07G101500 A0A2C9VK83_MANES Manihot esculenta (Cassava) (Jatropha manihot) negative regulation of ethylene-activated signaling pathway [GO:0010105] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021];ethylene binding [GO:0051740];phosphorelay sensor kinase activity [GO:0000155];negative regulation of ethylene-activated signaling pathway [GO:0010105] ethylene binding [GO:0051740];phosphorelay sensor kinase activity [GO:0000155] NDFLAVMNHEMR 0.95613 14.7502 0 0 0 14.7502 0 0 0 A0A2C9WFJ3 Uncharacterized protein MANES_02G121900 A0A2C9WFJ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] EPSAGEVQVSGVNQR 0.97348 14.7567 0 14.7567 0 0 0 0 0 A0A2C9V372 Uncharacterized protein MANES_11G153500 A0A2C9V372_MANES Manihot esculenta (Cassava) (Jatropha manihot) negative regulation of mitotic nuclear division [GO:0045839];regulation of DNA endoreduplication [GO:0032875] nucleus [GO:0005634] nucleus [GO:0005634];negative regulation of mitotic nuclear division [GO:0045839];regulation of DNA endoreduplication [GO:0032875] SEDHKPQQILPELDEK 0.98692 14.7609 0 14.7609 0 0 0 0 0 A0A2C9TZI3 DUF295 domain-containing protein MANES_18G008400 A0A2C9TZI3_MANES Manihot esculenta (Cassava) (Jatropha manihot) SFCEDVIYLNGFFYAVNK 0.98002 14.7712 0 14.7712 0 0 0 0 0 A0A2C9VLL1 Uncharacterized protein MANES_06G005600 A0A2C9VLL1_MANES Manihot esculenta (Cassava) (Jatropha manihot) ubiquitin-dependent ERAD pathway [GO:0030433] ubiquitin-dependent ERAD pathway [GO:0030433] GNAGAMYKLGLFYYFGLRGMR 0.95442 14.7766 0 14.7766 0 0 0 0 0 A0A2C9VYZ8 Uncharacterized protein MANES_04G021700 A0A2C9VYZ8_MANES Manihot esculenta (Cassava) (Jatropha manihot) "isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway [GO:0019288];terpenoid biosynthetic process [GO:0016114]" chloroplast [GO:0009507] "chloroplast [GO:0009507];4 iron, 4 sulfur cluster binding [GO:0051539];4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity [GO:0046429];iron ion binding [GO:0005506];isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway [GO:0019288];terpenoid biosynthetic process [GO:0016114]" "4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity [GO:0046429];4 iron, 4 sulfur cluster binding [GO:0051539];iron ion binding [GO:0005506]" YCESVHKTVR 0.95584 14.7794 0 0 14.7794 0 0 0 0 A0A2C9U5P7 Uncharacterized protein MANES_17G065600 A0A2C9U5P7_MANES Manihot esculenta (Cassava) (Jatropha manihot) magnesium ion transport [GO:0015693] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];metal ion transmembrane transporter activity [GO:0046873];magnesium ion transport [GO:0015693] metal ion transmembrane transporter activity [GO:0046873] NLSVMGEDHSISQNNRMKK 0.97445 14.7824 0 0 14.7824 0 0 0 0 A0A2C9V6N3 Uncharacterized protein MANES_10G115400 A0A2C9V6N3_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] PPRQAQGY 0.96321 14.7974 0 0 0 14.7974 0 0 0 O24524 Linamarase (EC 3.2.1.21) pLIN-GEN O24524_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] beta-glucosidase activity [GO:0008422];scopolin beta-glucosidase activity [GO:0102483];carbohydrate metabolic process [GO:0005975] beta-glucosidase activity [GO:0008422];scopolin beta-glucosidase activity [GO:0102483] PNITVDPNFRTYK 0.97205 14.7975 0 0 14.7975 0 0 0 0 A0A2C9VEG3 Uncharacterized protein MANES_08G082100 A0A2C9VEG3_MANES Manihot esculenta (Cassava) (Jatropha manihot) LQCLPWK 0.95482 14.8087 0 14.8087 0 0 0 0 0 A0A2C9W7R4 Glutamate receptor MANES_03G103700 A0A2C9W7R4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ligand-gated ion channel activity [GO:0015276];signaling receptor activity [GO:0038023] ligand-gated ion channel activity [GO:0015276];signaling receptor activity [GO:0038023] VAMEIAKEDFYSYSNQSLALHIK 1.0014 14.8264 0 0 0 14.8264 0 0 0 A0A2C9W590 Uncharacterized protein MANES_04G151400 A0A2C9W590_MANES Manihot esculenta (Cassava) (Jatropha manihot) AYGPVYLVT 0.96264 14.8771 0 14.8771 0 0 0 0 0 A0A2C9VEQ1 PlsC domain-containing protein MANES_08G089900 A0A2C9VEQ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) cutin biosynthetic process [GO:0010143] integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];glycerol-3-phosphate 2-O-acyltransferase activity [GO:0090447];phosphatase activity [GO:0016791];cutin biosynthetic process [GO:0010143] glycerol-3-phosphate 2-O-acyltransferase activity [GO:0090447];phosphatase activity [GO:0016791] FYADDVHPETWR 1.0405 14.8925 0 0 14.8925 0 0 0 0 A0A2C9V7M8 Uncharacterized protein MANES_10G139200 A0A2C9V7M8_MANES Manihot esculenta (Cassava) (Jatropha manihot) oxidoreductase activity [GO:0016491] oxidoreductase activity [GO:0016491] FPYKFWPSGPEK 0.96373 14.9055 0 14.9055 0 0 0 0 0 A0A2C9VHP9 Glutathione synthetase (GSH-S) (EC 6.3.2.3) MANES_08G123500 A0A2C9VHP9_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytosol [GO:0005829] cytosol [GO:0005829];ATP binding [GO:0005524];glutathione binding [GO:0043295];glutathione synthase activity [GO:0004363];magnesium ion binding [GO:0000287] ATP binding [GO:0005524];glutathione binding [GO:0043295];glutathione synthase activity [GO:0004363];magnesium ion binding [GO:0000287] ARLLMEQSLAVK 0.79167 14.912 0 0 0 14.912 0 0 0 A0A2C9W7S4 Uncharacterized protein MANES_03G150200 A0A2C9W7S4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];peroxisome [GO:0005777] "integral component of membrane [GO:0016021];peroxisome [GO:0005777];acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]" "acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]" PNTSVSELGK 0.98496 14.9213 0 0 0 14.9213 0 0 0 A0A2C9V5C9 Non-lysosomal glucosylceramidase (NLGase) (EC 3.2.1.45) MANES_10G115000 A0A2C9V5C9_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975];glucosylceramide catabolic process [GO:0006680] membrane [GO:0016020] membrane [GO:0016020];glucosylceramidase activity [GO:0004348];carbohydrate metabolic process [GO:0005975];glucosylceramide catabolic process [GO:0006680] glucosylceramidase activity [GO:0004348] GFGYSFQTPEGWNTDGQYR 1.0615 14.9269 0 0 0 14.9269 0 0 0 A0A2C9UQJ6 DUF1681 domain-containing protein MANES_13G035700 A0A2C9UQJ6_MANES Manihot esculenta (Cassava) (Jatropha manihot) endocytosis [GO:0006897];vesicle-mediated transport [GO:0016192] clathrin vesicle coat [GO:0030125] clathrin vesicle coat [GO:0030125];endocytosis [GO:0006897];vesicle-mediated transport [GO:0016192] LKEGETIR 0.96209 14.9375 0 0 14.9375 0 0 0 0 A0A2C9UQA0 ATG13 domain-containing protein MANES_13G087300 A0A2C9UQA0_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitophagy [GO:0000423];piecemeal microautophagy of the nucleus [GO:0034727];protein localization to phagophore assembly site [GO:0034497] Atg1/ULK1 kinase complex [GO:1990316];cytosol [GO:0005829];extrinsic component of membrane [GO:0019898];phagophore assembly site [GO:0000407] Atg1/ULK1 kinase complex [GO:1990316];cytosol [GO:0005829];extrinsic component of membrane [GO:0019898];phagophore assembly site [GO:0000407];mitophagy [GO:0000423];piecemeal microautophagy of the nucleus [GO:0034727];protein localization to phagophore assembly site [GO:0034497] DPANSSLKKDLFR 0.95722 14.9393 0 0 14.9393 0 0 0 0 A0A2C9UH99 Uncharacterized protein MANES_14G003700 A0A2C9UH99_MANES Manihot esculenta (Cassava) (Jatropha manihot) QASLLQRR 0.97025 14.9395 0 0 0 14.9395 0 0 0 A0A2C9W630 3-hydroxy-3-methylglutaryl coenzyme A reductase (HMG-CoA reductase) (EC 1.1.1.34) MANES_03G096600 A0A2C9W630_MANES Manihot esculenta (Cassava) (Jatropha manihot) coenzyme A metabolic process [GO:0015936];isoprenoid biosynthetic process [GO:0008299];sterol biosynthetic process [GO:0016126] endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021];peroxisomal membrane [GO:0005778] endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021];peroxisomal membrane [GO:0005778];hydroxymethylglutaryl-CoA reductase (NADPH) activity [GO:0004420];coenzyme A metabolic process [GO:0015936];isoprenoid biosynthetic process [GO:0008299];sterol biosynthetic process [GO:0016126] hydroxymethylglutaryl-CoA reductase (NADPH) activity [GO:0004420] DSSRQPTSGKPMNSDNVK 0.96597 14.9679 0 14.9679 0 0 0 0 0 A0A2C9WJ26 Uncharacterized protein MANES_01G091000 A0A2C9WJ26_MANES Manihot esculenta (Cassava) (Jatropha manihot) DRLPYSLYLCNK 0.96731 14.9726 0 0 0 14.9726 0 0 0 A0A2C9VF11 Uncharacterized protein MANES_08G021000 A0A2C9VF11_MANES Manihot esculenta (Cassava) (Jatropha manihot) mRNA cleavage [GO:0006379];mRNA polyadenylation [GO:0006378];termination of RNA polymerase II transcription [GO:0006369] cytoplasm [GO:0005737];mRNA cleavage factor complex [GO:0005849] cytoplasm [GO:0005737];mRNA cleavage factor complex [GO:0005849];mRNA binding [GO:0003729];RNA polymerase II complex binding [GO:0000993];mRNA cleavage [GO:0006379];mRNA polyadenylation [GO:0006378];termination of RNA polymerase II transcription [GO:0006369] mRNA binding [GO:0003729];RNA polymerase II complex binding [GO:0000993] ETPTEAVQQK 0.95933 15.0056 0 0 15.0056 0 0 0 0 A0A2C9W0I1 HECT-type E3 ubiquitin transferase (EC 2.3.2.26) MANES_04G074400 A0A2C9W0I1_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA endoreduplication [GO:0042023];trichome branching [GO:0010091] ubiquitin-protein transferase activity [GO:0004842];DNA endoreduplication [GO:0042023];trichome branching [GO:0010091] ubiquitin-protein transferase activity [GO:0004842] FDHGYTAKSPAVVNLLEIMGEFTPEQQR 1.0596 15.0144 0 0 0 15.0144 0 0 0 A0A2C9U9N7 Uncharacterized protein MANES_16G081600 A0A2C9U9N7_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" DPKNFPEPDK 0.95852 15.0275 0 15.0275 0 0 0 0 0 A0A2C9VEK0 Uncharacterized protein MANES_08G041800 A0A2C9VEK0_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA-dependent DNA replication [GO:0006261];DNA repair [GO:0006281] DNA replication factor C complex [GO:0005663];nucleus [GO:0005634] DNA replication factor C complex [GO:0005663];nucleus [GO:0005634];DNA repair [GO:0006281];DNA-dependent DNA replication [GO:0006261] SGWSVAWQWSR 0.95722 15.041 0 15.041 0 0 0 0 0 A0A2C9V1H1 Uncharacterized protein MANES_11G082900 A0A2C9V1H1_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi to plasma membrane transport [GO:0006893] Golgi to plasma membrane transport [GO:0006893] KEQGAQLRATLTVK 0.97775 15.0522 0 0 15.0522 0 0 0 0 A0A2C9UPC3 Protein kinase domain-containing protein MANES_13G069600 A0A2C9UPC3_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] GNSTEAK 0.95648 15.0592 0 0 15.0592 0 0 0 0 A0A2C9VZQ7 bHLH-MYC_N domain-containing protein MANES_05G177000 A0A2C9VZQ7_MANES Manihot esculenta (Cassava) (Jatropha manihot) FDDFAIK 0.95438 15.0666 0 15.0666 0 0 0 0 0 A0A2C9WE11 Uncharacterized protein MANES_02G064600 A0A2C9WE11_MANES Manihot esculenta (Cassava) (Jatropha manihot) TQLPSFNFPISSK 0.95829 15.0763 0 0 15.0763 0 0 0 0 A0A2C9W8R6 Phosphatidate cytidylyltransferase (EC 2.7.7.41) MANES_03G136500 A0A2C9W8R6_MANES Manihot esculenta (Cassava) (Jatropha manihot) CDP-diacylglycerol biosynthetic process [GO:0016024] endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021] endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021];phosphatidate cytidylyltransferase activity [GO:0004605];CDP-diacylglycerol biosynthetic process [GO:0016024] phosphatidate cytidylyltransferase activity [GO:0004605] RRSNEIPHELSK 0.96347 15.0763 0 0 15.0763 0 0 0 0 A0A2C9ULY5 NB-ARC domain-containing protein MANES_14G165100 A0A2C9ULY5_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] YQVDKVVEDCELYR 0.96107 15.085 0 15.085 0 0 0 0 0 A0A2C9VZL8 Uncharacterized protein MANES_04G048800 A0A2C9VZL8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] VLIKLGLGFRSR 0.94993 15.0866 0 0 0 15.0866 0 0 0 A0A2C9UM94 Uncharacterized protein MANES_14G166600 A0A2C9UM94_MANES Manihot esculenta (Cassava) (Jatropha manihot) COPII-coated ER to Golgi transport vesicle [GO:0030134];endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021] COPII-coated ER to Golgi transport vesicle [GO:0030134];endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021] GWAARNLDETDQCKR 0.97225 15.0908 0 0 0 15.0908 0 0 0 A0A2C9UVI0 Nicotinate phosphoribosyltransferase (EC 6.3.4.21) MANES_12G104000 A0A2C9UVI0_MANES Manihot esculenta (Cassava) (Jatropha manihot) NAD salvage [GO:0034355] cytosol [GO:0005829] cytosol [GO:0005829];nicotinate phosphoribosyltransferase activity [GO:0004516];nicotinate-nucleotide diphosphorylase (carboxylating) activity [GO:0004514];NAD salvage [GO:0034355] nicotinate-nucleotide diphosphorylase (carboxylating) activity [GO:0004514];nicotinate phosphoribosyltransferase activity [GO:0004516] EGYPLVDIMTGENEPSPK 0.96322 15.0991 0 15.0991 0 14.7411 0 0 0 A0A251IWS2 LOB domain-containing protein MANES_17G112700 A0A251IWS2_MANES Manihot esculenta (Cassava) (Jatropha manihot) MASSSYSISPCAACKSLR 0.9675 15.0991 0 15.0991 0 0 0 0 0 A0A2C9UT86 Fe2OG dioxygenase domain-containing protein MANES_12G031600 A0A2C9UT86_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] EFFINYAAK 0.9623 15.1175 0 15.1175 0 0 0 0 0 A0A2C9UAK6 Uncharacterized protein MANES_16G045800 A0A2C9UAK6_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell cycle [GO:0007049];cell differentiation [GO:0030154];negative regulation of G1/S transition of mitotic cell cycle [GO:2000134];regulation of transcription by RNA polymerase II [GO:0006357] chromatin [GO:0000785];nucleus [GO:0005634];transcription regulator complex [GO:0005667] chromatin [GO:0000785];nucleus [GO:0005634];transcription regulator complex [GO:0005667];RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977];cell cycle [GO:0007049];cell differentiation [GO:0030154];negative regulation of G1/S transition of mitotic cell cycle [GO:2000134];regulation of transcription by RNA polymerase II [GO:0006357] RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977] QPQCKPQVFCSVFVDWASAR 0.9683 15.1205 0 0 0 15.1205 0 0 0 A0A2C9WIV2 Transcription elongation factor SPT4 homolog MANES_01G004800 A0A2C9WIV2_MANES Manihot esculenta (Cassava) (Jatropha manihot) "chromatin organization [GO:0006325];mRNA processing [GO:0006397];positive regulation of DNA-templated transcription, elongation [GO:0032786];regulation of transcription elongation from RNA polymerase II promoter [GO:0034243]" DSIF complex [GO:0032044] "DSIF complex [GO:0032044];RNA polymerase II complex binding [GO:0000993];zinc ion binding [GO:0008270];chromatin organization [GO:0006325];mRNA processing [GO:0006397];positive regulation of DNA-templated transcription, elongation [GO:0032786];regulation of transcription elongation from RNA polymerase II promoter [GO:0034243]" RNA polymerase II complex binding [GO:0000993];zinc ion binding [GO:0008270] SWAARWLR 0.96467 15.1424 0 0 15.1424 0 0 0 0 A0A2C9UBN2 Uncharacterized protein MANES_16G137200 A0A2C9UBN2_MANES Manihot esculenta (Cassava) (Jatropha manihot) NGSDGTR 0.95599 15.1455 0 15.1455 0 0 0 0 0 A0A2C9WJU6 Phospholipase D (EC 3.1.4.4) MANES_01G069500 A0A2C9WJU6_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphatidylcholine metabolic process [GO:0046470];phospholipid catabolic process [GO:0009395] plasma membrane [GO:0005886] plasma membrane [GO:0005886];calcium ion binding [GO:0005509];N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290];phospholipase D activity [GO:0004630];phosphatidylcholine metabolic process [GO:0046470];phospholipid catabolic process [GO:0009395] calcium ion binding [GO:0005509];N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290];phospholipase D activity [GO:0004630] DGHEGKDCTLGDLLK 0.9638 15.1567 0 0 15.1567 0 0 0 0 A0A2C9VP89 ABC transporter domain-containing protein MANES_06G095100 A0A2C9VP89_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid transport [GO:0006869] integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231] integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231];ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524];ATPase-coupled transmembrane transporter activity [GO:0042626];lipid transporter activity [GO:0005319];lipid transport [GO:0006869] ABC-type transporter activity [GO:0140359];ATPase-coupled transmembrane transporter activity [GO:0042626];ATP binding [GO:0005524];lipid transporter activity [GO:0005319] VASSSGA 0.95478 15.1609 0 15.1609 0 0 0 0 0 A0A2C9USL1 F-box domain-containing protein MANES_12G013000 A0A2C9USL1_MANES Manihot esculenta (Cassava) (Jatropha manihot) GCVMVTAHAVLEKK 0.96758 15.1693 0 15.1693 0 0 0 0 0 A0A2C9WH76 Chorismate mutase (EC 5.4.99.5) (Fragment) MANES_01G030900 A0A2C9WH76_MANES Manihot esculenta (Cassava) (Jatropha manihot) aromatic amino acid family biosynthetic process [GO:0009073];chorismate metabolic process [GO:0046417];defense response to bacterium [GO:0042742];prephenate(2-) biosynthetic process [GO:1901747];tryptophan biosynthetic process [GO:0000162] cytoplasm [GO:0005737] cytoplasm [GO:0005737];chorismate mutase activity [GO:0004106];protein homodimerization activity [GO:0042803];aromatic amino acid family biosynthetic process [GO:0009073];chorismate metabolic process [GO:0046417];defense response to bacterium [GO:0042742];prephenate(2-) biosynthetic process [GO:1901747];tryptophan biosynthetic process [GO:0000162] chorismate mutase activity [GO:0004106];protein homodimerization activity [GO:0042803] FAASSPSYIRYSK 0.97595 15.1787 0 15.1787 0 0 0 0 0 A0A2C9WP78 Methyltransferase (EC 2.1.1.-) MANES_01G261600 A0A2C9WP78_MANES Manihot esculenta (Cassava) (Jatropha manihot) methylation [GO:0032259] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231];methyltransferase activity [GO:0008168];methylation [GO:0032259] methyltransferase activity [GO:0008168] ISSGSVEGITAEIFTENTELWK 0.94968 15.1964 0 15.1964 0 0 0 0 0 A0A2C9US90 Uncharacterized protein MANES_13G091600 A0A2C9US90_MANES Manihot esculenta (Cassava) (Jatropha manihot) ethylene-activated signaling pathway [GO:0009873] nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700];ethylene-activated signaling pathway [GO:0009873] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] EASVDKGYACQNLECPR 0.97289 15.1977 0 0 0 15.1977 0 0 0 A0A2C9VGA9 Protein kinase domain-containing protein MANES_08G090800 A0A2C9VGA9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] IGVSCSSSSPR 0.66667 15.2069 0 15.2069 0 0 0 0 0 A0A2C9V6H8 Phosphatidylinositol 4-phosphate 5-kinase (EC 2.7.1.68) MANES_09G005500 A0A2C9V6H8_MANES Manihot esculenta (Cassava) (Jatropha manihot) membrane [GO:0016020] membrane [GO:0016020];1-phosphatidylinositol-4-phosphate 5-kinase activity [GO:0016308];ATP binding [GO:0005524] 1-phosphatidylinositol-4-phosphate 5-kinase activity [GO:0016308];ATP binding [GO:0005524] QGETICKGHK 0.95298 15.2334 0 15.2334 0 0 0 0 0 A0A251LDH0 Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) MANES_02G005800 A0A251LDH0_MANES Manihot esculenta (Cassava) (Jatropha manihot) NAD biosynthetic process [GO:0009435] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ATP binding [GO:0005524];glutaminase activity [GO:0004359];NAD+ synthase (glutamine-hydrolyzing) activity [GO:0003952];NAD biosynthetic process [GO:0009435] ATP binding [GO:0005524];glutaminase activity [GO:0004359];NAD+ synthase (glutamine-hydrolyzing) activity [GO:0003952] IFYTVFMGSENSSESTR 0.95859 15.2598 0 15.2598 0 0 0 0 0 A0A2C9VUB0 WRKY domain-containing protein MANES_05G030900 A0A2C9VUB0_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] DILGANFPRGYYR 0.97451 15.2636 0 15.2636 0 0 0 0 0 A0A2C9VFU9 Protein kinase domain-containing protein MANES_08G126700 A0A2C9VFU9_MANES Manihot esculenta (Cassava) (Jatropha manihot) signal transduction [GO:0007165] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674];signal transduction [GO:0007165] ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] KFLDQDFSGAALAEFKR 1.0424 15.2668 0 0 15.2668 0 0 0 0 A0A2C9U9E1 Arp2/3 complex 34 kDa subunit MANES_16G060600 A0A2C9U9E1_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin filament polymerization [GO:0030041];Arp2/3 complex-mediated actin nucleation [GO:0034314];regulation of actin filament polymerization [GO:0030833] Arp2/3 protein complex [GO:0005885];cytoplasm [GO:0005737] Arp2/3 protein complex [GO:0005885];cytoplasm [GO:0005737];actin filament binding [GO:0051015];structural constituent of cytoskeleton [GO:0005200];actin filament polymerization [GO:0030041];Arp2/3 complex-mediated actin nucleation [GO:0034314];regulation of actin filament polymerization [GO:0030833] actin filament binding [GO:0051015];structural constituent of cytoskeleton [GO:0005200] IVLKHLASR 0.9563 15.2681 0 11.9073 0 15.2681 0 0 0 A0A2C9VDJ1 Uncharacterized protein MANES_09G160900 A0A2C9VDJ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) aromatic amino acid family biosynthetic process [GO:0009073];cellular amino acid biosynthetic process [GO:0008652];chorismate biosynthetic process [GO:0009423];shikimate metabolic process [GO:0019632] 3-dehydroquinate dehydratase activity [GO:0003855];shikimate 3-dehydrogenase (NADP+) activity [GO:0004764];aromatic amino acid family biosynthetic process [GO:0009073];cellular amino acid biosynthetic process [GO:0008652];chorismate biosynthetic process [GO:0009423];shikimate metabolic process [GO:0019632] 3-dehydroquinate dehydratase activity [GO:0003855];shikimate 3-dehydrogenase (NADP+) activity [GO:0004764] LIGYNTDCEASITAVEDALK 0.95533 15.2843 0 0 0 15.2843 0 0 0 Q5PYQ2 Fructose-bisphosphate aldolase (EC 4.1.2.13) (Fragment) Q5PYQ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) glycolytic process [GO:0006096] fructose-bisphosphate aldolase activity [GO:0004332];glycolytic process [GO:0006096] fructose-bisphosphate aldolase activity [GO:0004332] LASIGLENTEANR 0.95804 15.3015 0 15.3015 0 0 0 0 0 E2DQG2 Zeta-carotene desaturase (Fragment) ZDS E2DQG2_MANES Manihot esculenta (Cassava) (Jatropha manihot) oxidoreductase activity [GO:0016491] oxidoreductase activity [GO:0016491] MWDPVAYALGFIDCDNISAR 0.96252 15.3072 0 0 15.3072 0 0 0 0 A0A2C9VNU8 zinc_ribbon_12 domain-containing protein MANES_07G142000 A0A2C9VNU8_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of defense response to fungus [GO:1900150] regulation of defense response to fungus [GO:1900150] SRTSGLPEIDASEK 0.97571 15.3166 0 15.3166 0 0 0 0 0 A0A2C9W6C2 RING-type domain-containing protein MANES_03G106000 A0A2C9W6C2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] PQFIYNRHLHSNEQMVDR 0.96716 15.3225 0 0 15.3225 0 0 0 0 A0A2C9VT90 Kinesin-like protein MANES_05G044100 A0A2C9VT90_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoskeleton-dependent intracellular transport [GO:0030705];microtubule-based movement [GO:0007018] kinesin complex [GO:0005871];microtubule [GO:0005874] kinesin complex [GO:0005871];microtubule [GO:0005874];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777];plus-end-directed microtubule motor activity [GO:0008574];cytoskeleton-dependent intracellular transport [GO:0030705];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777];plus-end-directed microtubule motor activity [GO:0008574] INQEAENR 0.96948 15.335 0 0 0 15.335 0 0 0 A0A2C9UUP1 MSP domain-containing protein MANES_12G082500 A0A2C9UUP1_MANES Manihot esculenta (Cassava) (Jatropha manihot) endoplasmic reticulum membrane organization [GO:0090158];endoplasmic reticulum-plasma membrane tethering [GO:0061817] endoplasmic reticulum membrane [GO:0005789];plasma membrane [GO:0005886] endoplasmic reticulum membrane [GO:0005789];plasma membrane [GO:0005886];endoplasmic reticulum membrane organization [GO:0090158];endoplasmic reticulum-plasma membrane tethering [GO:0061817] KVWTLCK 0.96669 15.3699 0 0 15.3699 0 0 0 0 A0A2C9UX58 Uncharacterized protein MANES_11G005300 A0A2C9UX58_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];dipeptide transmembrane transporter activity [GO:0071916];tripeptide transmembrane transporter activity [GO:0042937] dipeptide transmembrane transporter activity [GO:0071916];tripeptide transmembrane transporter activity [GO:0042937] TILLSTMIYLTGLVLLTLTVSVIPMNHRK 0.8 15.3789 0 15.3789 0 0 0 0 0 A0A2C9VTI8 Uncharacterized protein MANES_05G005500 A0A2C9VTI8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] YVDIILFLFATASYLATLTIMVIHISRR 0.96471 15.3789 0 15.3789 0 0 0 0 0 A0A2C9WNL8 Galectin domain-containing protein MANES_01G192900 A0A2C9WNL8_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein glycosylation [GO:0006486] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021];carbohydrate binding [GO:0030246];galactosyltransferase activity [GO:0008378];glycosyltransferase activity [GO:0016757];protein glycosylation [GO:0006486] carbohydrate binding [GO:0030246];galactosyltransferase activity [GO:0008378];glycosyltransferase activity [GO:0016757] KWQAPPLLDGK 0.75 15.3839 0 15.3839 0 0 0 0 0 A0A2C9W5G4 Uncharacterized protein MANES_03G003600 A0A2C9W5G4_MANES Manihot esculenta (Cassava) (Jatropha manihot) centromere complex assembly [GO:0034508] Mis6-Sim4 complex [GO:0031511];nucleus [GO:0005634] Mis6-Sim4 complex [GO:0031511];nucleus [GO:0005634];centromere complex assembly [GO:0034508] QMQGDSNMVPDHHEEK 0.97161 15.3891 0 15.3891 0 0 0 0 0 A0A2C9WB79 Uncharacterized protein MANES_02G055200 A0A2C9WB79_MANES Manihot esculenta (Cassava) (Jatropha manihot) VVKEKQSSMK 0.96535 15.3897 0 0 15.3897 0 0 0 0 A0A2C9VZL7 Uncharacterized protein MANES_05G172700 A0A2C9VZL7_MANES Manihot esculenta (Cassava) (Jatropha manihot) RLFLHATHQK 0.96157 15.3905 0 0 15.3905 0 0 0 0 A0A2C9U7Q8 Protein DETOXIFICATION (Multidrug and toxic compound extrusion protein) MANES_16G007900 A0A2C9U7Q8_MANES Manihot esculenta (Cassava) (Jatropha manihot) xenobiotic detoxification by transmembrane export across the plasma membrane [GO:1990961] integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];antiporter activity [GO:0015297];transmembrane transporter activity [GO:0022857];xenobiotic transmembrane transporter activity [GO:0042910];xenobiotic detoxification by transmembrane export across the plasma membrane [GO:1990961] antiporter activity [GO:0015297];transmembrane transporter activity [GO:0022857];xenobiotic transmembrane transporter activity [GO:0042910] DRLDIWEEK 0.9599 15.4106 0 15.4106 0 0 0 0 0 A0A2C9W8D3 Uncharacterized protein MANES_03G089200 A0A2C9W8D3_MANES Manihot esculenta (Cassava) (Jatropha manihot) photosystem I assembly [GO:0048564] chloroplast [GO:0009507] chloroplast [GO:0009507];protein-disulfide reductase (NAD(P)) activity [GO:0047134];photosystem I assembly [GO:0048564] protein-disulfide reductase (NAD(P)) activity [GO:0047134] AKDVYEFTECPNCYGR 0.95536 15.4205 0 15.4205 0 0 0 0 0 A0A2C9WM99 Uncharacterized protein MANES_01G145800 A0A2C9WM99_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];ATP binding [GO:0005524];calcium ion binding [GO:0005509];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683];intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] ATP binding [GO:0005524];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calcium ion binding [GO:0005509];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683] TEDGIFK 0.98604 15.4398 0 15.4398 0 0 0 0 0 A0A251JUG3 RWP-RK domain-containing protein MANES_11G110900 A0A251JUG3_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA-binding transcription factor activity [GO:0003700] DNA-binding transcription factor activity [GO:0003700] VCVSWDNPEEPK 0.95499 15.4843 0 0 15.4843 0 0 0 0 A0A2C9W2G1 Lactamase_B domain-containing protein MANES_04G140400 A0A2C9W2G1_MANES Manihot esculenta (Cassava) (Jatropha manihot) NWLPLSSFSKNGFSQCRR 0.96101 15.4858 0 15.4858 0 0 0 0 0 A0A2C9WLW6 acidPPc domain-containing protein MANES_01G138300 A0A2C9WLW6_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid biosynthetic process [GO:0008610];protein N-linked glycosylation [GO:0006487] integral component of endoplasmic reticulum membrane [GO:0030176];intracellular membrane-bounded organelle [GO:0043231] integral component of endoplasmic reticulum membrane [GO:0030176];intracellular membrane-bounded organelle [GO:0043231];dolichyldiphosphatase activity [GO:0047874];lipid biosynthetic process [GO:0008610];protein N-linked glycosylation [GO:0006487] dolichyldiphosphatase activity [GO:0047874] VFQHEAFVK 0.97743 15.5416 0 0 15.5416 0 0 0 0 A0A2C9UI02 Uncharacterized protein MANES_15G149400 A0A2C9UI02_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650];carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650] FTDSYYISPDETMATQK 0.98087 15.5562 0 0 0 15.5562 0 0 0 A0A2C9VTP9 Casein kinase II subunit beta (CK II beta) MANES_05G057200 A0A2C9VTP9_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein kinase CK2 complex [GO:0005956] protein kinase CK2 complex [GO:0005956];protein kinase regulator activity [GO:0019887] protein kinase regulator activity [GO:0019887] DKERLSVPSSSTGK 0.96115 15.5666 0 0 15.5666 0 0 0 0 A0A2C9UUE3 Uncharacterized protein MANES_12G066900 A0A2C9UUE3_MANES Manihot esculenta (Cassava) (Jatropha manihot) diterpenoid biosynthetic process [GO:0016102];hydrocarbon biosynthetic process [GO:0120251] magnesium ion binding [GO:0000287];terpene synthase activity [GO:0010333];diterpenoid biosynthetic process [GO:0016102];hydrocarbon biosynthetic process [GO:0120251] magnesium ion binding [GO:0000287];terpene synthase activity [GO:0010333] DIKRVLDR 0.96862 15.5812 0 0 15.5812 0 0 0 0 A0A2C9WKA6 Uncharacterized protein MANES_01G084600 A0A2C9WKA6_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphatidylglycerol biosynthetic process [GO:0006655] "phosphatidylglycerophosphatase activity [GO:0008962];phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity [GO:0004439];protein tyrosine phosphatase activity [GO:0004725];protein tyrosine/serine/threonine phosphatase activity [GO:0008138];phosphatidylglycerol biosynthetic process [GO:0006655]" "phosphatidylglycerophosphatase activity [GO:0008962];phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity [GO:0004439];protein tyrosine/serine/threonine phosphatase activity [GO:0008138];protein tyrosine phosphatase activity [GO:0004725]" MIIEELKVGEVESGGEEK 0.96651 15.6018 0 0 15.6018 0 0 0 0 A0A2C9VZQ0 Uncharacterized protein (Fragment) MANES_04G051700 A0A2C9VZQ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular membrane-bounded organelle [GO:0043231] intracellular membrane-bounded organelle [GO:0043231] LDETHFLFEVEILDQK 0.97124 15.6018 0 0 15.6018 0 0 0 0 A0A2C9W138 Protein kinase domain-containing protein MANES_04G100300 A0A2C9W138_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell surface receptor signaling pathway [GO:0007166] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];calcium ion binding [GO:0005509];polysaccharide binding [GO:0030247];protein kinase activity [GO:0004672];cell surface receptor signaling pathway [GO:0007166] ATP binding [GO:0005524];calcium ion binding [GO:0005509];polysaccharide binding [GO:0030247];protein kinase activity [GO:0004672] LYKLIKK 0.96559 15.6032 0 0 0 15.6032 0 0 0 A0A2C9WLG0 DUF295 domain-containing protein MANES_01G152400 A0A2C9WLG0_MANES Manihot esculenta (Cassava) (Jatropha manihot) LPFPISPNPHLHPR 0.95935 15.6183 0 0 0 15.6183 0 0 0 A0A2C9VAX1 Uncharacterized protein MANES_09G099400 A0A2C9VAX1_MANES Manihot esculenta (Cassava) (Jatropha manihot) KALWSHKSFDGNSSDMTFEK 0.96174 15.626 0 0 15.626 0 0 0 0 A0A2C9U109 Uncharacterized protein MANES_18G009700 A0A2C9U109_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];ATP binding [GO:0005524];calcium ion binding [GO:0005509];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683];intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] ATP binding [GO:0005524];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calcium ion binding [GO:0005509];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683] LVNNKDIEDVR 0.96048 15.6341 0 0 0 15.6341 0 0 0 A0A199UB57 Uncharacterized protein MANES_S065300 A0A199UB57_MANES Manihot esculenta (Cassava) (Jatropha manihot) anatomical structure development [GO:0048856];response to chemical [GO:0042221] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];phosphorelay sensor kinase activity [GO:0000155];anatomical structure development [GO:0048856];response to chemical [GO:0042221] phosphorelay sensor kinase activity [GO:0000155] DPGTSLAMHSRSRK 0.9618 15.635 0 0 0 15.635 0 0 0 A0A2C9W4F9 Auxin response factor MANES_03G043900 A0A2C9W4F9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "auxin-activated signaling pathway [GO:0009734];regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA binding [GO:0003677];auxin-activated signaling pathway [GO:0009734];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] KVPPNGYMPNSAEGERK 0.95835 15.6547 0 0 15.6547 12.726 0 0 0 A0A2C9V288 Protein kinase domain-containing protein MANES_10G015600 A0A2C9V288_MANES Manihot esculenta (Cassava) (Jatropha manihot) hormone-mediated signaling pathway [GO:0009755] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];protein kinase activity [GO:0004672];hormone-mediated signaling pathway [GO:0009755] ATP binding [GO:0005524];protein kinase activity [GO:0004672] NKLMGSIPK 0.95939 15.6589 0 0 0 15.6589 0 0 0 A0A2C9VQ80 Signal recognition particle subunit SRP68 (SRP68) MANES_06G126200 A0A2C9VQ80_MANES Manihot esculenta (Cassava) (Jatropha manihot) SRP-dependent cotranslational protein targeting to membrane [GO:0006614] "signal recognition particle, endoplasmic reticulum targeting [GO:0005786]" "signal recognition particle, endoplasmic reticulum targeting [GO:0005786];7S RNA binding [GO:0008312];endoplasmic reticulum signal peptide binding [GO:0030942];signal recognition particle binding [GO:0005047];SRP-dependent cotranslational protein targeting to membrane [GO:0006614]" 7S RNA binding [GO:0008312];endoplasmic reticulum signal peptide binding [GO:0030942];signal recognition particle binding [GO:0005047] LDAYESVVGDANVK 0.96693 15.6596 0 15.6596 0 15.4962 0 0 0 A0A2C9VRR2 Auxin response factor MANES_06G126000 A0A2C9VRR2_MANES Manihot esculenta (Cassava) (Jatropha manihot) "auxin-activated signaling pathway [GO:0009734];regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA binding [GO:0003677];auxin-activated signaling pathway [GO:0009734];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] GDENLLDVEGMDAKDMKCLR 0.96239 15.665 0 0 0 15.665 0 0 0 A0A2C9U103 PPM-type phosphatase domain-containing protein MANES_18G067200 A0A2C9U103_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytosol [GO:0005829];nucleus [GO:0005634] cytosol [GO:0005829];nucleus [GO:0005634];protein serine/threonine phosphatase activity [GO:0004722] protein serine/threonine phosphatase activity [GO:0004722] DSKDDISCIVVR 0.96695 15.684 0 15.684 0 0 0 0 0 A0A2C9U498 Uncharacterized protein MANES_17G024800 A0A2C9U498_MANES Manihot esculenta (Cassava) (Jatropha manihot) QLQPPYAK 0.96936 15.6999 0 0 15.6999 0 0 0 0 A0A2C9URL4 Uncharacterized protein MANES_13G144200 A0A2C9URL4_MANES Manihot esculenta (Cassava) (Jatropha manihot) activation of protein kinase activity [GO:0032147];regulation of mitotic spindle organization [GO:0060236] cytoplasm [GO:0005737];microtubule [GO:0005874];nucleus [GO:0005634];spindle [GO:0005819] cytoplasm [GO:0005737];microtubule [GO:0005874];nucleus [GO:0005634];spindle [GO:0005819];activation of protein kinase activity [GO:0032147];regulation of mitotic spindle organization [GO:0060236] NAAGTPNLAQENQAIK 0.97127 15.7084 0 15.7084 0 0 0 0 0 A0A2C9UCL6 Uncharacterized protein MANES_15G041300 A0A2C9UCL6_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872] metal ion binding [GO:0046872] SVIDSLKK 0.96829 15.7106 0 15.7106 0 0 0 0 0 A0A2C9VSD4 Uncharacterized protein MANES_05G016000 A0A2C9VSD4_MANES Manihot esculenta (Cassava) (Jatropha manihot) zinc ion transmembrane transport [GO:0071577] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];vacuole [GO:0005773] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];vacuole [GO:0005773];zinc ion transmembrane transporter activity [GO:0005385];zinc ion transmembrane transport [GO:0071577] zinc ion transmembrane transporter activity [GO:0005385] VLLACHVK 0.96897 15.7175 0 15.7175 14.4201 0 0 0 0 A0A199UC05 Uncharacterized protein (Fragment) MANES_S023300 A0A199UC05_MANES Manihot esculenta (Cassava) (Jatropha manihot) PILLDSTWSNKKLK 0.97654 15.7247 0 0 15.7247 0 0 0 0 A0A2C9U126 Uncharacterized protein MANES_18G075300 A0A2C9U126_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565];regulation of transcription, DNA-templated [GO:0006355]" DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] EVNISFANHCQAKLLLGLFNDGYR 1.0109 15.7266 0 15.7266 0 0 0 0 0 A0A199U9V5 Uncharacterized protein MANES_S084600 A0A199U9V5_MANES Manihot esculenta (Cassava) (Jatropha manihot) CTYYQYHAQAR 0.95776 15.7312 0 15.7312 0 0 0 0 0 A0A2C9VCM9 Reverse transcriptase Ty1/copia-type domain-containing protein MANES_08G013900 A0A2C9VCM9_MANES Manihot esculenta (Cassava) (Jatropha manihot) EALCLGERVIMYLPR 0.95641 15.7639 0 15.7639 0 0 0 0 0 A0A2C9V5G0 Glyco_hyd_65N_2 domain-containing protein MANES_10G075700 A0A2C9V5G0_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] alpha-L-fucosidase activity [GO:0004560];carbohydrate metabolic process [GO:0005975] alpha-L-fucosidase activity [GO:0004560] CGWVVHHKSDIWAKSSADR 0.97446 15.7783 0 15.7783 14.7909 0 0 0 0 A0A2C9UPL2 J domain-containing protein MANES_13G062500 A0A2C9UPL2_MANES Manihot esculenta (Cassava) (Jatropha manihot) AGPVSITVPDPDFHDFDKDR 0.96441 15.7951 0 15.7951 0 13.1253 0 0 0 A0A2C9U394 Cir_N domain-containing protein MANES_17G000100 A0A2C9U394_MANES Manihot esculenta (Cassava) (Jatropha manihot) "negative regulation of transcription, DNA-templated [GO:0045892]" nucleus [GO:0005634] "nucleus [GO:0005634];transcription corepressor activity [GO:0003714];negative regulation of transcription, DNA-templated [GO:0045892]" transcription corepressor activity [GO:0003714] SRYKHYYSSEEYGGDR 0.97479 15.8031 0 15.8031 0 0 0 0 0 A0A2C9UQY3 Uncharacterized protein MANES_13G108500 A0A2C9UQY3_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];hydrolase activity [GO:0016787];nucleic acid binding [GO:0003676];RNA helicase activity [GO:0003724] ATP binding [GO:0005524];hydrolase activity [GO:0016787];nucleic acid binding [GO:0003676];RNA helicase activity [GO:0003724] VLIFTNSIDMSFR 0.95992 15.8046 0 15.8046 0 0 0 0 0 A0A251LCY0 Protein kinase domain-containing protein MANES_03G205200 A0A251LCY0_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] VSNKVKSK 0.96953 15.806 0 0 15.806 0 0 0 0 A0A2C9WGN5 C2 NT-type domain-containing protein MANES_02G157000 A0A2C9WGN5_MANES Manihot esculenta (Cassava) (Jatropha manihot) ESLQSLHDENQALVSSLDK 0.96359 15.8106 0 0 0 15.8106 0 0 0 A0A2C9U0Q2 Uncharacterized protein MANES_18G022900 A0A2C9U0Q2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] SGMLNTRR 0.96824 15.8377 0 14.0384 15.8377 0 0 0 0 A0A2C9W0U3 Complex I-B22 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9) (NADH-ubiquinone oxidoreductase B22 subunit) MANES_04G083400 A0A2C9W0U3_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mitochondrial electron transport, NADH to ubiquinone [GO:0006120]" mitochondrial respiratory chain complex I [GO:0005747] "mitochondrial respiratory chain complex I [GO:0005747];mitochondrial electron transport, NADH to ubiquinone [GO:0006120]" DTLNWAVHR 0.97962 15.845 0 0 15.845 0 0 0 0 A0A2C9UFV9 CRAL-TRIO domain-containing protein MANES_15G135200 A0A2C9UFV9_MANES Manihot esculenta (Cassava) (Jatropha manihot) membrane [GO:0016020] membrane [GO:0016020] LFILNMPR 0.95182 15.8538 0 15.3803 13.3699 15.8538 0 0 0 A0A2C9VCR1 Ribosome production factor 2 homolog (Ribosome biogenesis protein RPF2 homolog) MANES_08G020900 A0A2C9VCR1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463];ribosomal large subunit assembly [GO:0000027];RNA biosynthetic process [GO:0032774]" nucleolus [GO:0005730] "nucleolus [GO:0005730];rRNA binding [GO:0019843];maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463];ribosomal large subunit assembly [GO:0000027];RNA biosynthetic process [GO:0032774]" rRNA binding [GO:0019843] AYVCTAVSSNR 0.95837 15.8546 0 0 15.8546 0 0 0 0 A0A2C9U3V0 Glycosyltransferase (EC 2.4.1.-) MANES_18G104600 A0A2C9U3V0_MANES Manihot esculenta (Cassava) (Jatropha manihot) anthocyanin-containing compound biosynthetic process [GO:0009718] anthocyanidin 3-O-glucosyltransferase activity [GO:0047213];anthocyanin-containing compound biosynthetic process [GO:0009718] anthocyanidin 3-O-glucosyltransferase activity [GO:0047213] EKTWEMKQK 0.96325 15.8583 0 0 15.8583 0 0 0 0 A0A2C9VI17 Uncharacterized protein MANES_08G161400 A0A2C9VI17_MANES Manihot esculenta (Cassava) (Jatropha manihot) SLNHLLK 0.96829 15.8607 0 0 15.8607 0 0 0 0 A0A251IUM3 Vacuolar protein sorting-associated protein 28 homolog MANES_17G039800 A0A251IUM3_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway [GO:0043328] ESCRT I complex [GO:0000813] ESCRT I complex [GO:0000813];protein-containing complex binding [GO:0044877];protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway [GO:0043328] protein-containing complex binding [GO:0044877] EVKLWNDK 0.96293 15.8659 0 15.8659 0 0 0 0 0 A0A2C9WQD4 Hexosyltransferase (EC 2.4.1.-) MANES_01G211200 A0A2C9WQD4_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi apparatus [GO:0005794] Golgi apparatus [GO:0005794];glycosyltransferase activity [GO:0016757] glycosyltransferase activity [GO:0016757] SEPEVFSKINSTFPYLQFR 0.96842 15.8671 0 15.8671 0 0 0 0 0 A0A251JL19 BURP domain-containing protein MANES_12G028800 A0A251JL19_MANES Manihot esculenta (Cassava) (Jatropha manihot) KTTSFSDYR 0.96466 15.8693 0 15.8693 0 0 0 0 0 A0A251LSE0 PAPA-1 domain-containing protein MANES_03G204100 A0A251LSE0_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin remodeling [GO:0006338] Ino80 complex [GO:0031011] Ino80 complex [GO:0031011];chromatin remodeling [GO:0006338] AAREAEAEAIR 0.95889 15.9124 0 0 15.9124 0 0 0 0 A0A2C9U4I5 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase (EC 3.2.2.6) MANES_18G125400 A0A2C9U4I5_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953];defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953] FLKNLNLFYCCNLK 0.9635 15.9214 0 0 0 15.9214 0 0 0 A0A2C9VLZ6 HMA domain-containing protein MANES_06G012600 A0A2C9VLZ6_MANES Manihot esculenta (Cassava) (Jatropha manihot) copper ion homeostasis [GO:0055070] integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];ATP binding [GO:0005524];copper ion binding [GO:0005507];P-type divalent copper transporter activity [GO:0043682];copper ion homeostasis [GO:0055070] ATP binding [GO:0005524];copper ion binding [GO:0005507];P-type divalent copper transporter activity [GO:0043682] ARLLIHDDAK 0.98015 15.9214 0 12.5121 0 15.9214 0 0 0 V9K775 Glucan water dikinase 3 (Fragment) GWD3 V9K775_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];kinase activity [GO:0016301];starch binding [GO:2001070] ATP binding [GO:0005524];kinase activity [GO:0016301];starch binding [GO:2001070] GLESGLRNDAPDAAIAMRQK 0.96172 15.9315 0 15.9315 0 0 0 0 0 A0A2C9W2W8 Clu domain-containing protein MANES_04G110600 A0A2C9W2W8_MANES Manihot esculenta (Cassava) (Jatropha manihot) organelle organization [GO:0006996] cytoplasm [GO:0005737] cytoplasm [GO:0005737];organelle organization [GO:0006996] DYDMECPNPFRKFDIISIVPVCK 0.97558 15.9315 0 15.9315 0 14.5865 0 0 0 A0A251KEB1 Uncharacterized protein MANES_08G140900 A0A251KEB1_MANES Manihot esculenta (Cassava) (Jatropha manihot) thiamine metabolic process [GO:0006772] thiamine metabolic process [GO:0006772] LGDWGAIPWRR 0.95778 15.9625 0 15.9625 0 0 0 0 0 A0A2C9VE04 Uncharacterized protein MANES_08G065700 A0A2C9VE04_MANES Manihot esculenta (Cassava) (Jatropha manihot) deadenylation-dependent decapping of nuclear-transcribed mRNA [GO:0000290];P-body assembly [GO:0033962] P-body [GO:0000932] P-body [GO:0000932];RNA binding [GO:0003723];deadenylation-dependent decapping of nuclear-transcribed mRNA [GO:0000290];P-body assembly [GO:0033962] RNA binding [GO:0003723] QMELLRHFGQQR 0.96694 15.9676 0 0 15.9676 0 0 0 0 A0A2C9VTP7 RING-type domain-containing protein MANES_05G058100 A0A2C9VTP7_MANES Manihot esculenta (Cassava) (Jatropha manihot) MFWDAFSRNSFR 0.95518 15.9713 0 15.9713 0 15.7669 0 0 0 A0A2C9V2W9 RRM domain-containing protein MANES_10G029600 A0A2C9V2W9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA splicing, via spliceosome [GO:0000398]" cytoplasm [GO:0005737];nuclear speck [GO:0016607] "cytoplasm [GO:0005737];nuclear speck [GO:0016607];identical protein binding [GO:0042802];RNA binding [GO:0003723];mRNA splicing, via spliceosome [GO:0000398]" identical protein binding [GO:0042802];RNA binding [GO:0003723] GYGGRAR 0.96816 15.9744 0 13.0626 0 15.9744 0 0 0 A0A2C9US63 PKS_ER domain-containing protein MANES_13G117800 A0A2C9US63_MANES Manihot esculenta (Cassava) (Jatropha manihot) lignin biosynthetic process [GO:0009809] "cinnamyl-alcohol dehydrogenase activity [GO:0045551];oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616];zinc ion binding [GO:0008270];lignin biosynthetic process [GO:0009809]" "cinnamyl-alcohol dehydrogenase activity [GO:0045551];oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616];zinc ion binding [GO:0008270]" AMGHHVTVISSSEK 0.95999 16.0243 0 16.0243 0 0 0 0 0 A0A2C9VZ49 Uncharacterized protein MANES_04G028900 A0A2C9VZ49_MANES Manihot esculenta (Cassava) (Jatropha manihot) IKNRSSLSSSSSSK 0.95916 16.0338 0 0 0 16.0338 0 0 0 A0A0F6RAV0 Calcium/calmodulin-regulated receptor-like kinase CRLK1 MANES_15G078200 A0A0F6RAV0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] SSNILLDHSVRAR 0.96116 16.0529 0 0 16.0529 0 0 0 0 A0A2C9U6X6 Uncharacterized protein MANES_17G076200 A0A2C9U6X6_MANES Manihot esculenta (Cassava) (Jatropha manihot) DEAEATAKIMDLCMANK 0.95675 16.0579 0 16.0579 0 0 0 0 0 A0A2C9UR04 Remorin_C domain-containing protein MANES_13G124000 A0A2C9UR04_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to organic substance [GO:0010033];response to oxygen-containing compound [GO:1901700];response to stress [GO:0006950] response to organic substance [GO:0010033];response to oxygen-containing compound [GO:1901700];response to stress [GO:0006950] RDMATQMSPEDSTSSTPR 0.97026 16.0747 0 16.0747 0 0 0 0 0 A0A2C9WRW5 Abhydrolase_3 domain-containing protein MANES_01G264300 A0A2C9WRW5_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrolase activity [GO:0016787] hydrolase activity [GO:0016787] DHRYCNPMLEGPHQDK 0.97093 16.0747 0 16.0747 0 15.0085 0 0 0 A0A2C9UR54 Uncharacterized protein MANES_13G122500 A0A2C9UR54_MANES Manihot esculenta (Cassava) (Jatropha manihot) "callus formation [GO:1990110];DNA mediated transformation [GO:0009294];heterochromatin assembly [GO:0031507];histone H3-K27 methylation [GO:0070734];leaf morphogenesis [GO:0009965];negative regulation of molecular function, epigenetic [GO:0045857];regulation of flower development [GO:0009909];regulation of gene expression by genetic imprinting [GO:0006349];regulation of leaf senescence [GO:1900055];regulation of long-day photoperiodism, flowering [GO:0048586];regulation of transcription, DNA-templated [GO:0006355];response to abscisic acid [GO:0009737];vegetative to reproductive phase transition of meristem [GO:0010228]" chromatin silencing complex [GO:0005677];PcG protein complex [GO:0031519] "chromatin silencing complex [GO:0005677];PcG protein complex [GO:0031519];histone-lysine N-methyltransferase activity [GO:0018024];single-stranded RNA binding [GO:0003727];callus formation [GO:1990110];DNA mediated transformation [GO:0009294];heterochromatin assembly [GO:0031507];histone H3-K27 methylation [GO:0070734];leaf morphogenesis [GO:0009965];negative regulation of molecular function, epigenetic [GO:0045857];regulation of flower development [GO:0009909];regulation of gene expression by genetic imprinting [GO:0006349];regulation of leaf senescence [GO:1900055];regulation of long-day photoperiodism, flowering [GO:0048586];regulation of transcription, DNA-templated [GO:0006355];response to abscisic acid [GO:0009737];vegetative to reproductive phase transition of meristem [GO:0010228]" histone-lysine N-methyltransferase activity [GO:0018024];single-stranded RNA binding [GO:0003727] KRMEENK 0.96798 16.0764 0 16.0764 0 0 0 0 0 A0A251JXA4 Uncharacterized protein MANES_10G008200 A0A251JXA4_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] DVLLYDESWKFK 0.96778 16.0779 0 0 0 16.0779 0 0 0 A0A2C9W931 Sucrose synthase (EC 2.4.1.13) MANES_03G198900 A0A2C9W931_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to hypoxia [GO:0001666];seed maturation [GO:0010431];starch metabolic process [GO:0005982];sucrose metabolic process [GO:0005985] cytosol [GO:0005829];plastid [GO:0009536] cytosol [GO:0005829];plastid [GO:0009536];sucrose synthase activity [GO:0016157];response to hypoxia [GO:0001666];seed maturation [GO:0010431];starch metabolic process [GO:0005982];sucrose metabolic process [GO:0005985] sucrose synthase activity [GO:0016157] ALENEMVSRIQK 0.967 16.0837 0 0 0 16.0837 0 0 0 A0A2C9WB05 Uncharacterized protein MANES_03G211000 A0A2C9WB05_MANES Manihot esculenta (Cassava) (Jatropha manihot) VPSYKTYAQVSLR 0.97561 16.0887 0 0 16.0887 0 0 0 0 A0A2C9UXM3 ABC1 domain-containing protein MANES_12G141200 A0A2C9UXM3_MANES Manihot esculenta (Cassava) (Jatropha manihot) iron ion homeostasis [GO:0055072];membrane lipid biosynthetic process [GO:0046467];regulation of response to reactive oxygen species [GO:1901031] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];protein kinase activity [GO:0004672];iron ion homeostasis [GO:0055072];membrane lipid biosynthetic process [GO:0046467];regulation of response to reactive oxygen species [GO:1901031] protein kinase activity [GO:0004672] ARLKGQEVVVK 0.96067 16.1053 0 0 16.1053 0 0 0 0 A0A2C9USI0 Uncharacterized protein MANES_13G100500 A0A2C9USI0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] VQPGSVEARKGLDR 0.96051 16.1086 0 16.1086 16.0887 0 0 0 0 A0A2C9UZK3 Exportin-T (Exportin(tRNA)) (tRNA exportin) MANES_11G019400 A0A2C9UZK3_MANES Manihot esculenta (Cassava) (Jatropha manihot) tRNA re-export from nucleus [GO:0071528] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];small GTPase binding [GO:0031267];tRNA binding [GO:0000049];tRNA re-export from nucleus [GO:0071528] small GTPase binding [GO:0031267];tRNA binding [GO:0000049] IGREEEDRMVEYR 0.96051 16.1149 0 0 16.1149 0 0 0 0 A0A2C9UMK4 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase (EC 3.2.2.6) MANES_13G002100 A0A2C9UMK4_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953];defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953] ENIGKVQR 0.96208 16.1346 0 0 0 16.1346 0 0 0 A0A2C9UWK6 Beta-galactosidase (EC 3.2.1.23) MANES_12G147300 A0A2C9UWK6_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] apoplast [GO:0048046];vacuole [GO:0005773] apoplast [GO:0048046];vacuole [GO:0005773];beta-galactosidase activity [GO:0004565];carbohydrate binding [GO:0030246];carbohydrate metabolic process [GO:0005975] beta-galactosidase activity [GO:0004565];carbohydrate binding [GO:0030246] GLAWLNGEEIGRYWPRK 0.96897 16.1504 0 0 16.1504 13.5618 0 0 0 A0A0M4FL10 NAC transcription factors 89 MANES_17G016600 A0A0M4FL10_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" "DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] QFMLNAR 0.96731 16.1527 0 0 0 16.1527 0 0 0 A0A2C9V5C5 NB-ARC domain-containing protein MANES_10G114400 A0A2C9V5C5_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] CLKNCALFFEKQEIAR 0.95309 16.166 0 0 0 16.166 0 0 0 A0A2C9VQQ9 Uncharacterized protein MANES_06G142700 A0A2C9VQQ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] VGFIHKR 0.96697 16.1861 0 0 16.1861 0 0 0 0 A0A2C9WP75 Uncharacterized protein MANES_01G258700 A0A2C9WP75_MANES Manihot esculenta (Cassava) (Jatropha manihot) RQHEFELQKEK 0.96402 16.1863 0 16.1863 0 0 0 0 0 A0A2C9V1K9 Ribonuclease P (EC 3.1.26.5) MANES_11G160000 A0A2C9V1K9_MANES Manihot esculenta (Cassava) (Jatropha manihot) tRNA 5'-leader removal [GO:0001682] intracellular organelle [GO:0043229] intracellular organelle [GO:0043229];ribonuclease P activity [GO:0004526];tRNA 5'-leader removal [GO:0001682] ribonuclease P activity [GO:0004526] HQVRYTFMKGNLK 0.96049 16.1903 0 16.1903 0 0 0 0 0 A0A251LK88 TIR domain-containing protein MANES_02G205900 A0A251LK88_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953];defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953] LFGIESHIEK 0.9615 16.1917 0 16.1917 0 0 0 0 0 A0A2C9WLX6 Uncharacterized protein MANES_01G180400 A0A2C9WLX6_MANES Manihot esculenta (Cassava) (Jatropha manihot) EIHAHLIK 0.96837 16.2508 0 16.2508 0 0 0 0 0 A0A2C9VKY2 GH10 domain-containing protein MANES_07G059400 A0A2C9VKY2_MANES Manihot esculenta (Cassava) (Jatropha manihot) polysaccharide catabolic process [GO:0000272] cellular anatomical entity [GO:0110165] "cellular anatomical entity [GO:0110165];hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553];polysaccharide catabolic process [GO:0000272]" "hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]" RLEQILSYPGNK 0.95742 16.2625 0 0 16.2625 0 0 0 0 A0A2C9WED8 Phosphatidylinositol 4-phosphate 5-kinase (EC 2.7.1.68) MANES_02G159700 A0A2C9WED8_MANES Manihot esculenta (Cassava) (Jatropha manihot) membrane [GO:0016020] membrane [GO:0016020];1-phosphatidylinositol-4-phosphate 5-kinase activity [GO:0016308];ATP binding [GO:0005524] 1-phosphatidylinositol-4-phosphate 5-kinase activity [GO:0016308];ATP binding [GO:0005524] EGLDRDGLR 0.95904 16.2738 0 0 0 16.2738 0 0 0 A0A2C9US55 Glutaredoxin domain-containing protein MANES_12G007000 A0A2C9US55_MANES Manihot esculenta (Cassava) (Jatropha manihot) glutathione oxidoreductase activity [GO:0097573] glutathione oxidoreductase activity [GO:0097573] LFCGMGVNPTVYELDQDPR 0.97162 16.2892 0 0 0 16.2892 0 0 0 A0A2C9WGI9 AAA domain-containing protein MANES_02G219800 A0A2C9WGI9_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] QIEEDRR 0.95049 16.3008 0 16.3008 0 0 0 0 0 A0A2C9VGW6 Uncharacterized protein MANES_08G162500 A0A2C9VGW6_MANES Manihot esculenta (Cassava) (Jatropha manihot) REQVAQRK 0.9693 16.3076 0 0 0 16.3076 0 0 0 A0A2C9V2R3 Na_H_Exchanger domain-containing protein MANES_11G149800 A0A2C9V2R3_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of pH [GO:0006885] endomembrane system [GO:0012505];integral component of membrane [GO:0016021] endomembrane system [GO:0012505];integral component of membrane [GO:0016021];solute:proton antiporter activity [GO:0015299];regulation of pH [GO:0006885] solute:proton antiporter activity [GO:0015299] PNSELRIMACIHK 0.95971 16.3131 0 0 0 16.3131 0 0 0 A0A2C9ULC2 HTH myb-type domain-containing protein MANES_14G127500 A0A2C9ULC2_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] IEEFLSCLEEER 0.96329 16.3604 0 0 0 16.3604 0 0 0 A0A2C9VX19 Homeobox domain-containing protein MANES_05G124300 A0A2C9VX19_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] SANLYSDPFLSYAFHKVPSR 0.96763 16.3908 0 0 16.3908 0 0 0 0 A0A2C9VY37 Uncharacterized protein MANES_05G159600 A0A2C9VY37_MANES Manihot esculenta (Cassava) (Jatropha manihot) magnesium ion homeostasis [GO:0010960] integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231] integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231];magnesium ion homeostasis [GO:0010960] GKDGQQLEFK 0.96053 16.4044 0 0 0 16.4044 0 0 0 A0A2C9W0H6 RNase H type-1 domain-containing protein MANES_04G079500 A0A2C9W0H6_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleic acid binding [GO:0003676];RNA-DNA hybrid ribonuclease activity [GO:0004523] nucleic acid binding [GO:0003676];RNA-DNA hybrid ribonuclease activity [GO:0004523] VIHFLNK 0.96734 16.4094 0 0 0 16.4094 0 0 0 A0A2C9V807 Uncharacterized protein MANES_10G149500 A0A2C9V807_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] beta-glucosidase activity [GO:0008422];carbohydrate metabolic process [GO:0005975] beta-glucosidase activity [GO:0008422] FGKYYIF 0.96382 16.416 0 0 16.416 0 0 0 0 A0A251JEI7 PSI-F MANES_16G056000 A0A251JEI7_MANES Manihot esculenta (Cassava) (Jatropha manihot) photosynthesis [GO:0015979] integral component of membrane [GO:0016021];photosystem I reaction center [GO:0009538] integral component of membrane [GO:0016021];photosystem I reaction center [GO:0009538];mRNA binding [GO:0003729];protein domain specific binding [GO:0019904];photosynthesis [GO:0015979] mRNA binding [GO:0003729];protein domain specific binding [GO:0019904] LYAPDSAPALAIK 0.95977 16.4941 0 0 16.4941 0 0 0 0 A0A2C9VLA6 Uncharacterized protein MANES_07G136700 A0A2C9VLA6_MANES Manihot esculenta (Cassava) (Jatropha manihot) VPLSHVVSECTKR 0.96194 16.5088 0 16.5088 0 15.9744 0 0 0 A0A2C9UQ11 18S rRNA aminocarboxypropyltransferase (EC 2.5.1.-) MANES_13G077900 A0A2C9UQ11_MANES Manihot esculenta (Cassava) (Jatropha manihot) enzyme-directed rRNA pseudouridine synthesis [GO:0000455];maturation of SSU-rRNA [GO:0030490] cytoplasm [GO:0005737] cytoplasm [GO:0005737];18S rRNA aminocarboxypropyltransferase activity [GO:0106388];S-adenosyl-L-methionine binding [GO:1904047];enzyme-directed rRNA pseudouridine synthesis [GO:0000455];maturation of SSU-rRNA [GO:0030490] 18S rRNA aminocarboxypropyltransferase activity [GO:0106388];S-adenosyl-L-methionine binding [GO:1904047] VPKAVPDVQGGETSK 0.96343 16.5088 0 16.5088 0 16.3212 0 0 0 A0A2C9U2T7 Uncharacterized protein MANES_18G126200 A0A2C9U2T7_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650];carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650] VQSAVFDVKNYGGK 0.97613 16.5088 0 16.5088 0 14.8054 0 0 0 A0A2C9V2C9 Uncharacterized protein MANES_10G019700 A0A2C9V2C9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];regulation of transcription, DNA-templated [GO:0006355]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]" VPQTNGFDFAAETQVHPTLPR 0.95364 16.5141 0 16.5141 11.3091 0 0 0 0 A0A2C9VPG1 Uncharacterized protein MANES_06G093500 A0A2C9VPG1_MANES Manihot esculenta (Cassava) (Jatropha manihot) LLHSYSSK 0.96809 16.5382 0 0 16.5382 0 0 0 0 A0A2C9VTX5 Protein kinase domain-containing protein MANES_06G175900 A0A2C9VTX5_MANES Manihot esculenta (Cassava) (Jatropha manihot) signal transduction [GO:0007165] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674];signal transduction [GO:0007165] ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] NSTLHGLASSSGNNLEQLDR 0.9591 16.5397 0 16.5397 0 0 0 0 0 A0A2C9W849 Uncharacterized protein MANES_03G096100 A0A2C9W849_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein-chromophore linkage [GO:0018298];protein phosphorylation [GO:0006468] cytoplasm [GO:0005737];nucleus [GO:0005634];plasma membrane [GO:0005886] cytoplasm [GO:0005737];nucleus [GO:0005634];plasma membrane [GO:0005886];ATP binding [GO:0005524];blue light photoreceptor activity [GO:0009882];protein serine/threonine kinase activity [GO:0004674];protein phosphorylation [GO:0006468];protein-chromophore linkage [GO:0018298] ATP binding [GO:0005524];blue light photoreceptor activity [GO:0009882];protein serine/threonine kinase activity [GO:0004674] TFANILHK 0.96865 16.5578 0 16.5578 12.8339 0 0 0 0 A0A2C9USV2 Signal recognition particle subunit SRP72 MANES_12G016400 A0A2C9USV2_MANES Manihot esculenta (Cassava) (Jatropha manihot) SRP-dependent cotranslational protein targeting to membrane [GO:0006614] "signal recognition particle, endoplasmic reticulum targeting [GO:0005786]" "signal recognition particle, endoplasmic reticulum targeting [GO:0005786];7S RNA binding [GO:0008312];SRP-dependent cotranslational protein targeting to membrane [GO:0006614]" 7S RNA binding [GO:0008312] DKRAAQVR 0.96952 16.5578 0 16.5578 0 0 0 0 0 A0A2C9WLV3 TPT domain-containing protein MANES_01G165600 A0A2C9WLV3_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];antiporter activity [GO:0015297] antiporter activity [GO:0015297] VVPLQTMR 0.96996 16.5578 0 16.5578 0 0 0 0 0 A0A2C9V700 Uncharacterized protein MANES_10G128000 A0A2C9V700_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] CLKDKGGDYWPIISDIPCVDIEN 0.96092 16.5651 0 16.5651 12.5868 0 0 0 0 A0A251L4S7 DNA-directed RNA polymerase subunit beta (EC 2.7.7.6) MANES_04G156600 A0A251L4S7_MANES Manihot esculenta (Cassava) (Jatropha manihot) "transcription, DNA-templated [GO:0006351]" RNA polymerase I complex [GO:0005736] "RNA polymerase I complex [GO:0005736];DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899];ribonucleoside binding [GO:0032549];transcription, DNA-templated [GO:0006351]" DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899];ribonucleoside binding [GO:0032549] CPDGGNGGR 0.96802 16.5699 0 0 16.5699 15.7984 0 0 0 A0A2C9UJZ2 Uncharacterized protein MANES_14G051900 A0A2C9UJZ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) MFSRFADVHFYSMQSR 0.98689 16.5699 0 0 16.5699 0 0 0 0 A0A2C9VVZ2 Polynucleotide adenylyltransferase (EC 2.7.7.19) MANES_05G137200 A0A2C9VVZ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) mRNA polyadenylation [GO:0006378] nucleus [GO:0005634] nucleus [GO:0005634];ATP binding [GO:0005524];polynucleotide adenylyltransferase activity [GO:0004652];RNA binding [GO:0003723];mRNA polyadenylation [GO:0006378] ATP binding [GO:0005524];polynucleotide adenylyltransferase activity [GO:0004652];RNA binding [GO:0003723] SSGEKSSESKGVSDGLDDGR 0.96284 16.6027 0 0 16.6027 0 0 0 0 A0A2C9UJ51 Uncharacterized protein MANES_14G066600 A0A2C9UJ51_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to singlet oxygen [GO:0000304];singlet oxygen-mediated programmed cell death [GO:0010343] thylakoid membrane [GO:0042651] thylakoid membrane [GO:0042651];response to singlet oxygen [GO:0000304];singlet oxygen-mediated programmed cell death [GO:0010343] FQLEDAIENEDFQEAAK 0.98051 16.6027 0 15.8031 16.6027 0 0 0 0 A0A2C9WE64 Uncharacterized protein MANES_02G153800 A0A2C9WE64_MANES Manihot esculenta (Cassava) (Jatropha manihot) WFMVLQENQNNEICKEK 0.95676 16.6167 0 0 16.6167 0 0 0 0 A0A2C9UBG2 Protein kinase domain-containing protein MANES_16G100200 A0A2C9UBG2_MANES Manihot esculenta (Cassava) (Jatropha manihot) endocytosis [GO:0006897];peptidyl-serine phosphorylation [GO:0018105] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];endocytosis [GO:0006897];peptidyl-serine phosphorylation [GO:0018105] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] TTDASPGTMHKISSGQRSPPR 0.9812 16.6381 0 0 16.6381 0 0 0 0 A0A2C9UTM9 HORMA domain-containing protein MANES_12G011600 A0A2C9UTM9_MANES Manihot esculenta (Cassava) (Jatropha manihot) proteolysis involved in cellular protein catabolic process [GO:0051603] extracellular space [GO:0005615];lysosome [GO:0005764] extracellular space [GO:0005615];lysosome [GO:0005764];cysteine-type endopeptidase activity [GO:0004197];proteolysis involved in cellular protein catabolic process [GO:0051603] cysteine-type endopeptidase activity [GO:0004197] LIDWMEK 0.96721 16.6533 0 0 0 16.6533 0 0 0 A0A2C9UK64 Uncharacterized protein MANES_14G057800 A0A2C9UK64_MANES Manihot esculenta (Cassava) (Jatropha manihot) FPYHKLR 0.9629 16.7931 0 0 16.7931 0 0 0 0 A0A2C9W380 Auxin-responsive protein MANES_04G120900 A0A2C9W380_MANES Manihot esculenta (Cassava) (Jatropha manihot) "auxin-activated signaling pathway [GO:0009734];regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];auxin-activated signaling pathway [GO:0009734];regulation of transcription, DNA-templated [GO:0006355]" KKNSLNEK 0.96931 16.7931 0 15.7171 16.7931 0 0 0 0 A0A2C9UER8 Uncharacterized protein MANES_15G098600 A0A2C9UER8_MANES Manihot esculenta (Cassava) (Jatropha manihot) LDEMYDQLRSDYESMKR 0.97742 16.8193 0 16.8193 0 0 0 0 0 A0A2C9VRW5 MFS domain-containing protein MANES_06G178400 A0A2C9VRW5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] VSPEDGHEDSSSSPPRWK 0.97929 16.8427 0 0 16.8427 0 0 0 0 A0A2C9WNX4 Uncharacterized protein MANES_01G171500 A0A2C9WNX4_MANES Manihot esculenta (Cassava) (Jatropha manihot) ubiquitin-dependent protein catabolic process [GO:0006511] ubiquitin-dependent protein catabolic process [GO:0006511] SNQEASQNVEEPK 0.9603 16.8456 0 16.8456 0 0 0 0 0 A0A2C9WNC6 GRIP domain-containing protein MANES_01G153700 A0A2C9WNC6_MANES Manihot esculenta (Cassava) (Jatropha manihot) reciprocal meiotic recombination [GO:0007131] reciprocal meiotic recombination [GO:0007131] EEHDSFRGLVDR 0.96793 16.8456 0 16.8456 0 16.6923 0 0 0 B1NWE5 Photosystem II D2 protein (PSII D2 protein) (EC 1.10.3.9) (Photosystem Q(A) protein) psbD PSBD_MANES Manihot esculenta (Cassava) (Jatropha manihot) photosynthetic electron transport in photosystem II [GO:0009772];protein-chromophore linkage [GO:0018298] chloroplast thylakoid membrane [GO:0009535];integral component of membrane [GO:0016021];photosystem II [GO:0009523] "chloroplast thylakoid membrane [GO:0009535];integral component of membrane [GO:0016021];photosystem II [GO:0009523];chlorophyll binding [GO:0016168];electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity [GO:0045156];iron ion binding [GO:0005506];oxygen evolving activity [GO:0010242];photosynthetic electron transport in photosystem II [GO:0009772];protein-chromophore linkage [GO:0018298]" "chlorophyll binding [GO:0016168];electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity [GO:0045156];iron ion binding [GO:0005506];oxygen evolving activity [GO:0010242]" AYDFVSQEIR 0.96069 16.8697 0 0 16.8697 0 0 0 0 A0A2C9VNH9 Epimerase domain-containing protein MANES_06G068800 A0A2C9VNH9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]" "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]" DPGDAAK 0.96786 16.9485 0 0 0 16.9485 0 0 0 A0A2C9VTI4 ZnMc domain-containing protein MANES_05G050700 A0A2C9VTI4_MANES Manihot esculenta (Cassava) (Jatropha manihot) collagen catabolic process [GO:0030574];extracellular matrix organization [GO:0030198] anchored component of membrane [GO:0031225];extracellular matrix [GO:0031012] anchored component of membrane [GO:0031225];extracellular matrix [GO:0031012];metalloendopeptidase activity [GO:0004222];zinc ion binding [GO:0008270];collagen catabolic process [GO:0030574];extracellular matrix organization [GO:0030198] metalloendopeptidase activity [GO:0004222];zinc ion binding [GO:0008270] FEAAVFRYQAK 0.95989 16.9567 0 0 0 16.9567 0 0 0 A0A2C9W5Q0 Uncharacterized protein MANES_03G083400 A0A2C9W5Q0_MANES Manihot esculenta (Cassava) (Jatropha manihot) LEDANKLLNEMLEK 0.961 16.9567 0 15.3762 13.5296 16.9567 0 0 0 A0A2C9VKI3 Uncharacterized protein MANES_07G113800 A0A2C9VKI3_MANES Manihot esculenta (Cassava) (Jatropha manihot) LHLKYHVPGACK 0.966 16.9942 0 0 16.9942 0 0 0 0 A0A2C9WK54 Rab-GAP TBC domain-containing protein MANES_01G038300 A0A2C9WK54_MANES Manihot esculenta (Cassava) (Jatropha manihot) activation of GTPase activity [GO:0090630];intracellular protein transport [GO:0006886] GTPase activator activity [GO:0005096];activation of GTPase activity [GO:0090630];intracellular protein transport [GO:0006886] GTPase activator activity [GO:0005096] RLFTPDGRFCDGDGGIQFLK 0.97594 17.0265 0 0 17.0265 0 0 0 0 A0A2C9UBM7 Uncharacterized protein MANES_15G002700 A0A2C9UBM7_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553];carbohydrate metabolic process [GO:0005975]" "hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]" ETVNFAALER 0.96154 17.1012 0 0 17.1012 0 0 0 0 A0A2C9UEI8 Uncharacterized protein MANES_15G091800 A0A2C9UEI8_MANES Manihot esculenta (Cassava) (Jatropha manihot) PQQKRLDTVASNDSSSHSR 0.95983 17.1368 0 17.1368 0 0 0 0 0 A0A2C9VLD6 GATA-N domain-containing protein MANES_07G139500 A0A2C9VLD6_MANES Manihot esculenta (Cassava) (Jatropha manihot) "chloroplast organization [GO:0009658];positive regulation of transcription, DNA-templated [GO:0045893]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA binding [GO:0003677];zinc ion binding [GO:0008270];chloroplast organization [GO:0009658];positive regulation of transcription, DNA-templated [GO:0045893]" DNA binding [GO:0003677];zinc ion binding [GO:0008270] YVHVACLEKANSGNFFTR 0.97074 17.1368 0 17.1368 0 0 0 0 0 A0A2C9WC58 Uncharacterized protein MANES_02G002600 A0A2C9WC58_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" PVKESAYGLMFNR 0.9739 17.1582 0 0 0 17.1582 0 0 0 A0A2C9ULZ7 UMP-CMP kinase (EC 2.7.4.14) (Deoxycytidylate kinase) (CK) (dCMP kinase) (Uridine monophosphate/cytidine monophosphate kinase) (UMP/CMP kinase) (UMP/CMPK) MANES_14G090800 A0A2C9ULZ7_MANES Manihot esculenta (Cassava) (Jatropha manihot) 'de novo' pyrimidine nucleobase biosynthetic process [GO:0006207];CDP biosynthetic process [GO:0046705];UDP biosynthetic process [GO:0006225] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];ATP binding [GO:0005524];CMP kinase activity [GO:0036430];cytidylate kinase activity [GO:0004127];dCMP kinase activity [GO:0036431];UMP kinase activity [GO:0033862];'de novo' pyrimidine nucleobase biosynthetic process [GO:0006207];CDP biosynthetic process [GO:0046705];UDP biosynthetic process [GO:0006225] ATP binding [GO:0005524];CMP kinase activity [GO:0036430];cytidylate kinase activity [GO:0004127];dCMP kinase activity [GO:0036431];UMP kinase activity [GO:0033862] SIDEVFEDVK 0.95838 17.2153 0 17.2153 0 0 0 0 0 A0A2C9VYS2 Cyclic nucleotide-binding domain-containing protein MANES_04G018800 A0A2C9VYS2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];voltage-gated potassium channel activity [GO:0005249] voltage-gated potassium channel activity [GO:0005249] MGPNGRIR 0.95916 17.2398 0 17.2398 0 0 0 0 0 A0A0M4FBP0 NAC transcription factors 2 MANES_18G096600 A0A0M4FBP0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] TVTADSSLAPDGGEDK 0.9757 17.2546 0 0 0 17.2546 0 0 0 A0A2C9W9Z3 IPPc domain-containing protein MANES_03G175600 A0A2C9W9Z3_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphatidylinositol dephosphorylation [GO:0046856] "phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity [GO:0034485];phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity [GO:0004439];phosphatidylinositol dephosphorylation [GO:0046856]" "phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity [GO:0034485];phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity [GO:0004439]" VFVGWNEGKIYFPPTYK 0.95678 17.3055 0 0 17.3055 0 0 0 0 A0A2C9UUT8 Uncharacterized protein MANES_12G039700 A0A2C9UUT8_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin filament organization [GO:0007015];vesicle transport along actin filament [GO:0030050] actin cytoskeleton [GO:0015629];cytoplasm [GO:0005737];myosin complex [GO:0016459];vesicle [GO:0031982] actin cytoskeleton [GO:0015629];cytoplasm [GO:0005737];myosin complex [GO:0016459];vesicle [GO:0031982];actin filament binding [GO:0051015];ATP binding [GO:0005524];calmodulin binding [GO:0005516];microfilament motor activity [GO:0000146];actin filament organization [GO:0007015];vesicle transport along actin filament [GO:0030050] actin filament binding [GO:0051015];ATP binding [GO:0005524];calmodulin binding [GO:0005516];microfilament motor activity [GO:0000146] FGKFVEIQFDQSGR 0.95808 17.3274 0 17.3274 0 16.726 0 0 0 A0A2C9UIY1 Nodulin-like domain-containing protein MANES_14G050600 A0A2C9UIY1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020] FRAFVSNR 0.96554 17.3626 0 16.6608 15.6325 17.3626 0 0 0 A0A2C9W1C6 Uncharacterized protein MANES_04G059300 A0A2C9W1C6_MANES Manihot esculenta (Cassava) (Jatropha manihot) "chromatin organization [GO:0006325];histone H3-K4 methylation [GO:0051568];positive regulation of long-day photoperiodism, flowering [GO:0048578];regulation of transcription, DNA-templated [GO:0006355]" chromatin [GO:0000785];nucleus [GO:0005634] "chromatin [GO:0000785];nucleus [GO:0005634];chromatin binding [GO:0003682];histone-lysine N-methyltransferase activity [GO:0018024];metal ion binding [GO:0046872];chromatin organization [GO:0006325];histone H3-K4 methylation [GO:0051568];positive regulation of long-day photoperiodism, flowering [GO:0048578];regulation of transcription, DNA-templated [GO:0006355]" chromatin binding [GO:0003682];histone-lysine N-methyltransferase activity [GO:0018024];metal ion binding [GO:0046872] PVRVDWK 0.96421 17.3673 0 17.3673 0 0 0 0 0 A0A2C9UAW8 Protein kinase domain-containing protein MANES_16G109000 A0A2C9UAW8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] IPIGASWR 0.96972 17.3673 0 17.3673 0 0 0 0 0 A0A2C9VD12 FPL domain-containing protein MANES_08G032200 A0A2C9VD12_MANES Manihot esculenta (Cassava) (Jatropha manihot) endosomal transport [GO:0016197];endosome to lysosome transport [GO:0008333];regulation of autophagosome maturation [GO:1901096] endolysosome membrane [GO:0036020];integral component of membrane [GO:0016021] endolysosome membrane [GO:0036020];integral component of membrane [GO:0016021];endosomal transport [GO:0016197];endosome to lysosome transport [GO:0008333];regulation of autophagosome maturation [GO:1901096] DTIEGSTEKLFSNHLNNVHK 0.96898 17.3752 0 0 17.3752 0 0 0 0 A0A2C9U2A6 Uncharacterized protein MANES_18G103400 A0A2C9U2A6_MANES Manihot esculenta (Cassava) (Jatropha manihot) double-strand break repair via synthesis-dependent strand annealing [GO:0045003];interstrand cross-link repair [GO:0036297];meiotic cell cycle [GO:0051321];negative regulation of reciprocal meiotic recombination [GO:0045128];replication fork reversal [GO:0071932] 3'-5' DNA helicase activity [GO:0043138];ATP binding [GO:0005524];four-way junction DNA binding [GO:0000400];four-way junction helicase activity [GO:0009378];hydrolase activity [GO:0016787];double-strand break repair via synthesis-dependent strand annealing [GO:0045003];interstrand cross-link repair [GO:0036297];meiotic cell cycle [GO:0051321];negative regulation of reciprocal meiotic recombination [GO:0045128];replication fork reversal [GO:0071932] 3'-5' DNA helicase activity [GO:0043138];ATP binding [GO:0005524];four-way junction DNA binding [GO:0000400];four-way junction helicase activity [GO:0009378];hydrolase activity [GO:0016787] VDMMAVYRRSLLTQSPMER 0.97411 17.3752 0 0 17.3752 0 0 0 0 A0A2C9VDY8 Ig-like domain-containing protein MANES_08G003100 A0A2C9VDY8_MANES Manihot esculenta (Cassava) (Jatropha manihot) mRNA processing [GO:0006397] chloroplast stroma [GO:0009570] chloroplast stroma [GO:0009570];mRNA binding [GO:0003729];mRNA processing [GO:0006397] mRNA binding [GO:0003729] FSDVAMVTDSR 0.96924 17.3755 0 15.9841 0 17.3755 0 0 0 A0A2C9VCC1 Uncharacterized protein MANES_08G010500 A0A2C9VCC1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] MPPTLRK 0.96756 17.4165 0 0 17.4165 0 0 0 0 A0A2C9UR78 Uncharacterized protein MANES_13G086000 A0A2C9UR78_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] PAWSILR 0.96795 17.4165 0 0 17.4165 0 0 0 0 A0A2C9V3D4 Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) MANES_10G008700 A0A2C9V3D4_MANES Manihot esculenta (Cassava) (Jatropha manihot) metabolic process [GO:0008152] cytosol [GO:0005829] cytosol [GO:0005829];mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity [GO:0033925];metabolic process [GO:0008152] mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity [GO:0033925] SWGIANNYPK 0.95932 17.4262 0 17.4262 0 0 0 0 0 A0A251LNC2 Uncharacterized protein MANES_01G076200 A0A251LNC2_MANES Manihot esculenta (Cassava) (Jatropha manihot) MSFKSNALNVECASSDVLIK 1.0151 17.4539 0 0 17.4539 0 0 0 0 A0A2C9WKP1 AAA domain-containing protein MANES_01G139500 A0A2C9WKP1_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] NFSVAIEKGEEVNDVYENVK 0.96732 17.4896 0 0 0 17.4896 0 0 0 B1NWF4 "NAD(P)H-quinone oxidoreductase subunit K, chloroplastic (EC 7.1.1.-) (NAD(P)H dehydrogenase subunit K) (NADH-plastoquinone oxidoreductase subunit K)" ndhK NDHK_MANES Manihot esculenta (Cassava) (Jatropha manihot) "photosynthesis, light reaction [GO:0019684]" chloroplast thylakoid membrane [GO:0009535] "chloroplast thylakoid membrane [GO:0009535];4 iron, 4 sulfur cluster binding [GO:0051539];iron ion binding [GO:0005506];NADH dehydrogenase (ubiquinone) activity [GO:0008137];quinone binding [GO:0048038];photosynthesis, light reaction [GO:0019684]" "4 iron, 4 sulfur cluster binding [GO:0051539];iron ion binding [GO:0005506];NADH dehydrogenase (ubiquinone) activity [GO:0008137];quinone binding [GO:0048038]" ISREIYEDR 0.95921 17.5148 0 0 17.1827 17.5148 0 0 0 A0A2C9UBC4 Uncharacterized protein MANES_16G124000 A0A2C9UBC4_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid transport [GO:0006869] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021];lipid binding [GO:0008289];metal ion binding [GO:0046872];lipid transport [GO:0006869] lipid binding [GO:0008289];metal ion binding [GO:0046872] YTNIRSSR 0.95211 17.5199 0 17.5199 0 16.3529 0 0 0 A0A2C9W2G6 Uncharacterized protein MANES_04G096900 A0A2C9W2G6_MANES Manihot esculenta (Cassava) (Jatropha manihot) LIMDMNLMMKR 0.72222 17.5249 0 17.5249 12.126 16.6923 0 0 0 A0A199UCN7 LRRNT_2 domain-containing protein MANES_S020400 A0A199UCN7_MANES Manihot esculenta (Cassava) (Jatropha manihot) LTRTSSDGSTR 0.95958 17.5351 0 17.5351 17.1827 0 0 0 0 A0A251KMZ4 VARLMGL domain-containing protein MANES_06G083300 A0A251KMZ4_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of monopolar cell growth [GO:0051513] regulation of monopolar cell growth [GO:0051513] IPSSGHAGGPNR 0.95604 17.5918 0 0 0 17.5918 0 0 0 A0A2C9TZF0 Uncharacterized protein MANES_18G003200 A0A2C9TZF0_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast inner membrane [GO:0009706];integral component of membrane [GO:0016021] chloroplast inner membrane [GO:0009706];integral component of membrane [GO:0016021] LSFNLNCPGK 0.96091 17.5918 0 0 0 17.5918 0 0 0 A0A2C9W3N2 FHA domain-containing protein MANES_03G014400 A0A2C9W3N2_MANES Manihot esculenta (Cassava) (Jatropha manihot) LPCKDLTCRMR 0.96124 17.6007 0 0 0 17.6007 0 0 0 A0A2C9V4W0 Uncharacterized protein MANES_10G094400 A0A2C9V4W0_MANES Manihot esculenta (Cassava) (Jatropha manihot) ELVELKNR 0.96699 17.6605 0 14.7997 17.6605 0 0 0 0 A0A2C9VDF8 Uncharacterized protein MANES_08G041200 A0A2C9VDF8_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to fungus [GO:0050832];killing of cells of other organism [GO:0031640] defense response to fungus [GO:0050832];killing of cells of other organism [GO:0031640] IPEHTCHKK 0.96409 17.688 0 17.688 0 0 0 0 0 A0A2C9VDF5 Uncharacterized protein MANES_09G174100 A0A2C9VDF5_MANES Manihot esculenta (Cassava) (Jatropha manihot) "post-embryonic development [GO:0009791];regulation of transcription, DNA-templated [GO:0006355];reproductive structure development [GO:0048608];shoot system development [GO:0048367]" "post-embryonic development [GO:0009791];regulation of transcription, DNA-templated [GO:0006355];reproductive structure development [GO:0048608];shoot system development [GO:0048367]" LVTLPDNTDTSNK 0.96028 17.6938 0 0 0 17.6938 0 0 0 A0A2C9U4I1 Protein kinase domain-containing protein MANES_17G005600 A0A2C9U4I1_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellulose biosynthetic process [GO:0030244] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];cellulose biosynthetic process [GO:0030244] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] MNEGFDRFFER 0.95984 17.728 0 13.3526 0 17.728 0 0 0 A0A2C9VVU4 Protein kinase domain-containing protein MANES_05G132300 A0A2C9VVU4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];polysaccharide binding [GO:0030247];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];polysaccharide binding [GO:0030247];protein serine/threonine kinase activity [GO:0004674] QLPLCLR 0.96748 17.7575 0 0 0 17.7575 0 0 0 A0A2C9VMQ9 Protein kinase domain-containing protein MANES_06G040500 A0A2C9VMQ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) negative regulation of secondary growth [GO:2000604] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672];negative regulation of secondary growth [GO:2000604] ATP binding [GO:0005524];protein kinase activity [GO:0004672] MDLANNK 0.96883 17.8791 0 0 0 17.8791 0 0 0 A0A2C9WE71 Uncharacterized protein MANES_02G104800 A0A2C9WE71_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];ATP binding [GO:0005524];calcium ion binding [GO:0005509];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683];intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] ATP binding [GO:0005524];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calcium ion binding [GO:0005509];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683] LLGHGQFGYTYVATDKANGDR 0.95761 18.0082 0 0 18.0082 0 0 0 0 A0A2C9VR42 RRM domain-containing protein MANES_06G151800 A0A2C9VR42_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] SVEQSSGR 0.96946 18.0268 0 18.0268 0 0 0 0 0 A0A2C9VHX1 Smg4_UPF3 domain-containing protein MANES_07G025700 A0A2C9VHX1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184];positive regulation of translation [GO:0045727]" cytoplasm [GO:0005737];nucleolus [GO:0005730] "cytoplasm [GO:0005737];nucleolus [GO:0005730];mRNA binding [GO:0003729];nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184];positive regulation of translation [GO:0045727]" mRNA binding [GO:0003729] VVWTPLR 0.96748 18.0372 0 0 0 18.0372 0 0 0 A0A2C9U428 Protein kinase domain-containing protein MANES_17G018200 A0A2C9U428_MANES Manihot esculenta (Cassava) (Jatropha manihot) peptidyl-serine phosphorylation [GO:0018105] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];peptidyl-serine phosphorylation [GO:0018105] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] TYLGSHQ 0.96745 18.0417 0 0 18.0417 0 0 0 0 A0A2C9UBT5 Uncharacterized protein MANES_16G113300 A0A2C9UBT5_MANES Manihot esculenta (Cassava) (Jatropha manihot) oligopeptide transport [GO:0006857] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];transmembrane transporter activity [GO:0022857];oligopeptide transport [GO:0006857] transmembrane transporter activity [GO:0022857] IWDAETIEEEENENK 0.97388 18.0497 0 18.0497 0 0 0 0 0 A0A2C9UBH5 Uncharacterized protein MANES_16G131300 A0A2C9UBH5_MANES Manihot esculenta (Cassava) (Jatropha manihot) LYQSNCEFFLAERVIR 0.95567 18.0693 0 0 0 18.0693 0 0 0 A0A2C9VP05 Uncharacterized protein MANES_06G038200 A0A2C9VP05_MANES Manihot esculenta (Cassava) (Jatropha manihot) VTSLWEQRARQLGWEGE 0.96596 18.0765 0 0 18.0765 0 0 0 0 A0A2C9U4V2 PSP domain-containing protein MANES_17G042900 A0A2C9U4V2_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA splicing, via spliceosome [GO:0000398]" catalytic step 2 spliceosome [GO:0071013];precatalytic spliceosome [GO:0071011];U12-type spliceosomal complex [GO:0005689];U2 snRNP [GO:0005686];U2-type spliceosomal complex [GO:0005684] "catalytic step 2 spliceosome [GO:0071013];precatalytic spliceosome [GO:0071011];U12-type spliceosomal complex [GO:0005689];U2 snRNP [GO:0005686];U2-type spliceosomal complex [GO:0005684];mRNA splicing, via spliceosome [GO:0000398]" MQEKEGK 0.96478 18.093 0 0 0 18.093 0 0 0 A0A2C9TZW6 Prot_ATP_ID_OB domain-containing protein MANES_18G021300 A0A2C9TZW6_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive regulation of RNA polymerase II transcription preinitiation complex assembly [GO:0045899];proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161];ubiquitin-dependent ERAD pathway [GO:0030433] "cytosolic proteasome complex [GO:0031597];proteasome regulatory particle, base subcomplex [GO:0008540]" "cytosolic proteasome complex [GO:0031597];proteasome regulatory particle, base subcomplex [GO:0008540];proteasome-activating activity [GO:0036402];positive regulation of RNA polymerase II transcription preinitiation complex assembly [GO:0045899];proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161];ubiquitin-dependent ERAD pathway [GO:0030433]" proteasome-activating activity [GO:0036402] LLQHKELESR 0.95781 18.1922 0 18.1922 0 17.9945 0 0 0 A0A2C9WBD3 Uncharacterized protein MANES_03G197500 A0A2C9WBD3_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA repair [GO:0006281] DNA polymerase binding [GO:0070182];DNA repair [GO:0006281] DNA polymerase binding [GO:0070182] LTAKFYK 0.96372 18.2884 0 18.2884 0 0 0 0 0 A0A2C9U981 Uncharacterized protein MANES_16G024400 A0A2C9U981_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] YYLSPER 0.96683 18.3157 0 18.3157 13.2619 16.8984 0 0 0 A0A2C9V949 Exocyst subunit Exo70 family protein MANES_09G088800 A0A2C9V949_MANES Manihot esculenta (Cassava) (Jatropha manihot) exocytosis [GO:0006887];protein transport [GO:0015031] exocyst [GO:0000145] exocyst [GO:0000145];exocytosis [GO:0006887];protein transport [GO:0015031] LQKEFYQILSTNR 0.96179 18.3391 0 18.3391 0 0 0 0 0 A0A2C9UU73 Protein SDA1 MANES_12G019500 A0A2C9UU73_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin cytoskeleton organization [GO:0030036];protein transport [GO:0015031];ribosomal large subunit biogenesis [GO:0042273];ribosomal large subunit export from nucleus [GO:0000055] nucleolus [GO:0005730] nucleolus [GO:0005730];actin cytoskeleton organization [GO:0030036];protein transport [GO:0015031];ribosomal large subunit biogenesis [GO:0042273];ribosomal large subunit export from nucleus [GO:0000055] YVQPHQR 0.95432 18.3782 0 14.1392 18.3782 0 0 0 0 A0A2C9UKA8 CYTH domain-containing protein MANES_14G093500 A0A2C9UKA8_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] cytoplasm [GO:0005737];ATP binding [GO:0005524];kinase activity [GO:0016301];pyrophosphatase activity [GO:0016462] ATP binding [GO:0005524];kinase activity [GO:0016301];pyrophosphatase activity [GO:0016462] GFFLFIR 0.96911 18.392 0 18.392 0 17.7575 0 0 0 A0A2C9V6G8 Uncharacterized protein MANES_09G000700 A0A2C9V6G8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] PCVVTFAADQIDMTKSSVASR 0.97289 18.4869 0 0 0 18.4869 0 0 0 A0A2C9WH17 HUN domain-containing protein MANES_02G168300 A0A2C9WH17_MANES Manihot esculenta (Cassava) (Jatropha manihot) FQQIKKEVAEMVK 0.96803 18.6163 0 15.7902 18.6163 0 0 0 0 A0A2C9UXN0 Uncharacterized protein MANES_12G113900 A0A2C9UXN0_MANES Manihot esculenta (Cassava) (Jatropha manihot) HSPAGIIFDHRDEIQGPR 0.96817 18.8518 0 18.7318 0 18.8518 0 0 0 A0A2C9UZ02 Uncharacterized protein MANES_11G062600 A0A2C9UZ02_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] VRACYHK 0.96171 18.8742 0 0 18.8742 0 0 0 0 A0A2C9UAF8 Uncharacterized protein MANES_16G064700 A0A2C9UAF8_MANES Manihot esculenta (Cassava) (Jatropha manihot) KPLLVLK 0.96677 19.009 0 19.009 0 0 0 0 0 A0A2C9VQ08 Uncharacterized protein MANES_06G113500 A0A2C9VQ08_MANES Manihot esculenta (Cassava) (Jatropha manihot) LSPEFQSDSEPDIEDVFTR 0.97081 19.0742 0 0 19.0742 17.2021 0 0 0 A0A2C9VIQ1 DNA-directed RNA polymerase (EC 2.7.7.6) MANES_07G050500 A0A2C9VIQ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial transcription [GO:0006390] mitochondrial DNA-directed RNA polymerase complex [GO:0034245] mitochondrial DNA-directed RNA polymerase complex [GO:0034245];DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899];mitochondrial transcription [GO:0006390] DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899] IICPESSK 0.96811 19.1218 0 0 19.1218 0 0 0 0 A0A2C9US04 C3H1-type domain-containing protein MANES_13G143700 A0A2C9US04_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA binding [GO:0003677];metal ion binding [GO:0046872] DNA binding [GO:0003677];metal ion binding [GO:0046872] ILPEVSCHAVK 0.95882 19.1349 0 0 19.1349 0 0 0 0 A0A2C9W1L5 Str_synth domain-containing protein MANES_04G039600 A0A2C9W1L5_MANES Manihot esculenta (Cassava) (Jatropha manihot) biosynthetic process [GO:0009058] vacuole [GO:0005773] vacuole [GO:0005773];strictosidine synthase activity [GO:0016844];biosynthetic process [GO:0009058] strictosidine synthase activity [GO:0016844] VELVADLPGFPNNVR 0.96927 19.3784 0 19.3245 0 19.3784 0 0 0 A0A2C9VSX5 Aldehyde dehydrogenase MANES_06G165200 A0A2C9VSX5_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular aldehyde metabolic process [GO:0006081] cytoplasm [GO:0005737] cytoplasm [GO:0005737];aldehyde dehydrogenase (NAD+) activity [GO:0004029];cellular aldehyde metabolic process [GO:0006081] aldehyde dehydrogenase (NAD+) activity [GO:0004029] WDKIFFTGSARVGR 0.95886 19.5053 0 19.5053 18.8943 0 0 0 0 A0A2C9U212 Auxin efflux carrier component MANES_18G087300 A0A2C9U212_MANES Manihot esculenta (Cassava) (Jatropha manihot) auxin-activated signaling pathway [GO:0009734];auxin efflux [GO:0010315];auxin homeostasis [GO:0010252];auxin polar transport [GO:0009926] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021];plasma membrane [GO:0005886] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021];plasma membrane [GO:0005886];auxin efflux transmembrane transporter activity [GO:0010329];auxin efflux [GO:0010315];auxin homeostasis [GO:0010252];auxin polar transport [GO:0009926];auxin-activated signaling pathway [GO:0009734] auxin efflux transmembrane transporter activity [GO:0010329] ASNFNELDVTNAGGTPYWVR 0.96212 19.5866 0 0 0 19.5866 0 0 0 A0A2C9WES1 Uncharacterized protein MANES_02G172300 A0A2C9WES1_MANES Manihot esculenta (Cassava) (Jatropha manihot) TQAIARGQR 0.95931 19.6929 0 19.6929 18.0558 0 0 0 0 A0A2C9ULL6 Uncharacterized protein MANES_14G076900 A0A2C9ULL6_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell division [GO:0051301];protein localization to microtubule plus-end [GO:1904825];regulation of microtubule polymerization or depolymerization [GO:0031110];spindle assembly [GO:0051225];thigmotropism [GO:0009652] cytoplasmic microtubule [GO:0005881];microtubule organizing center [GO:0005815];microtubule plus-end [GO:0035371];spindle midzone [GO:0051233] cytoplasmic microtubule [GO:0005881];microtubule organizing center [GO:0005815];microtubule plus-end [GO:0035371];spindle midzone [GO:0051233];microtubule plus-end binding [GO:0051010];cell division [GO:0051301];protein localization to microtubule plus-end [GO:1904825];regulation of microtubule polymerization or depolymerization [GO:0031110];spindle assembly [GO:0051225];thigmotropism [GO:0009652] microtubule plus-end binding [GO:0051010] EITDLKLSVDHLEK 0.9782 20.0243 0 0 19.4827 20.0243 0 0 0 A0A2C9W7B0 Uncharacterized protein MANES_03G137600 A0A2C9W7B0_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] GNPNPRSYYKCTNAGCPVR 0.95376 20.0502 0 20.0502 0 0 0 0 0 A0A2C9U8S3 GMC_OxRdtase_N domain-containing protein MANES_16G045700 A0A2C9U8S3_MANES Manihot esculenta (Cassava) (Jatropha manihot) "flavin adenine dinucleotide binding [GO:0050660];oxidoreductase activity, acting on CH-OH group of donors [GO:0016614]" "flavin adenine dinucleotide binding [GO:0050660];oxidoreductase activity, acting on CH-OH group of donors [GO:0016614]" FNYFSHPLDVERCVNGTR 0.96684 20.4802 0 0 0 20.4802 0 0 0 A0A2C9VBL0 Uncharacterized protein MANES_09G174200 A0A2C9VBL0_MANES Manihot esculenta (Cassava) (Jatropha manihot) LLEIEDHKQK 0.44444 20.7798 0 19.1666 18.0422 20.7798 0 0 0 A0A2C9V089 Uncharacterized protein MANES_11G104500 A0A2C9V089_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleic acid binding [GO:0003676];zinc ion binding [GO:0008270] nucleic acid binding [GO:0003676];zinc ion binding [GO:0008270] RPCFLCGSLEHGFKQCSK 0.97439 22.3337 0 22.3337 19.089 18.7702 0 0 0 A0A2C9U5U6 Uncharacterized protein MANES_17G042200 A0A2C9U5U6_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast organization [GO:0009658] chloroplast outer membrane [GO:0009707] chloroplast outer membrane [GO:0009707];chloroplast organization [GO:0009658] KKILTFR 0.9669 22.6852 0 0 22.6852 0 0 0 0 A0A2C9UDY8 Arp2/3 complex 34 kDa subunit MANES_15G044500 A0A2C9UDY8_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin filament polymerization [GO:0030041];Arp2/3 complex-mediated actin nucleation [GO:0034314];regulation of actin filament polymerization [GO:0030833] Arp2/3 protein complex [GO:0005885];cytoplasm [GO:0005737] Arp2/3 protein complex [GO:0005885];cytoplasm [GO:0005737];actin binding [GO:0003779];actin filament polymerization [GO:0030041];Arp2/3 complex-mediated actin nucleation [GO:0034314];regulation of actin filament polymerization [GO:0030833] actin binding [GO:0003779] YVRKLVK 0.96737 22.6852 0 0 22.6852 0 0 0 0 A0A2C9UBU9 Pectinesterase (EC 3.1.1.11) MANES_16G089100 A0A2C9UBU9_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910];cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910] SDSDLSVFFR 0.95447 0 8.91913 0 0 0 0 0 8.91913 A0A251KC98 Trafficking protein particle complex subunit MANES_08G080100 A0A251KC98_MANES Manihot esculenta (Cassava) (Jatropha manihot) endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888] endoplasmic reticulum [GO:0005783];Golgi apparatus [GO:0005794];TRAPP complex [GO:0030008] endoplasmic reticulum [GO:0005783];Golgi apparatus [GO:0005794];TRAPP complex [GO:0030008];endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888] DYGSAGR 0.98108 0 9.62576 0 0 0 0 9.62576 0 A0A2C9VFR2 Sodium/hydrogen exchanger MANES_08G125800 A0A2C9VFR2_MANES Manihot esculenta (Cassava) (Jatropha manihot) potassium ion transmembrane transport [GO:0071805];regulation of intracellular pH [GO:0051453];regulation of stomatal closure [GO:0090333];sodium ion import across plasma membrane [GO:0098719] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];potassium:proton antiporter activity [GO:0015386];sodium:proton antiporter activity [GO:0015385];potassium ion transmembrane transport [GO:0071805];regulation of intracellular pH [GO:0051453];regulation of stomatal closure [GO:0090333];sodium ion import across plasma membrane [GO:0098719] potassium:proton antiporter activity [GO:0015386];sodium:proton antiporter activity [GO:0015385] STHNQWQ 0.98128 0 9.70177 0 0 0 0 9.70177 0 A0A2C9UKD4 VEFS-Box domain-containing protein MANES_14G039200 A0A2C9UKD4_MANES Manihot esculenta (Cassava) (Jatropha manihot) nitrogen compound metabolic process [GO:0006807];organic substance metabolic process [GO:0071704];primary metabolic process [GO:0044238] nucleus [GO:0005634] nucleus [GO:0005634];metal ion binding [GO:0046872];nitrogen compound metabolic process [GO:0006807];organic substance metabolic process [GO:0071704];primary metabolic process [GO:0044238] metal ion binding [GO:0046872] RALRNPSFLQR 0.95428 0 9.85284 0 0 0 9.85284 0 0 A0A2C9V377 Uncharacterized protein MANES_10G043500 A0A2C9V377_MANES Manihot esculenta (Cassava) (Jatropha manihot) GSYEVDK 0.98074 0 9.89483 0 0 0 0 9.89483 0 A0A2C9UGF4 HVA22-like protein MANES_15G167200 A0A2C9UGF4_MANES Manihot esculenta (Cassava) (Jatropha manihot) membrane [GO:0016020] membrane [GO:0016020] EASGAFR 0.98123 0 9.99322 0 0 0 0 9.99322 0 A0A2C9UC11 "Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic (EC 1.3.1.75)" MANES_15G016500 A0A2C9UC11_MANES Manihot esculenta (Cassava) (Jatropha manihot) chlorophyll biosynthetic process [GO:0015995] chloroplast [GO:0009507] "chloroplast [GO:0009507];3,8-divinyl protochlorophyllide a 8-vinyl reductase activity [GO:0051744];divinyl chlorophyllide a 8-vinyl-reductase activity [GO:0033728];chlorophyll biosynthetic process [GO:0015995]" "3,8-divinyl protochlorophyllide a 8-vinyl reductase activity [GO:0051744];divinyl chlorophyllide a 8-vinyl-reductase activity [GO:0033728]" FNPITASIATVEATQSSFRSK 0.98479 0 10.0524 0 0 0 0 10.0524 0 A0A2C9VAP6 Phosphoglycerate kinase (EC 2.7.2.3) MANES_09G067000 A0A2C9VAP6_MANES Manihot esculenta (Cassava) (Jatropha manihot) gluconeogenesis [GO:0006094];glycolytic process [GO:0006096] cytosol [GO:0005829] cytosol [GO:0005829];ADP binding [GO:0043531];ATP binding [GO:0005524];phosphoglycerate kinase activity [GO:0004618];gluconeogenesis [GO:0006094];glycolytic process [GO:0006096] ADP binding [GO:0043531];ATP binding [GO:0005524];phosphoglycerate kinase activity [GO:0004618] DCLQAAYQSKRSPEYK 0.98426 0 10.0895 0 0 0 0 10.0895 0 A0A2C9U2A5 Laccase (EC 1.10.3.2) (Benzenediol:oxygen oxidoreductase) (Diphenol oxidase) (Urishiol oxidase) MANES_18G096900 A0A2C9U2A5_MANES Manihot esculenta (Cassava) (Jatropha manihot) lignin catabolic process [GO:0046274] apoplast [GO:0048046] apoplast [GO:0048046];copper ion binding [GO:0005507];hydroquinone:oxygen oxidoreductase activity [GO:0052716];oxidoreductase activity [GO:0016491];lignin catabolic process [GO:0046274] copper ion binding [GO:0005507];hydroquinone:oxygen oxidoreductase activity [GO:0052716];oxidoreductase activity [GO:0016491] GRYNVTIHWHGVK 1.0045 0 10.2038 0 0 0 0 0 10.2038 A0A2C9VA72 Non-specific lipid-transfer protein MANES_09G117300 A0A2C9VA72_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid transport [GO:0006869] lipid binding [GO:0008289];lipid transport [GO:0006869] lipid binding [GO:0008289] GIKQPTADALPR 0.94872 0 10.2394 0 0 0 10.2394 0 0 A0A2C9WMH6 Uncharacterized protein MANES_01G208100 A0A2C9WMH6_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrion [GO:0005739] mitochondrion [GO:0005739] NQLLEKASSTLREMEK 0.73171 0 10.2862 0 0 0 0 0 10.2862 A0A251K2D7 Bms1-type G domain-containing protein MANES_09G003400 A0A251K2D7_MANES Manihot esculenta (Cassava) (Jatropha manihot) ribosome biogenesis [GO:0042254] nucleolus [GO:0005730] nucleolus [GO:0005730];GTP binding [GO:0005525];ribosome biogenesis [GO:0042254] GTP binding [GO:0005525] FHRDQVNESGFFDKLK 0.98291 0 10.3096 0 0 0 10.3096 0 0 A0A2C9WC48 RING-type domain-containing protein MANES_02G010100 A0A2C9WC48_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];polysaccharide binding [GO:0030247] polysaccharide binding [GO:0030247] ETLRTIPECNHYFHADCIDEWLK 1.007 0 10.503 0 0 0 0 0 10.503 A0A2C9VR24 Uncharacterized protein MANES_06G152500 A0A2C9VR24_MANES Manihot esculenta (Cassava) (Jatropha manihot) "peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase [GO:0017186]" integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];glutaminyl-peptide cyclotransferase activity [GO:0016603];peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase [GO:0017186]" glutaminyl-peptide cyclotransferase activity [GO:0016603] VIAKHIVK 0.96218 0 10.5175 0 0 0 0 0 10.5175 A0A2C9U986 C3H1-type domain-containing protein MANES_16G030100 A0A2C9U986_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA binding [GO:0003677];metal ion binding [GO:0046872] DNA binding [GO:0003677];metal ion binding [GO:0046872] PTWREGHLSK 0.95752 15.8325 10.5391 15.8325 0 15.2338 0 0 10.5391 A0A199U928 Uncharacterized protein MANES_S110600 A0A199U928_MANES Manihot esculenta (Cassava) (Jatropha manihot) GDWHCWGKQADLR 0.95885 0 10.5716 0 0 0 10.5716 0 0 A0A2C9VM35 Glyco_transf_64 domain-containing protein MANES_06G020900 A0A2C9VM35_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein glycosylation [GO:0006486] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];glycosyltransferase activity [GO:0016757];protein glycosylation [GO:0006486] glycosyltransferase activity [GO:0016757] YIYAGNGAEEPYPLK 0.97569 11.8261 10.6421 0 11.8261 0 0 0 10.6421 A0A2C9WIR0 Uncharacterized protein MANES_01G080700 A0A2C9WIR0_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleic acid binding [GO:0003676];zinc ion binding [GO:0008270] nucleic acid binding [GO:0003676];zinc ion binding [GO:0008270] RIKTHETQR 0.95506 0 10.6604 0 0 0 0 10.6604 0 A0A2C9VV16 AP2/ERF domain-containing protein MANES_05G106400 A0A2C9VV16_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] KRYVGVR 0.98174 11.0447 10.6604 0 0 11.0447 0 0 10.6604 A0A2C9ULV7 MI domain-containing protein MANES_14G145600 A0A2C9ULV7_MANES Manihot esculenta (Cassava) (Jatropha manihot) eukaryotic translation initiation factor 4F complex [GO:0016281] eukaryotic translation initiation factor 4F complex [GO:0016281];mRNA binding [GO:0003729];translation initiation factor activity [GO:0003743] mRNA binding [GO:0003729];translation initiation factor activity [GO:0003743] QADANQFNR 1.0189 0 10.6639 0 0 0 10.6639 0 0 A0A199UC14 Uncharacterized protein MANES_S022200 A0A199UC14_MANES Manihot esculenta (Cassava) (Jatropha manihot) GSNANFK 0.98144 0 10.7668 0 0 0 0 10.7668 0 A0A2C9W5N4 Cation_ATPase_N domain-containing protein MANES_03G081300 A0A2C9W5N4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of plasma membrane [GO:0005887];intracellular membrane-bounded organelle [GO:0043231] integral component of plasma membrane [GO:0005887];intracellular membrane-bounded organelle [GO:0043231];ATPase-coupled cation transmembrane transporter activity [GO:0019829];calmodulin binding [GO:0005516];P-type calcium transporter activity [GO:0005388] ATPase-coupled cation transmembrane transporter activity [GO:0019829];calmodulin binding [GO:0005516];P-type calcium transporter activity [GO:0005388] IVHKDHK 0.97666 0 10.7922 0 0 0 0 0 10.7922 A0A2C9U854 SPRY domain-containing protein MANES_16G020600 A0A2C9U854_MANES Manihot esculenta (Cassava) (Jatropha manihot) IAVVVFPKPEELK 0.9584 0 10.8757 0 0 0 0 0 10.8757 A0A2C9V163 MFS domain-containing protein MANES_11G098000 A0A2C9V163_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] DKVLDGENLTRPFLK 0.97654 0 10.9198 0 0 0 0 0 10.9198 A0A2C9UBG0 Uncharacterized protein MANES_16G134300 A0A2C9UBG0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" QADITIDEDLR 0.46154 0 10.9249 0 0 0 0 0 10.9249 A0A2C9UGI4 Uncharacterized protein MANES_15G170400 A0A2C9UGI4_MANES Manihot esculenta (Cassava) (Jatropha manihot) GDLELLKGMCFWMR 0.98102 14.6995 10.9413 14.6995 0 0 0 10.9413 0 A0A2C9UBA5 Uncharacterized protein MANES_16G122200 A0A2C9UBA5_MANES Manihot esculenta (Cassava) (Jatropha manihot) FDESSVMYWK 0.9837 0 11.0293 0 0 0 0 11.0293 0 A0A2C9UQW1 RNase III domain-containing protein MANES_13G113500 A0A2C9UQW1_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of gene expression [GO:0010468];RNA processing [GO:0006396];rRNA catabolic process [GO:0016075] nucleus [GO:0005634] nucleus [GO:0005634];double-stranded RNA binding [GO:0003725];ribonuclease III activity [GO:0004525];regulation of gene expression [GO:0010468];RNA processing [GO:0006396];rRNA catabolic process [GO:0016075] double-stranded RNA binding [GO:0003725];ribonuclease III activity [GO:0004525] LSWQDVAAYK 0.96101 16.7197 11.0555 0 16.7197 0 11.0555 0 0 A0A2C9V612 Uncharacterized protein MANES_10G143300 A0A2C9V612_MANES Manihot esculenta (Cassava) (Jatropha manihot) "chloroplast organization [GO:0009658];developmental process [GO:0032502];DNA-templated transcription, termination [GO:0006353];regulation of transcription, DNA-templated [GO:0006355]" chloroplast [GO:0009507] "chloroplast [GO:0009507];double-stranded DNA binding [GO:0003690];chloroplast organization [GO:0009658];developmental process [GO:0032502];DNA-templated transcription, termination [GO:0006353];regulation of transcription, DNA-templated [GO:0006355]" double-stranded DNA binding [GO:0003690] LHTNPDNFKKVLEEVR 0.98163 0 11.0626 0 0 0 0 11.0626 0 A0A2C9WIN5 MFS domain-containing protein MANES_02G225400 A0A2C9WIN5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] YLCMKGR 0.98013 18.4407 11.0631 18.4407 0 16.0181 0 0 11.0631 A0A2C9VE80 Uncharacterized protein MANES_08G019100 A0A2C9VE80_MANES Manihot esculenta (Cassava) (Jatropha manihot) "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" AAAEFFK 1.0114 0 11.0812 0 0 0 0 11.0812 0 A0A2C9UVD1 Protein kinase domain-containing protein MANES_12G103900 A0A2C9UVD1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] RALLVALR 0.96259 0 11.0928 0 0 0 0 0 11.0928 A0A251K118 Uncharacterized protein MANES_10G117500 A0A251K118_MANES Manihot esculenta (Cassava) (Jatropha manihot) HWFNAMR 0.97406 0 11.1065 0 0 0 0 11.1065 0 A0A0M4FEU9 NAC transcription factors 70 A0A0M4FEU9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" "DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] FHPTEEELVGYYLQR 0.97872 0 11.1129 0 0 0 11.1129 0 0 A0A2C9VU95 "Mannan endo-1,4-beta-mannosidase (EC 3.2.1.78)" MANES_05G006400 A0A2C9VU95_MANES Manihot esculenta (Cassava) (Jatropha manihot) organic substance metabolic process [GO:0071704] extracellular region [GO:0005576] "extracellular region [GO:0005576];mannan endo-1,4-beta-mannosidase activity [GO:0016985];organic substance metabolic process [GO:0071704]" "mannan endo-1,4-beta-mannosidase activity [GO:0016985]" KENASDMQM 0.88462 0 11.1336 0 0 0 0 11.1336 0 A0A2C9U537 Uncharacterized protein (Fragment) MANES_17G060300 A0A2C9U537_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] DADGALVWSTRTSNK 1.0085 0 11.1452 0 0 0 11.1452 0 0 A0A2C9V557 Uncharacterized protein MANES_10G107000 A0A2C9V557_MANES Manihot esculenta (Cassava) (Jatropha manihot) attachment of mitotic spindle microtubules to kinetochore [GO:0051315];mitotic spindle assembly checkpoint signaling [GO:0007094] kinetochore [GO:0000776];mitotic spindle [GO:0072686];nuclear envelope [GO:0005635] kinetochore [GO:0000776];mitotic spindle [GO:0072686];nuclear envelope [GO:0005635];attachment of mitotic spindle microtubules to kinetochore [GO:0051315];mitotic spindle assembly checkpoint signaling [GO:0007094] AESSATSAEEK 1.0143 0 11.152 0 0 0 0 0 11.152 A0A2C9W058 Aa_trans domain-containing protein MANES_04G068600 A0A2C9W058_MANES Manihot esculenta (Cassava) (Jatropha manihot) amino acid transport [GO:0006865];auxin-activated signaling pathway [GO:0009734] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];symporter activity [GO:0015293];amino acid transport [GO:0006865];auxin-activated signaling pathway [GO:0009734] symporter activity [GO:0015293] MPGVSYNPVRGSSDIER 1.0047 0 11.2152 0 0 0 0 11.2152 0 A0A2C9VYG0 DNA polymerase epsilon catalytic subunit (EC 2.7.7.7) MANES_04G006100 A0A2C9VYG0_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA repair [GO:0006281];DNA replication [GO:0006260] epsilon DNA polymerase complex [GO:0008622] "epsilon DNA polymerase complex [GO:0008622];4 iron, 4 sulfur cluster binding [GO:0051539];DNA binding [GO:0003677];DNA-directed DNA polymerase activity [GO:0003887];nucleotide binding [GO:0000166];zinc ion binding [GO:0008270];DNA repair [GO:0006281];DNA replication [GO:0006260]" "4 iron, 4 sulfur cluster binding [GO:0051539];DNA binding [GO:0003677];DNA-directed DNA polymerase activity [GO:0003887];nucleotide binding [GO:0000166];zinc ion binding [GO:0008270]" DLDLCRDTALLAQEWR 0.98425 0 11.2337 0 0 0 0 11.2337 0 A0A2C9V5L1 Uncharacterized protein MANES_10G123600 A0A2C9V5L1_MANES Manihot esculenta (Cassava) (Jatropha manihot) mRNA 3'-end processing by stem-loop binding and cleavage [GO:0006398];mRNA polyadenylation [GO:0006378];snRNA processing [GO:0016180] mRNA cleavage and polyadenylation specificity factor complex [GO:0005847] mRNA cleavage and polyadenylation specificity factor complex [GO:0005847];5'-3' exonuclease activity [GO:0008409];endoribonuclease activity [GO:0004521];RNA binding [GO:0003723];mRNA 3'-end processing by stem-loop binding and cleavage [GO:0006398];mRNA polyadenylation [GO:0006378];snRNA processing [GO:0016180] 5'-3' exonuclease activity [GO:0008409];endoribonuclease activity [GO:0004521];RNA binding [GO:0003723] TTFKGRVFMTHATK 0.97718 0 11.2359 0 0 0 0 0 11.2359 A0A2C9W988 J domain-containing protein MANES_03G199900 A0A2C9W988_MANES Manihot esculenta (Cassava) (Jatropha manihot) ESPIFDPSDYLFEGYPHTRNRVYK 1.0124 0 11.2422 0 0 0 0 11.2422 0 A0A2C9W4S3 Pectinesterase (EC 3.1.1.11) MANES_03G054300 A0A2C9W4S3_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910];cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910] SFIDGWTTFR 0.98356 15.4272 11.2653 0 15.4272 0 0 0 11.2653 A0A2C9U2L6 Uncharacterized protein MANES_18G090500 A0A2C9U2L6_MANES Manihot esculenta (Cassava) (Jatropha manihot) carboxylic acid metabolic process [GO:0019752] carboxy-lyase activity [GO:0016831];pyridoxal phosphate binding [GO:0030170];carboxylic acid metabolic process [GO:0019752] carboxy-lyase activity [GO:0016831];pyridoxal phosphate binding [GO:0030170] MYRMECVK 0.9798 0 11.2773 0 0 0 0 0 11.2773 A0A251LNC1 Nudix hydrolase domain-containing protein MANES_01G043400 A0A251LNC1_MANES Manihot esculenta (Cassava) (Jatropha manihot) EELGSIINDCGVVR 0.97816 0 11.2793 0 0 0 0 0 11.2793 A0A2C9W0R0 Uncharacterized protein MANES_04G040800 A0A2C9W0R0_MANES Manihot esculenta (Cassava) (Jatropha manihot) LDRFNETNFVR 0.9537 0 11.2938 0 0 0 11.2938 0 0 A0A2C9U968 UBC core domain-containing protein MANES_16G027500 A0A2C9U968_MANES Manihot esculenta (Cassava) (Jatropha manihot) ubiquitin conjugating enzyme activity [GO:0061631] ubiquitin conjugating enzyme activity [GO:0061631] GGSTGFK 0.97999 0 11.3141 0 0 0 11.3141 0 0 A0A2C9UHQ2 Uncharacterized protein MANES_15G167100 A0A2C9UHQ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) ITVCQLEIDRMVADGSEITRLK 0.98087 0 11.3306 0 0 0 0 0 11.3306 A0A2C9WI66 Protein kinase domain-containing protein MANES_02G199400 A0A2C9WI66_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein homodimerization activity [GO:0042803];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein homodimerization activity [GO:0042803];protein serine/threonine kinase activity [GO:0004674] LNDTVICWGQNNYSLEESLR 0.993 0 11.3536 0 0 0 0 0 11.3536 A0A2C9UHD8 Uncharacterized protein MANES_15G189200 A0A2C9UHD8_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975];positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436];protein ubiquitination [GO:0016567] cullin-RING ubiquitin ligase complex [GO:0031461];nucleus [GO:0005634] cullin-RING ubiquitin ligase complex [GO:0031461];nucleus [GO:0005634];ubiquitin ligase-substrate adaptor activity [GO:1990756];ubiquitin protein ligase binding [GO:0031625];carbohydrate metabolic process [GO:0005975];positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436];protein ubiquitination [GO:0016567] ubiquitin ligase-substrate adaptor activity [GO:1990756];ubiquitin protein ligase binding [GO:0031625] PGPEAGSVDGR 1 0 11.3568 0 0 0 11.3568 0 0 A0A2C9VP53 Uncharacterized protein MANES_06G085900 A0A2C9VP53_MANES Manihot esculenta (Cassava) (Jatropha manihot) GNTWLDANGSPAPSGGK 0.99007 0 11.3697 0 0 0 11.3697 0 0 A0A2C9UKG1 Uncharacterized protein MANES_14G101100 A0A2C9UKG1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] LLHTKHMK 0.97918 0 11.4039 0 0 0 0 11.4039 11.2257 A0A2C9V5M3 Uncharacterized protein MANES_10G071700 A0A2C9V5M3_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast stroma [GO:0009570] "chloroplast stroma [GO:0009570];4 iron, 4 sulfur cluster binding [GO:0051539];heme binding [GO:0020037];metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491]" "4 iron, 4 sulfur cluster binding [GO:0051539];heme binding [GO:0020037];metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491]" SKDSKDDIDVR 0.95352 0 11.4384 0 0 0 11.4384 0 0 A0A2C9ULN8 Uncharacterized protein MANES_14G109600 A0A2C9ULN8_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of cell cycle [GO:0051726] nucleus [GO:0005634] nucleus [GO:0005634];regulation of cell cycle [GO:0051726] TSSATFSQACSGLR 0.9787 0 11.4712 0 0 0 0 11.4712 0 A0A2C9UIS8 DNA-(apurinic or apyrimidinic site) endonuclease (EC 3.1.-.-) MANES_14G056000 A0A2C9UIS8_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA repair [GO:0006281] metal ion binding [GO:0046872];nuclease activity [GO:0004518];DNA repair [GO:0006281] metal ion binding [GO:0046872];nuclease activity [GO:0004518] MPAAGSK 0.95587 0 11.4768 0 0 0 0 0 11.4768 A0A2C9UUF9 Uncharacterized protein MANES_12G083900 A0A2C9UUF9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "chloroplast mRNA processing [GO:0010239];polycistronic mRNA processing [GO:0031426];regulation of photosynthesis, light reaction [GO:0042548]" chloroplast nucleoid [GO:0042644] "chloroplast nucleoid [GO:0042644];mRNA 5'-UTR binding [GO:0048027];chloroplast mRNA processing [GO:0010239];polycistronic mRNA processing [GO:0031426];regulation of photosynthesis, light reaction [GO:0042548]" mRNA 5'-UTR binding [GO:0048027] ELHSPNGNVHSDSSMK 1.0056 12.9327 11.478 12.9327 0 0 0 0 11.478 A0A2C9VTT7 RING-type domain-containing protein MANES_06G172200 A0A2C9VTT7_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of programmed cell death [GO:0043067] metal ion binding [GO:0046872];ubiquitin-protein transferase activity [GO:0004842];regulation of programmed cell death [GO:0043067] metal ion binding [GO:0046872];ubiquitin-protein transferase activity [GO:0004842] GETAAEMDDAQSCCGSSGEGEMKR 1.0141 0 11.4996 0 0 0 11.4996 0 0 A0A2C9W979 Uncharacterized protein MANES_03G198800 A0A2C9W979_MANES Manihot esculenta (Cassava) (Jatropha manihot) "flavin adenine dinucleotide binding [GO:0050660];oxidoreductase activity, acting on the CH-CH group of donors [GO:0016627]" "flavin adenine dinucleotide binding [GO:0050660];oxidoreductase activity, acting on the CH-CH group of donors [GO:0016627]" LPGVAPER 0.95135 0 11.5226 0 0 0 10.9955 0 11.5226 A0A2C9W7D4 Uncharacterized protein MANES_03G056500 A0A2C9W7D4_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to virus [GO:0051607];immune response [GO:0006955];post-transcriptional gene silencing by RNA [GO:0035194];production of small RNA involved in gene silencing by RNA [GO:0070918] ATP binding [GO:0005524];ribonuclease III activity [GO:0004525];RNA binding [GO:0003723];defense response to virus [GO:0051607];immune response [GO:0006955];post-transcriptional gene silencing by RNA [GO:0035194];production of small RNA involved in gene silencing by RNA [GO:0070918] ATP binding [GO:0005524];ribonuclease III activity [GO:0004525];RNA binding [GO:0003723] EQGRLIIGDA 0 0 11.5355 0 0 0 11.5355 0 0 A0A2C9VQL1 Uncharacterized protein (Fragment) MANES_06G058900 A0A2C9VQL1_MANES Manihot esculenta (Cassava) (Jatropha manihot) ALDRVEFICEASYDLLR 0.99844 0 11.5395 0 0 0 11.5395 0 0 A0A2C9WBS5 PALP domain-containing protein MANES_02G023000 A0A2C9WBS5_MANES Manihot esculenta (Cassava) (Jatropha manihot) D-serine biosynthetic process [GO:0070179];L-serine metabolic process [GO:0006563];pyruvate biosynthetic process [GO:0042866] ATP binding [GO:0005524];D-serine ammonia-lyase activity [GO:0008721];L-serine ammonia-lyase activity [GO:0003941];magnesium ion binding [GO:0000287];pyridoxal phosphate binding [GO:0030170];serine racemase activity [GO:0030378];threonine racemase activity [GO:0018114];D-serine biosynthetic process [GO:0070179];L-serine metabolic process [GO:0006563];pyruvate biosynthetic process [GO:0042866] ATP binding [GO:0005524];D-serine ammonia-lyase activity [GO:0008721];L-serine ammonia-lyase activity [GO:0003941];magnesium ion binding [GO:0000287];pyridoxal phosphate binding [GO:0030170];serine racemase activity [GO:0030378];threonine racemase activity [GO:0018114] MEMNNHISTEK 0.9992 0 11.5501 0 0 0 0 0 11.5501 A0A2C9US02 Phospholipid-transporting ATPase (EC 7.6.2.1) MANES_13G143600 A0A2C9US02_MANES Manihot esculenta (Cassava) (Jatropha manihot) phospholipid translocation [GO:0045332] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];ATPase-coupled intramembrane lipid transporter activity [GO:0140326];magnesium ion binding [GO:0000287];phospholipid translocation [GO:0045332] ATPase-coupled intramembrane lipid transporter activity [GO:0140326];ATP binding [GO:0005524];magnesium ion binding [GO:0000287] INTLQQAER 0.97909 0 11.5535 0 0 0 0 0 11.5535 A0A2C9V6G1 Protein kinase domain-containing protein MANES_10G109300 A0A2C9V6G1_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];ubiquitin-protein transferase activity [GO:0004842] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];ubiquitin-protein transferase activity [GO:0004842] DFIKKCLQVNPDDR 0.97911 0 11.5858 0 0 0 0 0 11.5858 A0A2C9W3F1 Protein kinase domain-containing protein MANES_03G004600 A0A2C9W3F1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] LCGGIAKFQLPK 0.95378 0 11.5861 0 0 0 0 0 11.5861 A0A2C9VQ57 Elongator complex protein 3 (EC 2.3.1.-) MANES_06G115200 A0A2C9VQ57_MANES Manihot esculenta (Cassava) (Jatropha manihot) tRNA wobble base 5-methoxycarbonylmethyl-2-thiouridinylation [GO:0002926] cytoplasm [GO:0005737];elongator holoenzyme complex [GO:0033588];nucleus [GO:0005634] "cytoplasm [GO:0005737];elongator holoenzyme complex [GO:0033588];nucleus [GO:0005634];4 iron, 4 sulfur cluster binding [GO:0051539];metal ion binding [GO:0046872];N-acetyltransferase activity [GO:0008080];tRNA binding [GO:0000049];tRNA uridine(34) acetyltransferase activity [GO:0106261];tRNA wobble base 5-methoxycarbonylmethyl-2-thiouridinylation [GO:0002926]" "4 iron, 4 sulfur cluster binding [GO:0051539];metal ion binding [GO:0046872];N-acetyltransferase activity [GO:0008080];tRNA binding [GO:0000049];tRNA uridine(34) acetyltransferase activity [GO:0106261]" YNPYVQAR 0.94949 0 11.5936 0 0 0 0 0 11.5936 A0A2C9TZB9 Glutamate receptor MANES_18G003400 A0A2C9TZB9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];G protein-coupled receptor activity [GO:0004930];ligand-gated ion channel activity [GO:0015276];signaling receptor activity [GO:0038023] G protein-coupled receptor activity [GO:0004930];ligand-gated ion channel activity [GO:0015276];signaling receptor activity [GO:0038023] VERSLSENDGDAK 0.95835 0 11.6127 0 0 0 11.6127 0 0 A0A2C9W404 Uncharacterized protein MANES_03G030600 A0A2C9W404_MANES Manihot esculenta (Cassava) (Jatropha manihot) arachidonic acid secretion [GO:0050482];lipid catabolic process [GO:0016042];phospholipid metabolic process [GO:0006644];pollen development [GO:0009555];pollen germination [GO:0009846];pollen tube growth [GO:0009860] extracellular region [GO:0005576];integral component of membrane [GO:0016021] extracellular region [GO:0005576];integral component of membrane [GO:0016021];calcium ion binding [GO:0005509];calcium-dependent phospholipase A2 activity [GO:0047498];phospholipid binding [GO:0005543];arachidonic acid secretion [GO:0050482];lipid catabolic process [GO:0016042];phospholipid metabolic process [GO:0006644];pollen development [GO:0009555];pollen germination [GO:0009846];pollen tube growth [GO:0009860] calcium-dependent phospholipase A2 activity [GO:0047498];calcium ion binding [GO:0005509];phospholipid binding [GO:0005543] PCDDLDACCKIHDECVEKK 0.99814 0 11.6258 0 0 0 0 0 11.6258 A0A2C9VIF8 Hexosyltransferase (EC 2.4.1.-) MANES_08G165700 A0A2C9VIF8_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall organization [GO:0071555];pectin biosynthetic process [GO:0045489] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021];polygalacturonate 4-alpha-galacturonosyltransferase activity [GO:0047262];cell wall organization [GO:0071555];pectin biosynthetic process [GO:0045489] polygalacturonate 4-alpha-galacturonosyltransferase activity [GO:0047262] AYFPSIAK 0.98421 13.6346 11.6453 13.6346 0 0 0 11.6453 0 A0A2C9UBT8 Uncharacterized protein MANES_15G001500 A0A2C9UBT8_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] FSDGPSRFSDAPVNRYSTNGTNTSSNYDR 1.0603 0 11.6468 0 0 0 0 11.6468 0 A0A251JHD8 Uncharacterized protein MANES_13G082700 A0A251JHD8_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA replication-dependent chromatin assembly [GO:0006335] DNA replication-dependent chromatin assembly [GO:0006335] TKAVEKMNYVCQHVIAK 1 0 11.651 0 0 0 0 0 11.651 A0A2C9V2N2 MFS domain-containing protein MANES_11G149700 A0A2C9V2N2_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular response to nitrate [GO:0071249];nitrate assimilation [GO:0042128];nitrate transport [GO:0015706] integral component of membrane [GO:0016021];plant-type vacuole membrane [GO:0009705];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plant-type vacuole membrane [GO:0009705];plasma membrane [GO:0005886];nitrate transmembrane transporter activity [GO:0015112];cellular response to nitrate [GO:0071249];nitrate assimilation [GO:0042128];nitrate transport [GO:0015706] nitrate transmembrane transporter activity [GO:0015112] PFGGFASDRAAR 0.9533 0 11.6548 0 0 0 11.6548 0 0 A0A2C9WBJ4 Uncharacterized protein MANES_02G016200 A0A2C9WBJ4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];calcium ion binding [GO:0005509];NAD(P)H oxidase H2O2-forming activity [GO:0016174];peroxidase activity [GO:0004601] calcium ion binding [GO:0005509];NAD(P)H oxidase H2O2-forming activity [GO:0016174];peroxidase activity [GO:0004601] FEFHKEHF 0.96293 0 11.6589 0 0 0 11.6589 0 0 A0A2C9VG87 Uncharacterized protein MANES_08G098900 A0A2C9VG87_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] HDNGGNIIR 0.97735 0 11.67 0 0 0 11.67 0 0 A0A2C9UY21 "(1->3)-beta-glucan endohydrolase (EC 3.2.1.39) (Beta-1,3-endoglucanase)" MANES_12G144400 A0A2C9UY21_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] anchored component of plasma membrane [GO:0046658];integral component of membrane [GO:0016021] "anchored component of plasma membrane [GO:0046658];integral component of membrane [GO:0016021];glucan endo-1,3-beta-D-glucosidase activity [GO:0042973];carbohydrate metabolic process [GO:0005975]" "glucan endo-1,3-beta-D-glucosidase activity [GO:0042973]" NVSYSNVFDANYDTLVWALHK 0.97294 0 11.6982 0 0 0 0 0 11.6982 A0A2C9VIW1 Uncharacterized protein MANES_08G164000 A0A2C9VIW1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "post-embryonic development [GO:0009791];regulation of transcription, DNA-templated [GO:0006355];reproductive structure development [GO:0048608];shoot system development [GO:0048367]" "post-embryonic development [GO:0009791];regulation of transcription, DNA-templated [GO:0006355];reproductive structure development [GO:0048608];shoot system development [GO:0048367]" QLCIVTCGDDK 0.99516 0 11.6991 0 0 0 11.6991 0 0 A0A2C9WEV8 G protein gamma domain-containing protein MANES_02G165500 A0A2C9WEV8_MANES Manihot esculenta (Cassava) (Jatropha manihot) G protein-coupled receptor signaling pathway [GO:0007186] G protein-coupled receptor signaling pathway [GO:0007186] EQDSAPMDDPLSSPAKPRR 0.99813 0 11.7221 0 0 0 0 11.7221 0 A0A2C9UQ69 Asparagine--tRNA ligase (EC 6.1.1.22) MANES_13G053400 A0A2C9UQ69_MANES Manihot esculenta (Cassava) (Jatropha manihot) asparaginyl-tRNA aminoacylation [GO:0006421] mitochondrion [GO:0005739] mitochondrion [GO:0005739];asparagine-tRNA ligase activity [GO:0004816];ATP binding [GO:0005524];asparaginyl-tRNA aminoacylation [GO:0006421] asparagine-tRNA ligase activity [GO:0004816];ATP binding [GO:0005524] FLCKWVLENCSADMK 0.96337 14.4348 11.7249 14.4348 0 0 0 0 11.7249 A0A2C9WJX5 Uncharacterized protein MANES_01G114700 A0A2C9WJX5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] NYQPPAEWMEWEKQFYTR 1 0 11.7267 0 0 0 11.7267 0 0 A0A2C9U2R2 Dynamin GTPase (EC 3.6.5.5) MANES_18G111800 A0A2C9U2R2_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737];membrane [GO:0016020];microtubule [GO:0005874] cytoplasm [GO:0005737];membrane [GO:0016020];microtubule [GO:0005874];GTP binding [GO:0005525];GTPase activity [GO:0003924];microtubule binding [GO:0008017] GTPase activity [GO:0003924];GTP binding [GO:0005525];microtubule binding [GO:0008017] SILLQIDNK 0.97846 0 11.7295 0 0 0 11.7295 0 0 A0A2C9WB26 Galectin domain-containing protein MANES_03G209300 A0A2C9WB26_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein glycosylation [GO:0006486] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021];carbohydrate binding [GO:0030246];galactosyltransferase activity [GO:0008378];protein glycosylation [GO:0006486] carbohydrate binding [GO:0030246];galactosyltransferase activity [GO:0008378] ILKIPLALPR 1.0033 14.2101 11.7305 0 0 14.2101 11.7305 0 0 A0A2C9V0Q4 Uncharacterized protein MANES_11G054800 A0A2C9V0Q4_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650];carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650] YNPGKILR 0.97979 12.7459 11.7404 0 12.7459 0 0 0 11.7404 A0A2C9U3W9 Uncharacterized protein MANES_17G003100 A0A2C9U3W9_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive regulation of transcription by RNA polymerase II [GO:0045944] nucleus [GO:0005634] nucleus [GO:0005634];transcription cis-regulatory region binding [GO:0000976];positive regulation of transcription by RNA polymerase II [GO:0045944] transcription cis-regulatory region binding [GO:0000976] EEISMFLEECERSPEKR 1.0029 0 11.7442 0 0 0 11.7442 0 0 A0A2C9US22 PPR_long domain-containing protein MANES_13G150200 A0A2C9US22_MANES Manihot esculenta (Cassava) (Jatropha manihot) VLKDAGEFDR 0.95812 17.5529 11.7732 15.8649 17.5529 0 0 0 11.7732 A0A2C9UJL1 Uncharacterized protein MANES_14G011200 A0A2C9UJL1_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA replication initiation [GO:0006270] nucleolus [GO:0005730] nucleolus [GO:0005730];chromatin binding [GO:0003682];DNA replication initiation [GO:0006270] chromatin binding [GO:0003682] TVASSCICVRR 0.95028 0 11.7821 0 0 0 0 0 11.7821 A0A2C9U6G9 Protein kinase domain-containing protein MANES_17G105500 A0A2C9U6G9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] IQLGDNFFR 1.0168 0 11.808 0 0 0 0 11.808 0 A0A2C9WAT8 Uncharacterized protein MANES_03G171900 A0A2C9WAT8_MANES Manihot esculenta (Cassava) (Jatropha manihot) EAGEPPVHNQKFEGTEEDNTNTEAQGKSLQEPVHK 0.93939 0 11.8196 0 0 0 11.8196 0 0 A0A2C9W6X9 RING-type domain-containing protein MANES_03G042200 A0A2C9W6X9_MANES Manihot esculenta (Cassava) (Jatropha manihot) MTCNHIFHERCIFGWLKVQNSCPTCR 1.0236 0 11.826 0 0 0 0 0 11.826 A0A2C9VT75 Abhydrolase_3 domain-containing protein MANES_05G042800 A0A2C9VT75_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrolase activity [GO:0016787] hydrolase activity [GO:0016787] QALDPDGER 1.0223 0 11.8271 0 0 0 11.8271 0 0 A0A2C9UCI4 Uncharacterized protein MANES_16G133700 A0A2C9UCI4_MANES Manihot esculenta (Cassava) (Jatropha manihot) anatomical structure development [GO:0048856];protein autophosphorylation [GO:0046777];response to chemical [GO:0042221] integral component of plasma membrane [GO:0005887] integral component of plasma membrane [GO:0005887];histidine phosphotransfer kinase activity [GO:0009927];phosphorelay sensor kinase activity [GO:0000155];anatomical structure development [GO:0048856];protein autophosphorylation [GO:0046777];response to chemical [GO:0042221] histidine phosphotransfer kinase activity [GO:0009927];phosphorelay sensor kinase activity [GO:0000155] VEVEAEYDTVAYWKQR 0.9876 0 11.8521 0 0 0 0 11.8521 0 A0A2C9WQ53 Uncharacterized protein MANES_01G203100 A0A2C9WQ53_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of monopolar cell growth [GO:0051513] regulation of monopolar cell growth [GO:0051513] PLTVETQR 0.94951 0 11.8737 0 0 0 11.8737 0 0 A0A2C9VXK3 Uncharacterized protein MANES_05G185500 A0A2C9VXK3_MANES Manihot esculenta (Cassava) (Jatropha manihot) HDQDRTEEEESDEVEDLIDVDDR 1.0084 0 11.8812 0 0 0 0 11.8812 0 A0A2C9UE88 Uncharacterized protein MANES_15G090200 A0A2C9UE88_MANES Manihot esculenta (Cassava) (Jatropha manihot) ETWVCSTDFIRWLPEHSRPVK 0.97802 0 11.8884 0 0 0 11.8884 0 0 A0A2C9UJE8 Protein kinase domain-containing protein MANES_14G033500 A0A2C9UJE8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] ALMDMKAALDPEDMYLSSWTMNGDPCDGSFEGVACNDK 1.0567 0 11.9 0 0 0 0 0 11.9 A0A2C9U966 Mediator of RNA polymerase II transcription subunit 11 (Mediator complex subunit 11) MED11 MANES_16G001300 A0A2C9U966_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of transcription by RNA polymerase II [GO:0006357] mediator complex [GO:0016592] mediator complex [GO:0016592];transcription coregulator activity [GO:0003712];regulation of transcription by RNA polymerase II [GO:0006357] transcription coregulator activity [GO:0003712] MDPSQTQTSSLQRLQDVEKK 1.011 0 11.9033 0 0 0 0 11.9033 0 A0A2C9VM57 Kin17_mid domain-containing protein MANES_07G115700 A0A2C9VM57_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular response to DNA damage stimulus [GO:0006974];DNA replication [GO:0006260] nucleus [GO:0005634] nucleus [GO:0005634];double-stranded DNA binding [GO:0003690];cellular response to DNA damage stimulus [GO:0006974];DNA replication [GO:0006260] double-stranded DNA binding [GO:0003690] WYCQMCQKQCRDENGFK 1.0016 0 11.9129 0 0 0 0 0 11.9129 A0A2C9VNA0 Uncharacterized protein MANES_06G013000 A0A2C9VNA0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein tyrosine kinase activity [GO:0004713] ATP binding [GO:0005524];protein tyrosine kinase activity [GO:0004713] CNMSHAFICMLDVENKCYHMRCHR 1.0108 0 11.919 0 0 0 11.919 0 0 A0A2C9UX68 Annexin MANES_11G003900 A0A2C9UX68_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to stress [GO:0006950] calcium ion binding [GO:0005509];calcium-dependent phospholipid binding [GO:0005544];response to stress [GO:0006950] calcium-dependent phospholipid binding [GO:0005544];calcium ion binding [GO:0005509] ETSGDYK 0.97739 0 11.9212 0 0 0 0 0 11.9212 A0A2C9WDL5 Uncharacterized protein MANES_02G136900 A0A2C9WDL5_MANES Manihot esculenta (Cassava) (Jatropha manihot) ARIVQMGMK 0.95547 0 11.9273 0 0 0 0 11.9273 0 A0A2C9UJP1 COBRA-like protein MANES_14G087800 A0A2C9UJP1_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellulose microfibril organization [GO:0010215];plant-type cell wall cellulose biosynthetic process [GO:0052324] anchored component of plasma membrane [GO:0046658] anchored component of plasma membrane [GO:0046658];cellulose microfibril organization [GO:0010215];plant-type cell wall cellulose biosynthetic process [GO:0052324] EYWRAKVAVTNFNYR 0.97591 0 11.9301 0 0 0 0 0 11.9301 A0A2C9UZI2 RING-type domain-containing protein MANES_11G091600 A0A2C9UZI2_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872] metal ion binding [GO:0046872] MASSSSMK 0.99581 0 11.9368 0 0 0 11.9368 0 0 A0A2C9V2X8 Uncharacterized protein MANES_10G039300 A0A2C9V2X8_MANES Manihot esculenta (Cassava) (Jatropha manihot) GQDDYEDGEVR 0.9984 0 11.9398 0 0 0 0 0 11.9398 A0A2C9VEX2 Uncharacterized protein MANES_08G053900 A0A2C9VEX2_MANES Manihot esculenta (Cassava) (Jatropha manihot) LLNRSFR 0.96133 0 11.943 0 0 0 0 0 11.943 A0A2C9VS83 AIG1-type G domain-containing protein MANES_05G006000 A0A2C9VS83_MANES Manihot esculenta (Cassava) (Jatropha manihot) GTP binding [GO:0005525] GTP binding [GO:0005525] LLEGSESNDR 0.9817 0 11.9756 0 0 0 0 0 11.9756 A0A2C9V2F8 C2 domain-containing protein MANES_10G017000 A0A2C9V2F8_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] defense response [GO:0006952] LSTKSDDSGSTR 1.0135 0 11.9778 0 0 0 11.9778 0 0 A0A2C9W1K4 Uncharacterized protein MANES_04G111800 A0A2C9W1K4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] RVSSPIQASNSPEESSSTNNSNGISQEDLK 0.89873 0 11.9921 0 0 0 0 0 11.9921 A0A2C9U456 Uncharacterized protein MANES_17G025800 A0A2C9U456_MANES Manihot esculenta (Cassava) (Jatropha manihot) WLCQSHDSISPDDEYRSSR 0.99721 0 11.9924 0 0 0 11.9924 0 0 A0A2C9UH02 Uncharacterized protein MANES_15G170700 A0A2C9UH02_MANES Manihot esculenta (Cassava) (Jatropha manihot) MYVKKYK 0.96736 0 11.9941 0 0 0 11.9941 0 0 A0A2C9W1U8 Uncharacterized protein MANES_04G121200 A0A2C9W1U8_MANES Manihot esculenta (Cassava) (Jatropha manihot) N-terminal peptidyl-methionine acetylation [GO:0017196] cytoplasm [GO:0005737] cytoplasm [GO:0005737];N-terminal peptidyl-methionine acetylation [GO:0017196] CAEYFPYSTYFEGK 0.98235 14.2237 12.0016 0 14.2237 0 0 0 12.0016 A0A2C9VYJ9 Uncharacterized protein MANES_04G010200 A0A2C9VYJ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "ATP binding [GO:0005524];hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [GO:0016818];nucleic acid binding [GO:0003676];zinc ion binding [GO:0008270]" "ATP binding [GO:0005524];hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [GO:0016818];nucleic acid binding [GO:0003676];zinc ion binding [GO:0008270]" QELITAPTDSRFQIDIEKSWVESSK 1.0187 0 12.0033 0 0 0 0 12.0033 0 A0A251J000 Reticulon-like protein MANES_16G087200 A0A251J000_MANES Manihot esculenta (Cassava) (Jatropha manihot) steroid biosynthetic process [GO:0006694] endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021] "endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021];3-beta-hydroxy-delta5-steroid dehydrogenase activity [GO:0003854];oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616];steroid biosynthetic process [GO:0006694]" "3-beta-hydroxy-delta5-steroid dehydrogenase activity [GO:0003854];oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]" PSSIFGPGDR 0.98964 0 12.0179 0 0 0 0 0 12.0179 A0A2C9UTN2 F-box domain-containing protein MANES_12G010000 A0A2C9UTN2_MANES Manihot esculenta (Cassava) (Jatropha manihot) IAVGMTLNGNATSEGYR 1.0353 0 12.0266 0 0 0 0 12.0266 0 A0A2C9ULZ9 Uncharacterized protein MANES_14G113800 A0A2C9ULZ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" chromatin [GO:0000785];nucleus [GO:0005634] "chromatin [GO:0000785];nucleus [GO:0005634];histone methyltransferase activity (H3-K36 specific) [GO:0046975];metal ion binding [GO:0046872];regulation of transcription, DNA-templated [GO:0006355]" histone methyltransferase activity (H3-K36 specific) [GO:0046975];metal ion binding [GO:0046872] ACRCPENCTNR 0.97164 0 12.0323 0 0 0 0 12.0323 0 A0A2C9VFK8 Uncharacterized protein MANES_08G119700 A0A2C9VFK8_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];transcription corepressor activity [GO:0003714] transcription corepressor activity [GO:0003714] KMWNILSFYYGEFYR 0.98004 0 12.034 0 0 0 0 0 12.034 A0A2C9W0D7 Non-specific serine/threonine protein kinase (EC 2.7.11.1) MANES_04G069900 A0A2C9W0D7_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA damage checkpoint signaling [GO:0000077];DNA repair [GO:0006281];telomere maintenance [GO:0000723] nucleus [GO:0005634] nucleus [GO:0005634];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];DNA damage checkpoint signaling [GO:0000077];DNA repair [GO:0006281];telomere maintenance [GO:0000723] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] GFSCQRFK 0.97674 15.6322 12.0547 0 15.6322 0 0 12.0547 0 A0A2C9WDX9 Uncharacterized protein MANES_02G145700 A0A2C9WDX9_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein deubiquitination [GO:0016579];ubiquitin-dependent protein catabolic process [GO:0006511] cytosol [GO:0005829];integral component of membrane [GO:0016021];nucleus [GO:0005634] cytosol [GO:0005829];integral component of membrane [GO:0016021];nucleus [GO:0005634];cysteine-type endopeptidase activity [GO:0004197];metal ion binding [GO:0046872];thiol-dependent deubiquitinase [GO:0004843];protein deubiquitination [GO:0016579];ubiquitin-dependent protein catabolic process [GO:0006511] cysteine-type endopeptidase activity [GO:0004197];metal ion binding [GO:0046872];thiol-dependent deubiquitinase [GO:0004843] CMRCHYK 0.97874 0 12.0678 0 0 0 12.0678 0 0 A0A2C9WQ78 Hcy-binding domain-containing protein MANES_01G205100 A0A2C9WQ78_MANES Manihot esculenta (Cassava) (Jatropha manihot) methionine biosynthetic process [GO:0009086];methylation [GO:0032259];S-methylmethionine cycle [GO:0033528] betaine-homocysteine S-methyltransferase activity [GO:0047150];S-adenosylmethionine-homocysteine S-methyltransferase activity [GO:0008898];zinc ion binding [GO:0008270];methionine biosynthetic process [GO:0009086];methylation [GO:0032259];S-methylmethionine cycle [GO:0033528] betaine-homocysteine S-methyltransferase activity [GO:0047150];S-adenosylmethionine-homocysteine S-methyltransferase activity [GO:0008898];zinc ion binding [GO:0008270] GFSSEESEAMLR 0.94842 0 12.0883 0 0 0 12.0883 0 0 A0A2C9VPM0 Glucose-6-phosphate 1-epimerase (EC 5.1.3.15) MANES_06G021500 A0A2C9VPM0_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] cytoplasm [GO:0005737] cytoplasm [GO:0005737];carbohydrate binding [GO:0030246];glucose-6-phosphate 1-epimerase activity [GO:0047938];carbohydrate metabolic process [GO:0005975] carbohydrate binding [GO:0030246];glucose-6-phosphate 1-epimerase activity [GO:0047938] PTEEDLK 0.95361 0 12.0966 0 0 0 12.0966 0 0 A0A2C9W2W0 Uncharacterized protein MANES_04G151100 A0A2C9W2W0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "auxin homeostasis [GO:0010252];endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000480];endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000447];endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000472];regulation of translation [GO:0006417];response to glucose [GO:0009749];response to sucrose [GO:0009744];ribosomal small subunit export from nucleus [GO:0000056]" "90S preribosome [GO:0030686];nucleolus [GO:0005730];preribosome, small subunit precursor [GO:0030688]" "90S preribosome [GO:0030686];nucleolus [GO:0005730];preribosome, small subunit precursor [GO:0030688];RNA binding [GO:0003723];auxin homeostasis [GO:0010252];endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000480];endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000447];endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000472];regulation of translation [GO:0006417];response to glucose [GO:0009749];response to sucrose [GO:0009744];ribosomal small subunit export from nucleus [GO:0000056]" RNA binding [GO:0003723] SVSGPGR 0.98279 0 12.1146 0 0 0 12.1146 0 0 A0A251JG44 Uncharacterized protein MANES_16G102200 A0A251JG44_MANES Manihot esculenta (Cassava) (Jatropha manihot) FMVSASR 0.98172 0 12.116 0 0 0 0 12.116 0 A0A2C9USL6 Fn3_like domain-containing protein MANES_13G104300 A0A2C9USL6_MANES Manihot esculenta (Cassava) (Jatropha manihot) arabinan catabolic process [GO:0031222];xylan catabolic process [GO:0045493] extracellular region [GO:0005576] "extracellular region [GO:0005576];alpha-L-arabinofuranosidase activity [GO:0046556];xylan 1,4-beta-xylosidase activity [GO:0009044];arabinan catabolic process [GO:0031222];xylan catabolic process [GO:0045493]" "alpha-L-arabinofuranosidase activity [GO:0046556];xylan 1,4-beta-xylosidase activity [GO:0009044]" HFTAYDLEKWGNFSR 0.97883 0 12.1174 0 0 0 12.1174 0 0 A0A251LUP9 Uncharacterized protein MANES_01G224100 A0A251LUP9_MANES Manihot esculenta (Cassava) (Jatropha manihot) PLKEYDEKMVIEIYK 0.97659 0 12.1226 0 0 0 0 0 12.1226 A0A2C9WDR9 Protein kinase domain-containing protein MANES_02G090800 A0A2C9WDR9_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] GVWNGTDVAIK 1.0127 0 12.1603 0 0 0 0 12.1603 0 A0A2C9V2C0 Uncharacterized protein MANES_10G013600 A0A2C9V2C0_MANES Manihot esculenta (Cassava) (Jatropha manihot) mRNA transport [GO:0051028];protein transport [GO:0015031];ribosomal large subunit export from nucleus [GO:0000055];ribosomal small subunit export from nucleus [GO:0000056] nuclear pore [GO:0005643] nuclear pore [GO:0005643];structural constituent of nuclear pore [GO:0017056];mRNA transport [GO:0051028];protein transport [GO:0015031];ribosomal large subunit export from nucleus [GO:0000055];ribosomal small subunit export from nucleus [GO:0000056] structural constituent of nuclear pore [GO:0017056] RAASICPADFSFGGDHLWDR 0.99186 0 12.1628 0 0 0 0 0 12.1628 A0A251JPR6 Uncharacterized protein MANES_12G121200 A0A251JPR6_MANES Manihot esculenta (Cassava) (Jatropha manihot) AGAMYRGGMPSPVTK 1.0138 0 12.1672 0 0 0 0 0 12.1672 A0A2C9VVF3 Uncharacterized protein MANES_05G068900 A0A2C9VVF3_MANES Manihot esculenta (Cassava) (Jatropha manihot) transmembrane transport [GO:0055085] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];transmembrane transport [GO:0055085] NGFHCAYQVMLTEGSSALYKGGFAIFAR 1.0625 0 12.1708 0 0 0 0 0 12.1708 A0A2C9W012 G domain-containing protein MANES_04G058400 A0A2C9W012_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbon fixation [GO:0015977];tricarboxylic acid cycle [GO:0006099] nucleolus [GO:0005730] nucleolus [GO:0005730];GTP binding [GO:0005525];phosphoenolpyruvate carboxylase activity [GO:0008964];carbon fixation [GO:0015977];tricarboxylic acid cycle [GO:0006099] GTP binding [GO:0005525];phosphoenolpyruvate carboxylase activity [GO:0008964] YLGMGMYSEWDEEKK 1.0297 0 12.1803 0 0 0 0 0 12.1803 A0A2C9UWY0 ABC transporter domain-containing protein MANES_12G157000 A0A2C9UWY0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524] ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524] SGKCLQYMFGR 0.95375 0 12.1886 0 0 0 0 0 12.1886 A0A2C9V2G5 Dof-type domain-containing protein MANES_11G140300 A0A2C9V2G5_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] CPRCDSTNTKFCYYNNYSLSQPR 1.0014 0 12.1983 0 0 0 12.1983 0 0 A0A2C9V2Z8 Uncharacterized protein MANES_10G033400 A0A2C9V2Z8_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677] DNA binding [GO:0003677] AFAAGNFLEGGDVCIFELIK 1.0157 0 12.215 0 0 0 0 0 12.215 A0A2C9U1I7 F-box domain-containing protein MANES_18G077300 A0A2C9U1I7_MANES Manihot esculenta (Cassava) (Jatropha manihot) CYMLSARDLTIVWSDTPVYWRWVSDPDSR 1.0605 0 12.2187 0 0 0 12.2187 0 0 A0A2C9UKI9 Uncharacterized protein MANES_14G104700 A0A2C9UKI9_MANES Manihot esculenta (Cassava) (Jatropha manihot) FIEWFRQEMR 0.95408 0 12.2193 0 0 0 0 12.2193 0 A0A2C9V408 U-box domain-containing protein MANES_10G001500 A0A2C9V408_MANES Manihot esculenta (Cassava) (Jatropha manihot) ubiquitin-protein transferase activity [GO:0004842] ubiquitin-protein transferase activity [GO:0004842] LFSTSNSAADAANNR 1.0137 0 12.2412 0 0 0 0 0 12.2412 A0A2C9VCI7 Uncharacterized protein MANES_08G015000 A0A2C9VCI7_MANES Manihot esculenta (Cassava) (Jatropha manihot) snRNA transcription by RNA polymerase II [GO:0042795];snRNA transcription by RNA polymerase III [GO:0042796] nucleus [GO:0005634];snRNA-activating protein complex [GO:0019185] nucleus [GO:0005634];snRNA-activating protein complex [GO:0019185];bent DNA binding [GO:0003681];RNA polymerase III type 3 promoter sequence-specific DNA binding [GO:0001006];snRNA transcription by RNA polymerase II [GO:0042795];snRNA transcription by RNA polymerase III [GO:0042796] bent DNA binding [GO:0003681];RNA polymerase III type 3 promoter sequence-specific DNA binding [GO:0001006] TQEFLVLGRQMLTEMRDR 1 0 12.2434 0 0 0 0 0 12.2434 A0A2C9W6A1 Uncharacterized protein MANES_03G020000 A0A2C9W6A1_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein localization [GO:0008104];protein transport [GO:0015031] protein localization [GO:0008104];protein transport [GO:0015031] HCPEDCR 0.98086 0 12.2444 0 0 0 0 12.2444 0 A0A2C9U107 PH domain-containing protein MANES_18G073400 A0A2C9U107_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid transport [GO:0006869] lipid binding [GO:0008289];lipid transport [GO:0006869] lipid binding [GO:0008289] RNKPPQFPTR 0.99184 0 12.2464 0 0 0 0 0 12.2464 A0A2C9VPT1 Reticulon-like protein MANES_06G065100 A0A2C9VPT1_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to bacterium [GO:0009617] endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021] endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021];response to bacterium [GO:0009617] NLFENFNKR 0.97989 0 12.2618 0 0 0 0 0 12.2618 A0A2C9VG39 Uncharacterized protein MANES_08G072200 A0A2C9VG39_MANES Manihot esculenta (Cassava) (Jatropha manihot) HFINSSSSR 1.0211 0 12.2781 0 0 0 0 0 12.2781 A0A2C9U4B9 E1 ubiquitin-activating enzyme (EC 6.2.1.45) MANES_18G144400 A0A2C9U4B9_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular response to DNA damage stimulus [GO:0006974];protein modification by small protein conjugation [GO:0032446];protein ubiquitination [GO:0016567];ubiquitin-dependent protein catabolic process [GO:0006511] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];ATP binding [GO:0005524];ubiquitin activating enzyme activity [GO:0004839];cellular response to DNA damage stimulus [GO:0006974];protein modification by small protein conjugation [GO:0032446];protein ubiquitination [GO:0016567];ubiquitin-dependent protein catabolic process [GO:0006511] ATP binding [GO:0005524];ubiquitin activating enzyme activity [GO:0004839] KVVDLVR 1 0 12.2784 0 0 0 0 12.2784 0 A0A2C9V094 DYW_deaminase domain-containing protein MANES_11G056600 A0A2C9V094_MANES Manihot esculenta (Cassava) (Jatropha manihot) zinc ion binding [GO:0008270] zinc ion binding [GO:0008270] KLLVCIIDSLRVEGYTPHTSNVFHDIEEEEK 0.9 0 12.282 0 0 0 0 0 12.282 A0A2C9USS4 Uncharacterized protein MANES_12G016300 A0A2C9USS4_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] cytoplasm [GO:0005737] ACTLCIPR 0.99497 0 12.2895 0 0 0 12.2895 0 0 A0A2C9WE49 Uncharacterized protein MANES_02G152500 A0A2C9WE49_MANES Manihot esculenta (Cassava) (Jatropha manihot) LLDDHSMR 1.0026 0 12.2928 0 0 0 12.2928 0 10.6546 A0A2C9VHI7 Protein kinase domain-containing protein MANES_08G142700 A0A2C9VHI7_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] LHLSDNYFIGELPR 0.98359 0 12.2992 0 0 0 0 0 12.2992 A0A2C9VJ87 Uncharacterized protein MANES_07G070700 A0A2C9VJ87_MANES Manihot esculenta (Cassava) (Jatropha manihot) KTKEEYTYANWK 0.95315 0 12.3023 0 0 0 0 12.3023 0 A0A2C9W4T8 Chalcone isomerase (EC 5.5.1.6) MANES_03G054000 A0A2C9W4T8_MANES Manihot esculenta (Cassava) (Jatropha manihot) flavonoid biosynthetic process [GO:0009813] chloroplast stroma [GO:0009570] chloroplast stroma [GO:0009570];fatty acid binding [GO:0005504];intramolecular lyase activity [GO:0016872];flavonoid biosynthetic process [GO:0009813] fatty acid binding [GO:0005504];intramolecular lyase activity [GO:0016872] FLYIPGSMAFQEALKCMSK 1.0029 0 12.3332 0 0 0 12.3332 0 0 A0A2C9W9T2 HSF_DOMAIN domain-containing protein MANES_03G173200 A0A2C9W9T2_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular response to heat [GO:0034605];regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];methyltransferase activity [GO:0008168];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];cellular response to heat [GO:0034605];regulation of transcription by RNA polymerase II [GO:0006357] DNA-binding transcription factor activity [GO:0003700];methyltransferase activity [GO:0008168];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978] QQQMMGFLAKAMR 0.95932 0 12.3814 0 0 0 12.3814 0 0 A0A2C9UPT6 Uncharacterized protein MANES_13G072300 A0A2C9UPT6_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell differentiation [GO:0030154] nucleus [GO:0005634] nucleus [GO:0005634];transcription cis-regulatory region binding [GO:0000976];cell differentiation [GO:0030154] transcription cis-regulatory region binding [GO:0000976] MYNLVGER 0.95121 0 12.3839 0 0 0 12.3839 0 0 A0A2C9U7N6 RanBP2-type domain-containing protein MANES_16G005800 A0A2C9U7N6_MANES Manihot esculenta (Cassava) (Jatropha manihot) double-strand break repair [GO:0006302] cytoplasm [GO:0005737];PML body [GO:0016605] cytoplasm [GO:0005737];PML body [GO:0016605];5'-tyrosyl-DNA phosphodiesterase activity [GO:0070260];metal ion binding [GO:0046872];single-stranded DNA binding [GO:0003697];double-strand break repair [GO:0006302] 5'-tyrosyl-DNA phosphodiesterase activity [GO:0070260];metal ion binding [GO:0046872];single-stranded DNA binding [GO:0003697] NSACEICGTRGSLSSLSSFEVLNDVGPDEDLDSSIGSVFVPLR 1.04 11.9221 12.3904 11.9221 0 0 0 0 12.3904 A0A2C9WHD6 Uncharacterized protein MANES_02G171400 A0A2C9WHD6_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell surface receptor signaling pathway [GO:0007166] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];calcium ion binding [GO:0005509];polysaccharide binding [GO:0030247];protein serine/threonine kinase activity [GO:0004674];cell surface receptor signaling pathway [GO:0007166] ATP binding [GO:0005524];calcium ion binding [GO:0005509];polysaccharide binding [GO:0030247];protein serine/threonine kinase activity [GO:0004674] FTVVGCDSYAYLLGSRAGLKYSAGCMSICDSIK 0.9537 0 12.4074 0 0 0 12.4074 0 0 A0A2C9WP27 Protein kinase domain-containing protein MANES_01G258200 A0A2C9WP27_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] HPNIVQFLGVLKHPDRLIFLTDYLR 1.0305 0 12.4081 0 0 0 12.4081 0 0 A0A2C9VQS7 TPX2_importin domain-containing protein MANES_06G138800 A0A2C9VQS7_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitotic spindle assembly [GO:0090307];regulation of mitotic spindle organization [GO:0060236] mitotic spindle [GO:0072686];nuclear microtubule [GO:0005880] mitotic spindle [GO:0072686];nuclear microtubule [GO:0005880];microtubule binding [GO:0008017];protein kinase activator activity [GO:0030295];mitotic spindle assembly [GO:0090307];regulation of mitotic spindle organization [GO:0060236] microtubule binding [GO:0008017];protein kinase activator activity [GO:0030295] LDASYSWK 1.0025 0 12.4216 0 0 0 0 0 12.4216 A0A2C9UFC7 Uncharacterized protein MANES_15G129000 A0A2C9UFC7_MANES Manihot esculenta (Cassava) (Jatropha manihot) phytanoyl-CoA dioxygenase activity [GO:0048244] phytanoyl-CoA dioxygenase activity [GO:0048244] ELSINKVGHALHEHDPVFK 1.0019 0 12.4243 0 0 0 0 0 12.4243 A0A2C9UXA5 Transglut_core2 domain-containing protein MANES_11G006000 A0A2C9UXA5_MANES Manihot esculenta (Cassava) (Jatropha manihot) FRNMEEDAVEKLMTR 0.98011 0 12.4312 0 0 0 0 0 12.4312 A0A2C9VTN6 DNA replication ATP-dependent helicase/nuclease (EC 3.1.-.-) (EC 3.6.4.12) MANES_05G060200 A0A2C9VTN6_MANES Manihot esculenta (Cassava) (Jatropha manihot) "DNA repair [GO:0006281];DNA replication, Okazaki fragment processing [GO:0033567];replication fork reversal [GO:0071932]" chromosome [GO:0005694];cytoplasm [GO:0005737];nucleus [GO:0005634] "chromosome [GO:0005694];cytoplasm [GO:0005737];nucleus [GO:0005634];4 iron, 4 sulfur cluster binding [GO:0051539];5'-flap endonuclease activity [GO:0017108];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];DNA binding [GO:0003677];metal ion binding [GO:0046872];RNA binding [GO:0003723];single-stranded DNA helicase activity [GO:0017116];DNA repair [GO:0006281];DNA replication, Okazaki fragment processing [GO:0033567];replication fork reversal [GO:0071932]" "4 iron, 4 sulfur cluster binding [GO:0051539];5'-flap endonuclease activity [GO:0017108];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];DNA binding [GO:0003677];metal ion binding [GO:0046872];RNA binding [GO:0003723];single-stranded DNA helicase activity [GO:0017116]" YSTPATKK 0.97135 0 12.435 0 0 0 0 0 12.435 A0A2C9UHB9 Uncharacterized protein MANES_15G189900 A0A2C9UHB9_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleic acid binding [GO:0003676];zinc ion binding [GO:0008270] nucleic acid binding [GO:0003676];zinc ion binding [GO:0008270] DCMGPLMICHNCGGR 0.97871 0 12.4489 0 0 0 12.4489 0 0 A0A2C9VHF8 F-box domain-containing protein MANES_07G010800 A0A2C9VHF8_MANES Manihot esculenta (Cassava) (Jatropha manihot) histone H3-K4 methylation [GO:0051568] Set1C/COMPASS complex [GO:0048188] Set1C/COMPASS complex [GO:0048188];histone binding [GO:0042393];histone H3-K4 methylation [GO:0051568] histone binding [GO:0042393] VFDMYSRK 0.96765 0 12.4493 0 0 0 0 12.4493 0 A0A2C9UNE1 S-(hydroxymethyl)glutathione dehydrogenase (EC 1.1.1.284) MANES_13G038500 A0A2C9UNE1_MANES Manihot esculenta (Cassava) (Jatropha manihot) ethanol oxidation [GO:0006069];formaldehyde catabolic process [GO:0046294] cytosol [GO:0005829] "cytosol [GO:0005829];alcohol dehydrogenase activity, zinc-dependent [GO:0004024];S-(hydroxymethyl)glutathione dehydrogenase activity [GO:0051903];S-(hydroxymethyl)glutathione dehydrogenase NAD activity [GO:0106322];S-(hydroxymethyl)glutathione dehydrogenase NADP activity [GO:0106321];zinc ion binding [GO:0008270];ethanol oxidation [GO:0006069];formaldehyde catabolic process [GO:0046294]" "alcohol dehydrogenase activity, zinc-dependent [GO:0004024];S-(hydroxymethyl)glutathione dehydrogenase activity [GO:0051903];S-(hydroxymethyl)glutathione dehydrogenase NAD activity [GO:0106322];S-(hydroxymethyl)glutathione dehydrogenase NADP activity [GO:0106321];zinc ion binding [GO:0008270]" VRAATGVGIMMNDRK 0.9777 0 12.4555 0 0 0 0 0 12.4555 A0A251LKJ2 NAB domain-containing protein MANES_02G210800 A0A251LKJ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin binding [GO:0003779] actin binding [GO:0003779] RVPVLAA 0.95005 0 12.4605 0 0 0 0 0 12.4605 A0A2C9WN68 HSF_DOMAIN domain-containing protein MANES_01G177700 A0A2C9WN68_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];methyltransferase activity [GO:0008168];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];regulation of transcription by RNA polymerase II [GO:0006357] DNA-binding transcription factor activity [GO:0003700];methyltransferase activity [GO:0008168];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978] HNNFSSFVRQLNTYGFK 0.7027 0 12.4631 0 0 0 0 0 12.4631 A0A2C9V8B2 PX domain-containing protein MANES_09G053000 A0A2C9V8B2_MANES Manihot esculenta (Cassava) (Jatropha manihot) endosome [GO:0005768];membrane [GO:0016020] endosome [GO:0005768];membrane [GO:0016020];phosphatidylinositol binding [GO:0035091] phosphatidylinositol binding [GO:0035091] HRELGQSLSDFGK 0.97039 0 12.4637 0 0 0 0 0 12.4637 A0A2C9VKZ9 Protein kinase domain-containing protein MANES_07G129800 A0A2C9VKZ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein homodimerization activity [GO:0042803];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein homodimerization activity [GO:0042803];protein serine/threonine kinase activity [GO:0004674] LVGYCEDGDEKLLVYEYMKNGALYDHLHDK 1 11.3469 12.466 0 11.3469 0 0 0 12.466 A0A2C9URH0 Uncharacterized protein MANES_13G126200 A0A2C9URH0_MANES Manihot esculenta (Cassava) (Jatropha manihot) autophagosome assembly [GO:0000045] autophagosome membrane [GO:0000421] autophagosome membrane [GO:0000421];autophagosome assembly [GO:0000045] CCERILR 0.96176 0 12.4699 0 0 0 12.4699 0 0 A0A2C9UT82 Uncharacterized protein MANES_12G029400 A0A2C9UT82_MANES Manihot esculenta (Cassava) (Jatropha manihot) dGTP catabolic process [GO:0006203] nucleus [GO:0005634] nucleus [GO:0005634];ATP binding [GO:0005524];dGTPase activity [GO:0008832];dGTP catabolic process [GO:0006203] ATP binding [GO:0005524];dGTPase activity [GO:0008832] DYESGDK 0.95531 0 12.4703 0 0 0 0 0 12.4703 A0A2C9VB70 Uncharacterized protein MANES_09G115000 A0A2C9VB70_MANES Manihot esculenta (Cassava) (Jatropha manihot) GSSPGGY 0.95542 0 12.4826 0 0 0 12.4826 0 0 A0A2C9UYV3 Nodulin-like domain-containing protein MANES_11G061600 A0A2C9UYV3_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020] LQPVYQMLYAGGSFR 0.97812 14.9466 12.4923 14.9466 0 0 12.4923 0 0 A0A2C9WM46 Uncharacterized protein MANES_01G186500 A0A2C9WM46_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA replication initiation [GO:0006270];pollen development [GO:0009555] nuclear origin of replication recognition complex [GO:0005664] nuclear origin of replication recognition complex [GO:0005664];DNA binding [GO:0003677];DNA replication initiation [GO:0006270];pollen development [GO:0009555] DNA binding [GO:0003677] DPREVKGNR 0.96071 13.2624 12.5035 13.2624 12.4603 0 0 0 12.5035 A0A2C9WP06 Uncharacterized protein MANES_01G165000 A0A2C9WP06_MANES Manihot esculenta (Cassava) (Jatropha manihot) oligopeptide transport [GO:0006857] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];transmembrane transporter activity [GO:0022857];oligopeptide transport [GO:0006857] transmembrane transporter activity [GO:0022857] KVEHTTYFSFFDK 0.9991 12.5164 12.5196 0 0 12.5164 0 0 12.5196 A0A2C9UQM9 Uncharacterized protein MANES_13G096700 A0A2C9UQM9_MANES Manihot esculenta (Cassava) (Jatropha manihot) KGFWSKLLDLK 0.95341 0 12.5286 0 0 0 0 12.5286 0 A0A2C9UDE2 FBA_1 domain-containing protein MANES_15G025900 A0A2C9UDE2_MANES Manihot esculenta (Cassava) (Jatropha manihot) QVFIFSMKTSLWR 0.95981 0 12.5343 0 0 0 12.5343 0 0 A0A2C9UUP4 Uncharacterized protein MANES_12G093000 A0A2C9UUP4_MANES Manihot esculenta (Cassava) (Jatropha manihot) STFSFPLNFFVSFHDLTK 0.99564 0 12.5585 0 0 0 12.5585 0 0 A0A2C9ULM6 3-ketoacyl-CoA synthase (EC 2.3.1.-) MANES_14G102100 A0A2C9ULM6_MANES Manihot esculenta (Cassava) (Jatropha manihot) fatty acid biosynthetic process [GO:0006633] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];very-long-chain 3-ketoacyl-CoA synthase activity [GO:0102756];fatty acid biosynthetic process [GO:0006633] very-long-chain 3-ketoacyl-CoA synthase activity [GO:0102756] DNPKSVEFQMRILER 0.97651 12.1756 12.5706 12.1756 0 0 12.5706 0 0 A0A2C9V2Q2 Electron transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) (EC 1.5.5.1) MANES_11G123500 A0A2C9V2Q2_MANES Manihot esculenta (Cassava) (Jatropha manihot) electron transport chain [GO:0022900];leucine catabolic process [GO:0006552];response to absence of light [GO:0009646] integral component of mitochondrial inner membrane [GO:0031305] "integral component of mitochondrial inner membrane [GO:0031305];4 iron, 4 sulfur cluster binding [GO:0051539];electron-transferring-flavoprotein dehydrogenase activity [GO:0004174];metal ion binding [GO:0046872];electron transport chain [GO:0022900];leucine catabolic process [GO:0006552];response to absence of light [GO:0009646]" "4 iron, 4 sulfur cluster binding [GO:0051539];electron-transferring-flavoprotein dehydrogenase activity [GO:0004174];metal ion binding [GO:0046872]" NSWIWEELYKAR 0.94925 0 12.5715 0 0 0 12.5715 0 0 A0A2C9VLP3 Glycosyltransferase (EC 2.4.1.-) MANES_07G070800 A0A2C9VLP3_MANES Manihot esculenta (Cassava) (Jatropha manihot) anthocyanin-containing compound biosynthetic process [GO:0009718] anthocyanidin 3-O-glucosyltransferase activity [GO:0047213];quercetin 3-O-glucosyltransferase activity [GO:0080043];quercetin 7-O-glucosyltransferase activity [GO:0080044];anthocyanin-containing compound biosynthetic process [GO:0009718] anthocyanidin 3-O-glucosyltransferase activity [GO:0047213];quercetin 3-O-glucosyltransferase activity [GO:0080043];quercetin 7-O-glucosyltransferase activity [GO:0080044] PVGPLFK 0.95603 0 12.5745 0 0 0 0 12.5745 0 A0A2C9WBW3 Uncharacterized protein MANES_03G207700 A0A2C9WBW3_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] cytosolic small ribosomal subunit [GO:0022627] cytosolic small ribosomal subunit [GO:0022627];small ribosomal subunit rRNA binding [GO:0070181];structural constituent of ribosome [GO:0003735];translation [GO:0006412] small ribosomal subunit rRNA binding [GO:0070181];structural constituent of ribosome [GO:0003735] ETLMPTAATYPNPKQVHGNWFSR 1.0056 0 12.587 0 0 0 0 0 12.587 A0A2C9U6C4 Protein kinase domain-containing protein MANES_17G057900 A0A2C9U6C4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] LIFTSHVQQDYEVHIGHLKRFSFR 1.0124 11.4503 12.5896 11.4503 0 0 0 12.5896 0 A0A2C9U8V2 Uncharacterized protein MANES_16G042900 A0A2C9U8V2_MANES Manihot esculenta (Cassava) (Jatropha manihot) ECCYSFKQSSPYPSSFILNLQINDRLQYQK 1 0 12.6015 0 0 0 0 12.6015 9.72209 A0A2C9VDX5 Uncharacterized protein MANES_08G058500 A0A2C9VDX5_MANES Manihot esculenta (Cassava) (Jatropha manihot) GCFAMNVEMGEDHIGSGGARGGSKENVEDNNK 0.94792 0 12.6017 0 0 0 0 12.6017 0 A0A2C9VHV4 Castor_Poll_mid domain-containing protein MANES_07G023400 A0A2C9VHV4_MANES Manihot esculenta (Cassava) (Jatropha manihot) ion transport [GO:0006811] integral component of membrane [GO:0016021];nuclear membrane [GO:0031965] integral component of membrane [GO:0016021];nuclear membrane [GO:0031965];ion transport [GO:0006811] PSVFSHSSWIR 0.99435 0 12.6027 0 0 0 12.6027 0 0 A0A2C9UH07 Non-specific serine/threonine protein kinase (EC 2.7.11.1) MANES_15G145800 A0A2C9UH07_MANES Manihot esculenta (Cassava) (Jatropha manihot) "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]" nucleus [GO:0005634] "nucleus [GO:0005634];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]" ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] GEATRIAENATLSQSEKNK 1 12.2494 12.6052 0 12.2494 0 0 11.8101 12.6052 A0A2C9WFH0 Uncharacterized protein MANES_02G119900 A0A2C9WFH0_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA repair [GO:0006281];response to UV [GO:0009411] Cul4-RING E3 ubiquitin ligase complex [GO:0080008];nucleus [GO:0005634] Cul4-RING E3 ubiquitin ligase complex [GO:0080008];nucleus [GO:0005634];damaged DNA binding [GO:0003684];DNA repair [GO:0006281];response to UV [GO:0009411] damaged DNA binding [GO:0003684] LRVWDCIFGNLDSPSREIVHSHDFNR 1.0258 0 12.6163 0 0 0 0 12.6163 0 A0A2C9WCA0 Uncharacterized protein MANES_02G092800 A0A2C9WCA0_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of DNA methylation [GO:0044030] nucleus [GO:0005634] "nucleus [GO:0005634];ATP binding [GO:0005524];ATP-dependent activity, acting on DNA [GO:0008094];DNA binding [GO:0003677];regulation of DNA methylation [GO:0044030]" "ATP binding [GO:0005524];ATP-dependent activity, acting on DNA [GO:0008094];DNA binding [GO:0003677]" RMKADVEQMLPR 0.95309 0 12.626 0 0 0 0 0 12.626 A0A2C9WGL7 Uncharacterized protein MANES_01G011000 A0A2C9WGL7_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] LADLLQREWVR 0.95115 0 12.6332 0 0 0 0 12.6332 0 A0A2C9UK43 Adenylate kinase (EC 2.7.4.3) MANES_14G053000 A0A2C9UK43_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737];mitochondrion [GO:0005739] cytoplasm [GO:0005737];mitochondrion [GO:0005739];adenylate kinase activity [GO:0004017];ATP binding [GO:0005524] adenylate kinase activity [GO:0004017];ATP binding [GO:0005524] RLEDGYYR 0.96971 0 12.6346 0 0 0 12.6346 0 0 A0A2C9V5L2 Glyco_trans_2-like domain-containing protein MANES_10G055100 A0A2C9V5L2_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];glycosyltransferase activity [GO:0016757];mannan synthase activity [GO:0051753] glycosyltransferase activity [GO:0016757];mannan synthase activity [GO:0051753] LFGRKPNK 0.96287 0 12.645 0 0 0 12.645 0 0 A0A2C9VHL1 Uncharacterized protein (Fragment) MANES_07G016500 A0A2C9VHL1_MANES Manihot esculenta (Cassava) (Jatropha manihot) KMDELRISPGYNTFHILIK 0.99814 0 12.648 0 0 0 0 0 12.648 A0A2C9W4H1 FAD synthase (EC 2.7.7.2) MANES_04G162800 A0A2C9W4H1_MANES Manihot esculenta (Cassava) (Jatropha manihot) FAD biosynthetic process [GO:0006747];riboflavin biosynthetic process [GO:0009231] chloroplast [GO:0009507] chloroplast [GO:0009507];ATP binding [GO:0005524];FMN adenylyltransferase activity [GO:0003919];FAD biosynthetic process [GO:0006747];riboflavin biosynthetic process [GO:0009231] ATP binding [GO:0005524];FMN adenylyltransferase activity [GO:0003919] GFTNSSGR 0.99916 0 12.6514 0 0 0 0 12.6514 0 A0A199UA77 Uncharacterized protein MANES_S075500 A0A199UA77_MANES Manihot esculenta (Cassava) (Jatropha manihot) YILDLQSR 0.96971 0 12.6638 0 0 0 0 0 12.6638 A0A2C9W0E3 Ge1_WD40 domain-containing protein MANES_05G206100 A0A2C9W0E3_MANES Manihot esculenta (Cassava) (Jatropha manihot) deadenylation-independent decapping of nuclear-transcribed mRNA [GO:0031087] P-body [GO:0000932] P-body [GO:0000932];deadenylation-independent decapping of nuclear-transcribed mRNA [GO:0031087] STQSDEFGLR 0.98357 0 12.664 0 0 0 0 12.664 0 A0A251L9H5 Uncharacterized protein MANES_03G119900 A0A251L9H5_MANES Manihot esculenta (Cassava) (Jatropha manihot) FCPMLENQALYRENRLILLR 1.0069 0 12.6772 0 0 0 0 12.6772 0 A0A2C9UHF3 Uncharacterized protein MANES_15G158100 A0A2C9UHF3_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitotic sister chromatid cohesion [GO:0007064];replication-born double-strand break repair via sister chromatid exchange [GO:1990414];synaptonemal complex assembly [GO:0007130] nuclear meiotic cohesin complex [GO:0034991];nuclear mitotic cohesin complex [GO:0034990];synaptonemal complex [GO:0000795] nuclear meiotic cohesin complex [GO:0034991];nuclear mitotic cohesin complex [GO:0034990];synaptonemal complex [GO:0000795];chromatin binding [GO:0003682];mitotic sister chromatid cohesion [GO:0007064];replication-born double-strand break repair via sister chromatid exchange [GO:1990414];synaptonemal complex assembly [GO:0007130] chromatin binding [GO:0003682] KCIFDDVIVFPNNCK 0.98194 0 12.6913 0 0 0 12.6913 0 0 A0A251KLU9 NAD(P)-bd_dom domain-containing protein MANES_06G054100 A0A251KLU9_MANES Manihot esculenta (Cassava) (Jatropha manihot) galactose metabolic process [GO:0006012] UDP-glucose 4-epimerase activity [GO:0003978];galactose metabolic process [GO:0006012] UDP-glucose 4-epimerase activity [GO:0003978] VTIVDNLSR 0.9762 0 12.6927 0 0 0 0 12.6927 0 A0A2C9W403 Uncharacterized protein MANES_03G027100 A0A2C9W403_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein import into mitochondrial matrix [GO:0030150] integral component of mitochondrial inner membrane [GO:0031305];TIM23 mitochondrial import inner membrane translocase complex [GO:0005744] integral component of mitochondrial inner membrane [GO:0031305];TIM23 mitochondrial import inner membrane translocase complex [GO:0005744];protein import into mitochondrial matrix [GO:0030150] MNAPRVGGSFAVWGGLFSAFDCTMVYVR 1.0576 0 12.6987 0 0 0 0 0 12.6987 A0A2C9VWW7 LIM zinc-binding domain-containing protein MANES_05G164200 A0A2C9VWW7_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872];ubiquitin binding [GO:0043130] metal ion binding [GO:0046872];ubiquitin binding [GO:0043130] AHPFWVQKYCPSHEHDGTPR 1.0141 0 12.7037 0 0 0 12.7037 0 0 A0A2C9W884 Non-specific serine/threonine protein kinase (EC 2.7.11.1) MANES_03G170300 A0A2C9W884_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular signal transduction [GO:0035556];protein phosphorylation [GO:0006468] ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];intracellular signal transduction [GO:0035556];protein phosphorylation [GO:0006468] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] EYQMPSPISK 0.95998 15.4005 12.7174 0 15.4005 0 12.7174 0 0 A0A2C9V832 Uncharacterized protein MANES_09G054400 A0A2C9V832_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] FGFVHFAERSSAMK 0.97457 0 12.7289 0 0 0 0 12.7289 0 A0A2C9VYY4 Uncharacterized protein MANES_05G159400 A0A2C9VYY4_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrolase activity [GO:0016787];metal ion binding [GO:0046872] hydrolase activity [GO:0016787];metal ion binding [GO:0046872] EEKVGTYGSTLIR 0.96695 13.9133 12.7303 0 0 13.9133 0 12.7303 0 A0A2C9W4F5 Fe2OG dioxygenase domain-containing protein MANES_04G136100 A0A2C9W4F5_MANES Manihot esculenta (Cassava) (Jatropha manihot) dioxygenase activity [GO:0051213];metal ion binding [GO:0046872] dioxygenase activity [GO:0051213];metal ion binding [GO:0046872] KGMNGAMEELLQLPLETKQR 1.009 0 12.7314 0 0 0 0 0 12.7314 A0A2C9UFC9 Uncharacterized protein MANES_15G124900 A0A2C9UFC9_MANES Manihot esculenta (Cassava) (Jatropha manihot) EVVSEAISIDEAIAWAKEK 1.0108 0 12.7341 0 0 0 0 0 12.7341 A0A2C9VIQ9 Uncharacterized protein MANES_08G146600 A0A2C9VIQ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein O-linked glycosylation [GO:0006493] protein N-acetylglucosaminyltransferase activity [GO:0016262];protein O-linked glycosylation [GO:0006493] protein N-acetylglucosaminyltransferase activity [GO:0016262] NLERAYFKMWNIHCSGQQPQHFK 1 0 12.7358 0 0 0 0 0 12.7358 A0A2C9W7L9 Uncharacterized protein MANES_03G148000 A0A2C9W7L9_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to bacterium [GO:0042742];defense response to oomycetes [GO:0002229] plasma membrane [GO:0005886] plasma membrane [GO:0005886];ATP binding [GO:0005524];transmembrane receptor protein serine/threonine kinase activity [GO:0004675];defense response to bacterium [GO:0042742];defense response to oomycetes [GO:0002229] ATP binding [GO:0005524];transmembrane receptor protein serine/threonine kinase activity [GO:0004675] ELMRLLNLGIACTRSNPESR 1.012 0 12.7509 0 0 0 0 12.7509 0 A0A2C9WI31 Uncharacterized protein MANES_01G052700 A0A2C9WI31_MANES Manihot esculenta (Cassava) (Jatropha manihot) MSLALCDLKWVGDSR 0.97815 0 12.7536 0 0 0 12.7536 0 0 A0A2C9VYT8 Uncharacterized protein MANES_04G021300 A0A2C9VYT8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] AKELNMNPK 1.0059 0 12.7538 0 0 0 12.7538 0 0 A0A2C9W9B4 Fe2OG dioxygenase domain-containing protein MANES_03G208300 A0A2C9W9B4_MANES Manihot esculenta (Cassava) (Jatropha manihot) gibberellin catabolic process [GO:0045487];response to light stimulus [GO:0009416] C-19 gibberellin 2-beta-dioxygenase activity [GO:0052634];dioxygenase activity [GO:0051213];metal ion binding [GO:0046872];gibberellin catabolic process [GO:0045487];response to light stimulus [GO:0009416] C-19 gibberellin 2-beta-dioxygenase activity [GO:0052634];dioxygenase activity [GO:0051213];metal ion binding [GO:0046872] ITALPHMVSAVRPSLYRPFTWDDYK 1.0266 0 12.7544 0 0 0 0 12.7544 0 A0A2C9V427 Uncharacterized protein MANES_10G004000 A0A2C9V427_MANES Manihot esculenta (Cassava) (Jatropha manihot) NATKCDTWCELQNPANHRFFER 0.98084 0 12.7548 0 0 0 12.7548 0 0 A0A2C9VI79 Hexosyltransferase (EC 2.4.1.-) MANES_08G141400 A0A2C9VI79_MANES Manihot esculenta (Cassava) (Jatropha manihot) ceramide biosynthetic process [GO:0046513];inositol phosphoceramide metabolic process [GO:0006673];pollen development [GO:0009555];pollen tube guidance [GO:0010183] Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];glucuronosyltransferase activity [GO:0015020];glycosyltransferase activity [GO:0016757];sphingolipid alpha-glucuronosyltransferase activity [GO:1990482];ceramide biosynthetic process [GO:0046513];inositol phosphoceramide metabolic process [GO:0006673];pollen development [GO:0009555];pollen tube guidance [GO:0010183] glucuronosyltransferase activity [GO:0015020];glycosyltransferase activity [GO:0016757];sphingolipid alpha-glucuronosyltransferase activity [GO:1990482] SIEDLFKCGKFCANLK 0.98033 0 12.7568 0 0 0 0 12.7568 0 A0A2C9UNS6 AAA domain-containing protein MANES_13G043200 A0A2C9UNS6_MANES Manihot esculenta (Cassava) (Jatropha manihot) proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161] "cytoplasm [GO:0005737];nucleus [GO:0005634];proteasome regulatory particle, base subcomplex [GO:0008540]" "cytoplasm [GO:0005737];nucleus [GO:0005634];proteasome regulatory particle, base subcomplex [GO:0008540];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];proteasome-activating activity [GO:0036402];proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]" ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];proteasome-activating activity [GO:0036402] KPDGGDK 1 0 12.7624 0 0 0 0 0 12.7624 A0A2C9W838 Uncharacterized protein MANES_03G094900 A0A2C9W838_MANES Manihot esculenta (Cassava) (Jatropha manihot) N-acetyltransferase activity [GO:0008080] N-acetyltransferase activity [GO:0008080] MIGDEFLGEDSNLDGFSWNR 1.0135 13.3491 12.7672 13.3491 0 0 0 12.7672 0 A0A2C9WFP1 Thioredoxin domain-containing protein MANES_02G153700 A0A2C9WFP1_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] cytoplasm [GO:0005737] SYDAARSSTSSSSLGQITLSQTNEAK 1.0371 0 12.7743 0 0 0 12.7743 0 0 A0A2C9W2Z7 Uncharacterized protein MANES_04G160000 A0A2C9W2Z7_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];zinc ion binding [GO:0008270] ATP binding [GO:0005524];zinc ion binding [GO:0008270] QDDWDPDWQSTSSSKVSYLVQR 0.98079 0 12.7752 0 0 0 12.7752 0 0 A0A251JAR1 DDT domain-containing protein MANES_14G073100 A0A251JAR1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" RSF complex [GO:0031213] "RSF complex [GO:0031213];regulation of transcription, DNA-templated [GO:0006355]" AAERLQAAQQQAAIER 1.0015 0 12.7757 0 0 0 0 12.7757 0 A0A2C9V399 NB-ARC domain-containing protein MANES_11G156500 A0A2C9V399_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] IPHHQIQK 0.9696 13.861 12.7885 0 0 13.861 0 12.7885 0 A0A2C9VDA6 Kinesin-like protein MANES_08G042300 A0A2C9VDA6_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] microtubule [GO:0005874] microtubule [GO:0005874];ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777] FPHCPGPR 1.0017 0 12.7893 0 0 0 12.7893 0 10.3842 A0SVL8 1-amino-cyclopropane-1-carboxylic acid oxidase A0SVL8_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] EPRFEAMKAVENNVNLGPNCYCLIINYY 1.0627 0 12.7913 0 0 0 12.7913 0 0 A0A2C9VJF7 Tify domain-containing protein MANES_07G023500 A0A2C9VJF7_MANES Manihot esculenta (Cassava) (Jatropha manihot) FALSCYFHWL 0.9612 0 12.7921 0 0 0 12.7921 0 0 A0A2C9VGV1 Uncharacterized protein MANES_08G084400 A0A2C9VGV1_MANES Manihot esculenta (Cassava) (Jatropha manihot) ACGQNIKDYMVEHLGIEK 0.99726 0 12.7931 0 0 0 0 12.7931 0 A0A2C9W7L1 Protein kinase domain-containing protein MANES_03G076600 A0A2C9W7L1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] SLLHPSTVELWCVYFIFFSLLHTSSAQNATTDPAEVR 0.74603 10.387 12.7935 0 0 10.387 0 12.7935 0 A0A251JRS1 Elf4 domain-containing protein MANES_11G021100 A0A251JRS1_MANES Manihot esculenta (Cassava) (Jatropha manihot) entrainment of circadian clock [GO:0009649];positive regulation of circadian rhythm [GO:0042753];rhythmic process [GO:0048511] nucleus [GO:0005634] nucleus [GO:0005634];entrainment of circadian clock [GO:0009649];positive regulation of circadian rhythm [GO:0042753];rhythmic process [GO:0048511] RVVDLYADLSSNFTR 0.98062 13.3697 12.7936 13.3697 0 0 12.7936 0 0 A0A2C9WGT5 Uncharacterized protein MANES_01G011400 A0A2C9WGT5_MANES Manihot esculenta (Cassava) (Jatropha manihot) MMVGDSMVCPKPR 0.96873 0 12.804 0 0 0 12.804 0 0 A0A2C9UYP4 Uncharacterized protein MANES_11G017500 A0A2C9UYP4_MANES Manihot esculenta (Cassava) (Jatropha manihot) MKIAFYQSLQRGT 0.9608 16.9173 12.8149 16.9173 0 16.3131 12.8149 0 0 A0A2C9UN31 Uncharacterized protein MANES_14G158800 A0A2C9UN31_MANES Manihot esculenta (Cassava) (Jatropha manihot) "DNA ligation involved in DNA repair [GO:0051103];DNA recombination [GO:0006310];double-strand break repair via nonhomologous end joining [GO:0006303];nucleotide-excision repair, DNA gap filling [GO:0006297]" DNA ligase IV complex [GO:0032807] "DNA ligase IV complex [GO:0032807];ATP binding [GO:0005524];DNA binding [GO:0003677];DNA ligase (ATP) activity [GO:0003910];DNA ligation involved in DNA repair [GO:0051103];DNA recombination [GO:0006310];double-strand break repair via nonhomologous end joining [GO:0006303];nucleotide-excision repair, DNA gap filling [GO:0006297]" ATP binding [GO:0005524];DNA binding [GO:0003677];DNA ligase (ATP) activity [GO:0003910] ATEGEASKR 0.96411 0 12.8167 0 0 0 0 0 12.8167 A0A2C9U6H1 Uncharacterized protein MANES_17G098700 A0A2C9U6H1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "dimethylallyl diphosphate biosynthetic process [GO:0050992];isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway [GO:0019288]" "4 iron, 4 sulfur cluster binding [GO:0051539];4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase activity [GO:0051745];metal ion binding [GO:0046872];dimethylallyl diphosphate biosynthetic process [GO:0050992];isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway [GO:0019288]" "4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase activity [GO:0051745];4 iron, 4 sulfur cluster binding [GO:0051539];metal ion binding [GO:0046872]" SKNYNRR 0.96238 0 12.8172 0 0 0 0 0 12.8172 A0A2C9V038 Uncharacterized protein MANES_11G099500 A0A2C9V038_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein folding [GO:0006457];response to heat [GO:0009408] cytosol [GO:0005829] cytosol [GO:0005829];ATP binding [GO:0005524];Hsp70 protein binding [GO:0030544];metal ion binding [GO:0046872];unfolded protein binding [GO:0051082];protein folding [GO:0006457];response to heat [GO:0009408] ATP binding [GO:0005524];Hsp70 protein binding [GO:0030544];metal ion binding [GO:0046872];unfolded protein binding [GO:0051082] EGMGGGGGGHNPFDIFESFFGGNPFGGGSSR 0.75 0 12.82 0 0 0 0 0 12.82 A0A2C9WBI8 Uncharacterized protein MANES_02G068300 A0A2C9WBI8_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of gene expression [GO:0010468] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];mRNA binding [GO:0003729];regulation of gene expression [GO:0010468] mRNA binding [GO:0003729] MMMQGDNSTMGKGVHRR 1 11.3999 12.8235 0 11.3999 0 0 12.8235 0 A0A2C9VUT0 Protein kinase domain-containing protein MANES_05G015400 A0A2C9VUT0_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell surface receptor signaling pathway [GO:0007166] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];polysaccharide binding [GO:0030247];protein kinase activity [GO:0004672];cell surface receptor signaling pathway [GO:0007166] ATP binding [GO:0005524];polysaccharide binding [GO:0030247];protein kinase activity [GO:0004672] CLLFGGDGKIGMMEVAR 0.96058 0 12.8273 0 0 0 0 0 12.8273 A0A097PP48 Uncoupling protein 3 (Fragment) A0A097PP48_MANES Manihot esculenta (Cassava) (Jatropha manihot) transmembrane transport [GO:0055085] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];transmembrane transport [GO:0055085] HLFYTPLRIVGYENLR 0.98828 0 12.8342 0 0 0 0 0 12.8342 A0A199UDA1 UBC core domain-containing protein MANES_S000800 A0A199UDA1_MANES Manihot esculenta (Cassava) (Jatropha manihot) ubiquitin conjugating enzyme activity [GO:0061631] ubiquitin conjugating enzyme activity [GO:0061631] KYSEDVFILSLKTMMYTLR 0.9963 0 12.8353 0 0 0 0 0 12.8353 A0A2C9WK82 Uncharacterized protein MANES_01G130000 A0A2C9WK82_MANES Manihot esculenta (Cassava) (Jatropha manihot) potassium ion transmembrane transport [GO:0071805];stabilization of membrane potential [GO:0030322] integral component of plasma membrane [GO:0005887];plant-type vacuole membrane [GO:0009705] integral component of plasma membrane [GO:0005887];plant-type vacuole membrane [GO:0009705];potassium ion leak channel activity [GO:0022841];potassium ion transmembrane transport [GO:0071805];stabilization of membrane potential [GO:0030322] potassium ion leak channel activity [GO:0022841] MLFQMDDEPLLPNTLPEHHHHHHHHSNK 1.0686 0 12.8393 0 0 0 0 12.8393 0 A0A2C9W7R8 Uncharacterized protein MANES_03G156000 A0A2C9W7R8_MANES Manihot esculenta (Cassava) (Jatropha manihot) autophagy [GO:0006914] intracellular membrane-bounded organelle [GO:0043231] intracellular membrane-bounded organelle [GO:0043231];autophagy [GO:0006914] QQTNGDVSSSR 1.0176 0 12.8409 0 0 0 12.8409 0 0 A0A2C9UQC2 AB hydrolase-1 domain-containing protein MANES_13G094500 A0A2C9UQC2_MANES Manihot esculenta (Cassava) (Jatropha manihot) catalytic activity [GO:0003824] catalytic activity [GO:0003824] SKFNLYVPDLLFFGDSYTTR 1.0152 13.0141 12.8452 0 13.0141 0 0 12.8452 0 A0A2C9WMI3 Protein kinase domain-containing protein MANES_01G188200 A0A2C9WMI3_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] MSEVLTTLEQIDSPK 0.97629 0 12.8544 0 0 0 12.8544 0 0 A0A2C9UE14 CBS domain-containing protein MANES_15G085600 A0A2C9UE14_MANES Manihot esculenta (Cassava) (Jatropha manihot) TMHRSGK 0.96397 0 12.8673 0 0 0 0 0 12.8673 A0A251KIJ3 Uncharacterized protein MANES_07G077000 A0A251KIJ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) QGVAANEK 0.96729 0 12.8673 0 0 0 0 0 12.8673 A0A2C9VDV9 Uncharacterized protein MANES_09G188900 A0A2C9VDV9_MANES Manihot esculenta (Cassava) (Jatropha manihot) LISAYASCAQMR 0.94847 0 12.8685 0 0 0 0 0 12.8685 A0A2C9W2F6 Acetate--CoA ligase (EC 6.2.1.1) MANES_04G095800 A0A2C9W2F6_MANES Manihot esculenta (Cassava) (Jatropha manihot) acetyl-CoA biosynthetic process from acetate [GO:0019427] acetate-CoA ligase activity [GO:0003987];AMP binding [GO:0016208];ATP binding [GO:0005524];acetyl-CoA biosynthetic process from acetate [GO:0019427] acetate-CoA ligase activity [GO:0003987];AMP binding [GO:0016208];ATP binding [GO:0005524] YLEMYKRSVEDPAGFWSDIASQFYWK 1.0324 0 12.8692 0 0 0 12.8692 0 0 A0A0M4G3M4 NAC transcription factors 6 A0A0M4G3M4_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] TNWVMHQYHLGQNEEEKEGELVVSK 1.0206 0 12.8832 0 0 0 0 12.8832 0 A0A2C9U489 Uncharacterized protein MANES_18G143400 A0A2C9U489_MANES Manihot esculenta (Cassava) (Jatropha manihot) TCDVQNNEVAK 0.95656 0 12.8845 0 0 0 12.8845 0 0 A0A2C9VYI6 Uncharacterized protein MANES_04G013400 A0A2C9VYI6_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein polymerization [GO:0051258];regulation of cell division [GO:0051302];regulation of root morphogenesis [GO:2000067];specification of plant organ axis polarity [GO:0090708] extrinsic component of cytoplasmic side of plasma membrane [GO:0031234] extrinsic component of cytoplasmic side of plasma membrane [GO:0031234];protein polymerization [GO:0051258];regulation of cell division [GO:0051302];regulation of root morphogenesis [GO:2000067];specification of plant organ axis polarity [GO:0090708] AKVWTER 0.9777 0 12.8872 0 0 0 0 12.8872 0 A0A199UCZ1 "NADPH:adrenodoxin oxidoreductase, mitochondrial (EC 1.18.1.6)" MANES_S011200 A0A199UCZ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrion [GO:0005739] mitochondrion [GO:0005739];NADPH-adrenodoxin reductase activity [GO:0015039];oxidoreductase activity [GO:0016491] NADPH-adrenodoxin reductase activity [GO:0015039];oxidoreductase activity [GO:0016491] VAVGTGQFEDLDCGMVLK 0.99478 0 12.8986 0 0 0 0 12.8986 0 A0A2C9UBX0 Uncharacterized protein MANES_16G115400 A0A2C9UBX0_MANES Manihot esculenta (Cassava) (Jatropha manihot) chlorophyll catabolic process [GO:0015996];PSII associated light-harvesting complex II catabolic process [GO:0010304] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];chlorophyll(ide) b reductase activity [GO:0034256];chlorophyll catabolic process [GO:0015996];PSII associated light-harvesting complex II catabolic process [GO:0010304] chlorophyll(ide) b reductase activity [GO:0034256] QHKSEKSCGTVMENENNLNK 1.012 0 12.9059 0 0 0 0 12.9059 0 A0A2C9WFT3 Uncharacterized protein MANES_02G120100 A0A2C9WFT3_MANES Manihot esculenta (Cassava) (Jatropha manihot) phospholipid catabolic process [GO:0009395] "hydrolase activity, acting on ester bonds [GO:0016788];phospholipid catabolic process [GO:0009395]" "hydrolase activity, acting on ester bonds [GO:0016788]" TAMSGFK 0.9806 0 12.9085 0 0 0 12.9085 0 0 A0A2C9WFA5 Fe2OG dioxygenase domain-containing protein MANES_02G104700 A0A2C9WFA5_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] FDMSGGK 0.97981 0 12.927 0 0 0 12.927 0 9.64198 A0A2C9W7Y7 Beta-amylase (EC 3.2.1.2) MANES_03G155800 A0A2C9W7Y7_MANES Manihot esculenta (Cassava) (Jatropha manihot) polysaccharide catabolic process [GO:0000272] amylopectin maltohydrolase activity [GO:0102229];beta-amylase activity [GO:0016161];polysaccharide catabolic process [GO:0000272] amylopectin maltohydrolase activity [GO:0102229];beta-amylase activity [GO:0016161] CREEVER 0.95957 0 12.9406 0 0 0 0 0 12.9406 A0A199U933 Uncharacterized protein MANES_S110200 A0A199U933_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650];carbohydrate metabolic process [GO:0005975] polygalacturonase activity [GO:0004650] TPLAINLR 0.96675 0 12.945 0 0 0 12.945 0 0 A0A2C9V5W0 Uncharacterized protein MANES_10G063500 A0A2C9V5W0_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];ATP binding [GO:0005524];calcium ion binding [GO:0005509];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683];intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] ATP binding [GO:0005524];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calcium ion binding [GO:0005509];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683] PENCLFLNER 0.98054 0 12.9488 0 0 0 0 0 12.9488 A0A2C9UZE0 Uncharacterized protein MANES_11G087600 A0A2C9UZE0_MANES Manihot esculenta (Cassava) (Jatropha manihot) YSPDGEYNR 1.0179 0 12.9516 0 0 0 0 12.9516 0 A0A2C9UN53 Uncharacterized protein MANES_13G017000 A0A2C9UN53_MANES Manihot esculenta (Cassava) (Jatropha manihot) PLIKLCR 0.96293 16.115 12.9588 0 16.115 0 0 0 12.9588 A0A2C9UEZ0 TPT domain-containing protein MANES_15G112500 A0A2C9UEZ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];antiporter activity [GO:0015297];nucleotide-sugar transmembrane transporter activity [GO:0005338];UDP-galactose transmembrane transporter activity [GO:0005459] antiporter activity [GO:0015297];nucleotide-sugar transmembrane transporter activity [GO:0005338];UDP-galactose transmembrane transporter activity [GO:0005459] EETPLIK 0.9842 0 12.9646 0 0 0 0 12.9646 0 V9NC38 Purple acid phosphatase (EC 3.1.3.2) PAP15-1 V9NC38_MANES Manihot esculenta (Cassava) (Jatropha manihot) acid phosphatase activity [GO:0003993];metal ion binding [GO:0046872] acid phosphatase activity [GO:0003993];metal ion binding [GO:0046872] PVTVPLDK 0.9664 0 12.968 0 0 0 12.968 0 0 A0A2C9UIJ4 Uncharacterized protein MANES_14G030900 A0A2C9UIJ4_MANES Manihot esculenta (Cassava) (Jatropha manihot) SKLLALQEQEYDHQHQQR 0.99393 0 12.9732 0 0 0 12.9732 0 0 A0A2C9TZI6 Uncharacterized protein MANES_18G006200 A0A2C9TZI6_MANES Manihot esculenta (Cassava) (Jatropha manihot) QGLHELK 0.96856 15.2723 12.9824 0 15.2723 0 0 0 12.9824 A0A2C9WH49 UvrD-like helicase ATP-binding domain-containing protein MANES_02G203200 A0A2C9WH49_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];helicase activity [GO:0004386];RNA binding [GO:0003723] ATP binding [GO:0005524];helicase activity [GO:0004386];RNA binding [GO:0003723] VGQKYDSFGR 0.98327 0 12.9843 0 0 0 12.9843 0 0 A0A2C9U6Y6 Uncharacterized protein MANES_17G112400 A0A2C9U6Y6_MANES Manihot esculenta (Cassava) (Jatropha manihot) EVISTGKETIENLR 0.93617 0 12.9861 0 0 0 12.9861 0 0 A0A2C9WBZ1 BHLH domain-containing protein MANES_02G068800 A0A2C9WBZ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];protein dimerization activity [GO:0046983];regulation of transcription, DNA-templated [GO:0006355]" protein dimerization activity [GO:0046983] EVDEAEEVVHVRAKR 0.97656 0 12.9875 0 0 0 0 12.9875 0 A0A2C9UFW5 Uncharacterized protein MANES_15G136100 A0A2C9UFW5_MANES Manihot esculenta (Cassava) (Jatropha manihot) trehalose biosynthetic process [GO:0005992] catalytic activity [GO:0003824];trehalose biosynthetic process [GO:0005992] catalytic activity [GO:0003824] VVALDPNFRKLSMEHIVSAYK 0.97683 0 12.9908 0 0 0 0 12.9908 0 A0A251L1V5 Uncharacterized protein MANES_04G066600 A0A251L1V5_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA cis splicing, via spliceosome [GO:0045292]" catalytic step 2 spliceosome [GO:0071013];U2 snRNP [GO:0005686];U2-type prespliceosome [GO:0071004] "catalytic step 2 spliceosome [GO:0071013];U2 snRNP [GO:0005686];U2-type prespliceosome [GO:0071004];RNA binding [GO:0003723];mRNA cis splicing, via spliceosome [GO:0045292]" RNA binding [GO:0003723] ANEEPEEPMR 0.97089 0 13.0034 0 0 0 0 13.0034 0 A0A2C9V6C0 Uncharacterized protein MANES_10G094700 A0A2C9V6C0_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] "cytoplasm [GO:0005737];intramolecular transferase activity, phosphotransferases [GO:0016868]" "intramolecular transferase activity, phosphotransferases [GO:0016868]" SYFSPEYFDAQLTQLGWQQVDDLR 1.011 0 13.0053 0 0 0 0 0 13.0053 A0A2C9V7X7 Uncharacterized protein MANES_10G131600 A0A2C9V7X7_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to virus [GO:0051607];gene silencing by RNA [GO:0031047] defense response to virus [GO:0051607];gene silencing by RNA [GO:0031047] GGPGAIDWYR 0.98492 0 13.0068 0 0 0 13.0068 9.84997 0 A0A2C9W3J8 PPPDE domain-containing protein MANES_03G010900 A0A2C9W3J8_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein deubiquitination [GO:0016579];protein modification by small protein removal [GO:0070646] deubiquitinase activity [GO:0101005];protein deubiquitination [GO:0016579];protein modification by small protein removal [GO:0070646] deubiquitinase activity [GO:0101005] CPGFTFR 0.98154 0 13.0069 0 0 0 13.0069 0 0 A0A2C9U8I7 Phospholipase A1 (EC 3.1.1.-) MANES_16G036900 A0A2C9U8I7_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid catabolic process [GO:0016042] phospholipase A1 activity [GO:0008970];lipid catabolic process [GO:0016042] phospholipase A1 activity [GO:0008970] PTGQPDK 0.95644 0 13.0098 0 0 0 13.0098 0 0 A0A2C9WPN3 Pectinesterase (EC 3.1.1.11) MANES_01G229500 A0A2C9WPN3_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];carboxylic ester hydrolase activity [GO:0052689];pectinesterase activity [GO:0030599];cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];carboxylic ester hydrolase activity [GO:0052689];pectinesterase activity [GO:0030599] KQQPQDSNGFVFK 0.9806 0 13.0112 0 0 0 0 0 13.0112 A0A251J0D9 PPIase cyclophilin-type domain-containing protein MANES_16G119700 A0A251J0D9_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein folding [GO:0006457];protein peptidyl-prolyl isomerization [GO:0000413] cytoplasm [GO:0005737] cytoplasm [GO:0005737];cyclosporin A binding [GO:0016018];peptidyl-prolyl cis-trans isomerase activity [GO:0003755];protein folding [GO:0006457];protein peptidyl-prolyl isomerization [GO:0000413] cyclosporin A binding [GO:0016018];peptidyl-prolyl cis-trans isomerase activity [GO:0003755] SLSRSVSPDGSPK 0.9569 12.6154 13.0152 0 0 12.6154 0 13.0152 0 A0A2C9VL95 Ribosome biogenesis protein NOP53 MANES_07G139400 A0A2C9VL95_MANES Manihot esculenta (Cassava) (Jatropha manihot) ribosomal large subunit assembly [GO:0000027];rRNA processing [GO:0006364] nucleolus [GO:0005730];nucleoplasm [GO:0005654] nucleolus [GO:0005730];nucleoplasm [GO:0005654];5S rRNA binding [GO:0008097];ribosomal large subunit assembly [GO:0000027];rRNA processing [GO:0006364] 5S rRNA binding [GO:0008097] EELSKEIDSLPDIIKEIAK 1.0009 0 13.0183 0 0 0 0 13.0183 0 A0A2C9URG0 Uncharacterized protein MANES_13G131000 A0A2C9URG0_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677] DNA binding [GO:0003677] ENGRQGR 0.97765 0 13.0185 0 0 0 13.0185 0 0 A0A2C9UM47 FAD_binding_3 domain-containing protein MANES_14G118900 A0A2C9UM47_MANES Manihot esculenta (Cassava) (Jatropha manihot) FAD binding [GO:0071949];monooxygenase activity [GO:0004497] FAD binding [GO:0071949];monooxygenase activity [GO:0004497] NIACYAPPNRELK 0.95883 0 13.0187 0 0 0 13.0187 0 0 A0A2C9UHM3 Uncharacterized protein MANES_14G007000 A0A2C9UHM3_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] SICKMCWAGCETYWFSLQYVTCFLWHK 1.0456 0 13.0252 0 0 0 0 13.0252 0 A0A2C9UAT9 Non-specific serine/threonine protein kinase (EC 2.7.11.1) MANES_16G108000 A0A2C9UAT9_MANES Manihot esculenta (Cassava) (Jatropha manihot) autophagy of peroxisome [GO:0030242];late endosome to vacuole transport [GO:0045324];macroautophagy [GO:0016236];phosphatidylinositol-mediated signaling [GO:0048015];pollen development [GO:0009555];pollen germination [GO:0009846];protein phosphorylation [GO:0006468];protein targeting to vacuole [GO:0006623] "endosome membrane [GO:0010008];late endosome [GO:0005770];nucleus-vacuole junction [GO:0071561];phosphatidylinositol 3-kinase complex, class III, type I [GO:0034271];phosphatidylinositol 3-kinase complex, class III, type II [GO:0034272]" "endosome membrane [GO:0010008];late endosome [GO:0005770];nucleus-vacuole junction [GO:0071561];phosphatidylinositol 3-kinase complex, class III, type I [GO:0034271];phosphatidylinositol 3-kinase complex, class III, type II [GO:0034272];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];autophagy of peroxisome [GO:0030242];late endosome to vacuole transport [GO:0045324];macroautophagy [GO:0016236];phosphatidylinositol-mediated signaling [GO:0048015];pollen development [GO:0009555];pollen germination [GO:0009846];protein phosphorylation [GO:0006468];protein targeting to vacuole [GO:0006623]" ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] GQYDPSQHLEK 1.0459 14.2772 13.0345 14.2772 0 10.4103 13.0345 0 0 A0A251JC41 Uncharacterized protein MANES_14G096300 A0A251JC41_MANES Manihot esculenta (Cassava) (Jatropha manihot) P-body assembly [GO:0033962];stress granule assembly [GO:0034063] messenger ribonucleoprotein complex [GO:1990124];P-body [GO:0000932] messenger ribonucleoprotein complex [GO:1990124];P-body [GO:0000932];mRNA binding [GO:0003729];P-body assembly [GO:0033962];stress granule assembly [GO:0034063] mRNA binding [GO:0003729] DGPQIPPSDK 1.0031 0 13.0407 0 0 0 13.0407 0 0 A0A2C9V0I2 Uncharacterized protein MANES_11G075800 A0A2C9V0I2_MANES Manihot esculenta (Cassava) (Jatropha manihot) LHDSVECDK 0.97619 0 13.0414 0 0 0 0 0 13.0414 A0A2C9VQX9 Uncharacterized protein MANES_06G145900 A0A2C9VQX9_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi to plasma membrane protein transport [GO:0043001];intracellular protein transport [GO:0006886];protein localization to organelle [GO:0033365] Golgi apparatus [GO:0005794] Golgi apparatus [GO:0005794];GTP binding [GO:0005525];GTPase activity [GO:0003924];Golgi to plasma membrane protein transport [GO:0043001];intracellular protein transport [GO:0006886];protein localization to organelle [GO:0033365] GTPase activity [GO:0003924];GTP binding [GO:0005525] AGVAGPGA 0.99092 0 13.0419 0 0 0 0 13.0419 0 A0A2C9WBB6 Uncharacterized protein MANES_02G058800 A0A2C9WBB6_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565];regulation of transcription, DNA-templated [GO:0006355]" DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] FGQGGFK 0.98043 0 13.0425 0 0 0 0 13.0425 0 A0A2C9UNT4 Uncharacterized protein MANES_13G052600 A0A2C9UNT4_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] cytosolic large ribosomal subunit [GO:0022625] cytosolic large ribosomal subunit [GO:0022625];structural constituent of ribosome [GO:0003735];translation [GO:0006412] structural constituent of ribosome [GO:0003735] HYLPNGFK 0.95262 0 13.0462 0 0 0 13.0462 0 0 A0A2C9WAC9 ANAPC4_WD40 domain-containing protein MANES_02G029900 A0A2C9WAC9_MANES Manihot esculenta (Cassava) (Jatropha manihot) anaphase-promoting complex-dependent catabolic process [GO:0031145];positive regulation of anaphase-promoting complex-dependent catabolic process [GO:1905786];protein ubiquitination [GO:0016567] anaphase-promoting complex [GO:0005680] anaphase-promoting complex [GO:0005680];anaphase-promoting complex binding [GO:0010997];ubiquitin ligase activator activity [GO:1990757];anaphase-promoting complex-dependent catabolic process [GO:0031145];positive regulation of anaphase-promoting complex-dependent catabolic process [GO:1905786];protein ubiquitination [GO:0016567] anaphase-promoting complex binding [GO:0010997];ubiquitin ligase activator activity [GO:1990757] FWNVFPSPK 1.0233 0 13.047 0 0 0 0 0 13.047 A0A251K1R4 Bromo domain-containing protein MANES_10G118700 A0A251K1R4_MANES Manihot esculenta (Cassava) (Jatropha manihot) GQGVKIEDTEQQNSSIKEK 0.99722 0 13.0548 0 0 0 0 13.0548 0 A0A2C9VDY3 PPM-type phosphatase domain-containing protein MANES_09G174400 A0A2C9VDY3_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphatase activity [GO:0016791] phosphatase activity [GO:0016791] LEENAEERERVTASGGEVGR 1.0089 0 13.055 0 0 0 0 0 13.055 A0A2C9U365 DNA_MISMATCH_REPAIR_2 domain-containing protein MANES_18G108000 A0A2C9U365_MANES Manihot esculenta (Cassava) (Jatropha manihot) mismatch repair [GO:0006298];negative regulation of DNA recombination [GO:0045910] mismatch repair complex [GO:0032300] "mismatch repair complex [GO:0032300];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];ATP-dependent activity, acting on DNA [GO:0008094];endonuclease activity [GO:0004519];mismatched DNA binding [GO:0030983];mismatch repair [GO:0006298];negative regulation of DNA recombination [GO:0045910]" "ATP binding [GO:0005524];ATP-dependent activity, acting on DNA [GO:0008094];ATP hydrolysis activity [GO:0016887];endonuclease activity [GO:0004519];mismatched DNA binding [GO:0030983]" LNKYCGGHRFPK 0.95847 0 13.0558 0 0 0 0 13.0558 0 A0A2C9WD24 Uncharacterized protein MANES_02G104400 A0A2C9WD24_MANES Manihot esculenta (Cassava) (Jatropha manihot) IIHALVIVDER 1.0131 0 13.0601 0 0 0 0 0 13.0601 A0A2C9WDW8 Uncharacterized protein MANES_02G094600 A0A2C9WDW8_MANES Manihot esculenta (Cassava) (Jatropha manihot) FSIRDADAYPRYENQLENFSK 0.42857 11.2016 13.0654 11.2016 0 0 0 13.0654 0 A0A2C9UQG9 Uncharacterized protein MANES_13G032900 A0A2C9UQG9_MANES Manihot esculenta (Cassava) (Jatropha manihot) ALSNQEKFADSK 0.95193 0 13.066 0 0 0 13.066 0 0 A0A2C9U574 Bromo domain-containing protein MANES_17G063000 A0A2C9U574_MANES Manihot esculenta (Cassava) (Jatropha manihot) LTFSNAMLYNPPTNYVHKMAESLNK 1.0306 0 13.0725 0 0 0 0 13.0725 0 A0A199U9Q2 Uncharacterized protein MANES_S095500 A0A199U9Q2_MANES Manihot esculenta (Cassava) (Jatropha manihot) MTKLCMHVYLEPPKR 0.97712 0 13.0758 0 0 0 0 0 13.0758 A0A251JET4 F-box domain-containing protein MANES_13G018300 A0A251JET4_MANES Manihot esculenta (Cassava) (Jatropha manihot) KLAGLLEEWLFVLTMDSQGKESHWEVMDCLGNR 0.375 0 13.0824 0 0 0 0 13.0824 0 A0A2C9WIA7 ARID domain-containing protein MANES_01G060100 A0A2C9WIA7_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677] DNA binding [GO:0003677] SFWDDYRKYFPR 0.95252 0 13.084 0 0 0 13.084 0 0 A0A2C9W9P8 Uncharacterized protein MANES_03G210500 A0A2C9W9P8_MANES Manihot esculenta (Cassava) (Jatropha manihot) EAIAVEARQESEASK 0.96481 13.78 13.0865 0 13.78 0 13.0865 0 0 A0A2C9W554 Uncharacterized protein MANES_03G066200 A0A2C9W554_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA-dependent DNA replication [GO:0006261];double-strand break repair [GO:0006302] ATP binding [GO:0005524];DNA binding [GO:0003677];DNA-directed DNA polymerase activity [GO:0003887];DNA-dependent DNA replication [GO:0006261];double-strand break repair [GO:0006302] ATP binding [GO:0005524];DNA binding [GO:0003677];DNA-directed DNA polymerase activity [GO:0003887] LMAHFSK 0.95455 0 13.0894 0 0 0 13.0894 0 0 A0A2C9V4D0 PWWP domain-containing protein MANES_10G041700 A0A2C9V4D0_MANES Manihot esculenta (Cassava) (Jatropha manihot) GVSGSTVLESSKETVSDGVASGDSAETR 0.95716 0 13.0904 0 0 0 0 13.0904 12.3631 A0A2C9WJ67 Uncharacterized protein MANES_01G047300 A0A2C9WJ67_MANES Manihot esculenta (Cassava) (Jatropha manihot) YLTKFISK 0.96226 0 13.092 0 0 0 0 0 13.092 A0A251L9C7 Uncharacterized protein MANES_03G107200 A0A251L9C7_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to virus [GO:0051607];gene silencing by RNA [GO:0031047];immune response [GO:0006955] nucleic acid binding [GO:0003676];defense response to virus [GO:0051607];gene silencing by RNA [GO:0031047];immune response [GO:0006955] nucleic acid binding [GO:0003676] GFQHSLK 0.96714 0 13.0929 0 0 0 13.0929 0 0 A0A251L901 Phosphoenolpyruvate carboxylase (EC 4.1.1.31) MANES_03G101900 A0A251L901_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbon fixation [GO:0015977];leaf development [GO:0048366];tricarboxylic acid cycle [GO:0006099] cytosol [GO:0005829] cytosol [GO:0005829];phosphoenolpyruvate carboxylase activity [GO:0008964];carbon fixation [GO:0015977];leaf development [GO:0048366];tricarboxylic acid cycle [GO:0006099] phosphoenolpyruvate carboxylase activity [GO:0008964] DKKNLNMLQEMYNEWPFFR 0.99907 0 13.0945 0 0 0 0 0 13.0945 A0A2C9UT85 Uncharacterized protein MANES_13G125700 A0A2C9UT85_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast accumulation movement [GO:0009904];chloroplast avoidance movement [GO:0009903] cytosol [GO:0005829] cytosol [GO:0005829];chloroplast accumulation movement [GO:0009904];chloroplast avoidance movement [GO:0009903] ITVSMEKKHEAEESR 0.74545 0 13.1008 0 0 0 13.1008 0 0 A0A2C9U3N4 Uncharacterized protein MANES_17G008700 A0A2C9U3N4_MANES Manihot esculenta (Cassava) (Jatropha manihot) endoplasmic reticulum [GO:0005783] endoplasmic reticulum [GO:0005783];lipid binding [GO:0008289] lipid binding [GO:0008289] VEDRGLK 0.96173 0 13.1009 0 0 0 0 13.1009 0 A0A2C9VPB3 Uncharacterized protein MANES_06G049800 A0A2C9VPB3_MANES Manihot esculenta (Cassava) (Jatropha manihot) poly(A)+ mRNA export from nucleus [GO:0016973] DNA binding [GO:0003677];metal ion binding [GO:0046872];mRNA binding [GO:0003729];poly(A)+ mRNA export from nucleus [GO:0016973] DNA binding [GO:0003677];metal ion binding [GO:0046872];mRNA binding [GO:0003729] GWRRHSR 0.96837 0 13.1049 0 0 0 0 13.1049 0 A0A2C9VD89 Uncharacterized protein MANES_08G040000 A0A2C9VD89_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA splicing, via spliceosome [GO:0000398]" nucleus [GO:0005634];U2 snRNP [GO:0005686] "nucleus [GO:0005634];U2 snRNP [GO:0005686];U2 snRNA binding [GO:0030620];mRNA splicing, via spliceosome [GO:0000398]" U2 snRNA binding [GO:0030620] KGSFSYK 0.96696 0 13.1078 0 0 0 0 0 13.1078 A0A2C9WLL6 Citrate synthase MANES_01G129000 A0A2C9WLL6_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975];tricarboxylic acid cycle [GO:0006099] mitochondrial matrix [GO:0005759] mitochondrial matrix [GO:0005759];citrate (Si)-synthase activity [GO:0004108];carbohydrate metabolic process [GO:0005975];tricarboxylic acid cycle [GO:0006099] citrate (Si)-synthase activity [GO:0004108] HYMPLKERMETGDADR 0.98492 0 13.1159 0 0 0 13.1159 0 0 A0A2C9WDB9 Acyl-coenzyme A oxidase MANES_02G041600 A0A2C9WDB9_MANES Manihot esculenta (Cassava) (Jatropha manihot) fatty acid beta-oxidation using acyl-CoA oxidase [GO:0033540];lipid homeostasis [GO:0055088];long-chain fatty acid metabolic process [GO:0001676];very long-chain fatty acid metabolic process [GO:0000038] peroxisome [GO:0005777] peroxisome [GO:0005777];acyl-CoA oxidase activity [GO:0003997];FAD binding [GO:0071949];fatty acid binding [GO:0005504];flavin adenine dinucleotide binding [GO:0050660];palmitoyl-CoA oxidase activity [GO:0016401];fatty acid beta-oxidation using acyl-CoA oxidase [GO:0033540];lipid homeostasis [GO:0055088];long-chain fatty acid metabolic process [GO:0001676];very long-chain fatty acid metabolic process [GO:0000038] acyl-CoA oxidase activity [GO:0003997];FAD binding [GO:0071949];fatty acid binding [GO:0005504];flavin adenine dinucleotide binding [GO:0050660];palmitoyl-CoA oxidase activity [GO:0016401] HAFHVSDR 0.99095 0 13.1164 0 0 0 0 0 13.1164 A0A2C9WFD9 J domain-containing protein MANES_02G191800 A0A2C9WFD9_MANES Manihot esculenta (Cassava) (Jatropha manihot) RDEWMTTLPPERK 0.95395 0 13.1172 0 0 0 0 0 13.1172 A0A2C9VV69 Methyltransferase (EC 2.1.1.-) MANES_05G108800 A0A2C9VV69_MANES Manihot esculenta (Cassava) (Jatropha manihot) methylation [GO:0032259] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231];methyltransferase activity [GO:0008168];methylation [GO:0032259] methyltransferase activity [GO:0008168] DVIWSNNVK 0.96387 0 13.1246 0 0 0 0 0 13.1246 A0A2C9WDY3 Uncharacterized protein MANES_02G061500 A0A2C9WDY3_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] NQKDVFVGETKVTAGDSFLEPENVR 1.0324 0 13.1289 0 0 0 0 0 13.1289 A0A2C9VUX4 AAA domain-containing protein MANES_05G019300 A0A2C9VUX4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] PGRIDVHIHFPLCDFSAFKTLANSYLGVK 1.0563 0 13.1317 0 0 0 0 13.1317 0 A0A2C9UQZ3 Uncharacterized protein MANES_13G110300 A0A2C9UQZ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi membrane [GO:0000139];integral component of membrane [GO:0016021] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021];galactosyltransferase activity [GO:0008378];hexosyltransferase activity [GO:0016758] galactosyltransferase activity [GO:0008378];hexosyltransferase activity [GO:0016758] NKVDYCRLHGYDIFYNNVLLHPK 1.0028 0 13.1375 0 0 0 0 0 13.1375 A0A2C9VNY4 "ADP/ATP translocase (ADP,ATP carrier protein)" MANES_06G081600 A0A2C9VNY4_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial ADP transmembrane transport [GO:0140021];mitochondrial ATP transmembrane transport [GO:1990544] integral component of membrane [GO:0016021];mitochondrial inner membrane [GO:0005743] integral component of membrane [GO:0016021];mitochondrial inner membrane [GO:0005743];ATP:ADP antiporter activity [GO:0005471];mitochondrial ADP transmembrane transport [GO:0140021];mitochondrial ATP transmembrane transport [GO:1990544] ATP:ADP antiporter activity [GO:0005471] GLLDVYSKTLSSDGMAGLYR 1.0132 0 13.1391 0 0 0 13.1391 0 0 A0A2C9WD07 Catalase (EC 1.11.1.6) MANES_02G113300 A0A2C9WD07_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrogen peroxide catabolic process [GO:0042744];response to oxidative stress [GO:0006979] peroxisome [GO:0005777] peroxisome [GO:0005777];catalase activity [GO:0004096];heme binding [GO:0020037];metal ion binding [GO:0046872];hydrogen peroxide catabolic process [GO:0042744];response to oxidative stress [GO:0006979] catalase activity [GO:0004096];heme binding [GO:0020037];metal ion binding [GO:0046872] WVAALSDPR 0.96266 0 13.1404 0 0 0 0 13.1404 0 A0A2C9WE18 Uncharacterized protein MANES_02G147800 A0A2C9WE18_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi apparatus [GO:0005794] Golgi apparatus [GO:0005794];glycosyltransferase activity [GO:0016757];pentosyltransferase activity [GO:0016763] glycosyltransferase activity [GO:0016757];pentosyltransferase activity [GO:0016763] TRRFCGIDPSGK 0.95343 0 13.1426 0 0 0 0 0 13.1426 A0A2C9W962 Uncharacterized protein MANES_03G203700 A0A2C9W962_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565];regulation of transcription, DNA-templated [GO:0006355]" DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] VVHYFSK 0.9682 0 13.1486 0 0 0 0 0 13.1486 A0A2C9UNM6 4-diphosphocytidyl-2C-methyl-D-erythritol synthase (EC 2.7.7.60) (MEP cytidylyltransferase) MANES_14G146200 A0A2C9UNM6_MANES Manihot esculenta (Cassava) (Jatropha manihot) "isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway [GO:0019288]" "2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase activity [GO:0050518];isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway [GO:0019288]" 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase activity [GO:0050518] IATTSIKCSAK 0.95032 0 13.1491 0 0 0 0 13.1491 0 Q43784 "Granule-bound starch synthase 1, chloroplastic/amyloplastic (EC 2.4.1.242) (Granule-bound starch synthase I) (GBSS-I)" WAXY GBSS SSG1_MANES Manihot esculenta (Cassava) (Jatropha manihot) starch biosynthetic process [GO:0019252] amyloplast [GO:0009501];chloroplast [GO:0009507] amyloplast [GO:0009501];chloroplast [GO:0009507];ADP-glucose-starch glucosyltransferase activity [GO:0102502];glycogen (starch) synthase activity [GO:0004373];starch biosynthetic process [GO:0019252] ADP-glucose-starch glucosyltransferase activity [GO:0102502];glycogen (starch) synthase activity [GO:0004373] YIDIHYDATTVMDAKPLLK 1.0029 0 13.1491 0 0 0 13.1491 0 0 A0A2C9V5Q7 Uncharacterized protein MANES_10G119900 A0A2C9V5Q7_MANES Manihot esculenta (Cassava) (Jatropha manihot) iron-sulfur cluster assembly [GO:0016226];protein maturation by iron-sulfur cluster transfer [GO:0097428] mitochondrion [GO:0005739] "mitochondrion [GO:0005739];4 iron, 4 sulfur cluster binding [GO:0051539];iron ion binding [GO:0005506];iron-sulfur cluster assembly [GO:0016226];protein maturation by iron-sulfur cluster transfer [GO:0097428]" "4 iron, 4 sulfur cluster binding [GO:0051539];iron ion binding [GO:0005506]" LRRIPCR 0.96159 0 13.1517 0 0 0 13.1517 0 0 A0A199U8U7 Pectinesterase (EC 3.1.1.11) MANES_S112800 A0A199U8U7_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];carboxylic ester hydrolase activity [GO:0052689];pectinesterase activity [GO:0030599];cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];carboxylic ester hydrolase activity [GO:0052689];pectinesterase activity [GO:0030599] PFITLLGDPK 0.95969 0 13.154 0 0 0 13.154 0 0 A0A2C9V6S3 Uncharacterized protein MANES_09G002600 A0A2C9V6S3_MANES Manihot esculenta (Cassava) (Jatropha manihot) DQLNYTAQRR 0.99433 0 13.1563 0 0 0 0 0 13.1563 A0A2C9U2F7 RING-type domain-containing protein MANES_18G102200 A0A2C9U2F7_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein transport [GO:0015031];ubiquitin-dependent protein catabolic process [GO:0006511] integral component of membrane [GO:0016021];vacuole [GO:0005773] integral component of membrane [GO:0016021];vacuole [GO:0005773];metal ion binding [GO:0046872];ubiquitin protein ligase activity [GO:0061630];protein transport [GO:0015031];ubiquitin-dependent protein catabolic process [GO:0006511] metal ion binding [GO:0046872];ubiquitin protein ligase activity [GO:0061630] FHAFCVDSWLTTWR 0.97813 0 13.16 0 0 0 0 0 13.16 A0A2C9U0Z8 W2 domain-containing protein MANES_18G072500 A0A2C9U0Z8_MANES Manihot esculenta (Cassava) (Jatropha manihot) formation of cytoplasmic translation initiation complex [GO:0001732];formation of translation preinitiation complex [GO:0001731] cytosol [GO:0005829] cytosol [GO:0005829];eukaryotic initiation factor eIF2 binding [GO:0071074];GDP-dissociation inhibitor activity [GO:0005092];GTP binding [GO:0005525];translation initiation factor activity [GO:0003743];formation of cytoplasmic translation initiation complex [GO:0001732];formation of translation preinitiation complex [GO:0001731] eukaryotic initiation factor eIF2 binding [GO:0071074];GDP-dissociation inhibitor activity [GO:0005092];GTP binding [GO:0005525];translation initiation factor activity [GO:0003743] SPEREAK 0.96345 0 13.1647 0 0 0 0 13.1647 0 A0A2C9UBF9 GATA transcription factor MANES_16G074900 A0A2C9UBF9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "cell differentiation [GO:0030154];positive regulation of transcription, DNA-templated [GO:0045893]" nucleus [GO:0005634] "nucleus [GO:0005634];sequence-specific DNA binding [GO:0043565];zinc ion binding [GO:0008270];cell differentiation [GO:0030154];positive regulation of transcription, DNA-templated [GO:0045893]" sequence-specific DNA binding [GO:0043565];zinc ion binding [GO:0008270] EGADGGTGNGDGRK 1.0123 0 13.1739 0 0 0 13.1739 0 0 A0A2C9UTW7 Uncharacterized protein MANES_13G146300 A0A2C9UTW7_MANES Manihot esculenta (Cassava) (Jatropha manihot) APKSWRQALPPK 0.95298 0 13.1793 0 0 0 13.1793 0 0 A0A2C9WGD2 Uncharacterized protein MANES_02G224400 A0A2C9WGD2_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] "nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];lipid binding [GO:0008289]" "DNA binding [GO:0003677];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];lipid binding [GO:0008289]" FWFQNRR 0.52174 0 13.182 0 0 0 13.182 0 0 A0A2C9VCG4 Uncharacterized protein MANES_09G141900 A0A2C9VCG4_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975];photosynthetic electron transport in photosystem I [GO:0009773] chloroplast thylakoid membrane [GO:0009535];cytoplasm [GO:0005737];NAD(P)H dehydrogenase complex (plastoquinone) [GO:0010598] chloroplast thylakoid membrane [GO:0009535];cytoplasm [GO:0005737];NAD(P)H dehydrogenase complex (plastoquinone) [GO:0010598];carbohydrate binding [GO:0030246];glucose-6-phosphate 1-epimerase activity [GO:0047938];carbohydrate metabolic process [GO:0005975];photosynthetic electron transport in photosystem I [GO:0009773] carbohydrate binding [GO:0030246];glucose-6-phosphate 1-epimerase activity [GO:0047938] YETLDQGLELFFRVIR 0.98759 0 13.1884 0 0 0 13.1884 0 0 A0A2C9UEF9 Sulfate adenylyltransferase (EC 2.7.7.4) MANES_15G033600 A0A2C9UEF9_MANES Manihot esculenta (Cassava) (Jatropha manihot) sulfate assimilation [GO:0000103] adenylylsulfate kinase activity [GO:0004020];ATP binding [GO:0005524];sulfate adenylyltransferase (ATP) activity [GO:0004781];sulfate assimilation [GO:0000103] adenylylsulfate kinase activity [GO:0004020];ATP binding [GO:0005524];sulfate adenylyltransferase (ATP) activity [GO:0004781] EAISLPRIK 0.95415 0 13.1909 0 0 0 0 0 13.1909 A0A2C9UPH6 RING-type domain-containing protein MANES_13G023100 A0A2C9UPH6_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];zinc ion binding [GO:0008270] zinc ion binding [GO:0008270] HSTCPLCRSVL 0.95926 0 13.2018 0 0 0 13.2018 0 0 A0A2C9VR66 Uncharacterized protein MANES_06G157000 A0A2C9VR66_MANES Manihot esculenta (Cassava) (Jatropha manihot) KGVCLESEGEYHK 0.9768 0 13.2125 0 0 0 0 13.2125 0 A0A199UA85 Uncharacterized protein MANES_S077300 A0A199UA85_MANES Manihot esculenta (Cassava) (Jatropha manihot) nitrate assimilation [GO:0042128];nitric oxide biosynthetic process [GO:0006809] FAD binding [GO:0071949];heme binding [GO:0020037];metal ion binding [GO:0046872];nitrate reductase (NADH) activity [GO:0009703];nitrate assimilation [GO:0042128];nitric oxide biosynthetic process [GO:0006809] FAD binding [GO:0071949];heme binding [GO:0020037];metal ion binding [GO:0046872];nitrate reductase (NADH) activity [GO:0009703] DELDAWAK 0.95079 0 13.2175 0 0 0 0 13.2175 0 A0A2C9VAM9 Uncharacterized protein MANES_09G065100 A0A2C9VAM9_MANES Manihot esculenta (Cassava) (Jatropha manihot) MIGDREFEVYR 0.95157 0 13.221 0 0 0 0 13.221 0 A0A2C9WD42 RING-type domain-containing protein MANES_02G120000 A0A2C9WD42_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567] cytosol [GO:0005829] cytosol [GO:0005829];metal ion binding [GO:0046872];ubiquitin protein ligase activity [GO:0061630];protein ubiquitination [GO:0016567] metal ion binding [GO:0046872];ubiquitin protein ligase activity [GO:0061630] EFYAVIFPSLLQLQR 0.97695 0 13.2313 0 0 0 0 13.2313 0 A0A2C9UWD7 Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4) MANES_12G135000 A0A2C9UWD7_MANES Manihot esculenta (Cassava) (Jatropha manihot) asparagine biosynthetic process [GO:0006529];glutamine metabolic process [GO:0006541] cytosol [GO:0005829] cytosol [GO:0005829];asparagine synthase (glutamine-hydrolyzing) activity [GO:0004066];ATP binding [GO:0005524];asparagine biosynthetic process [GO:0006529];glutamine metabolic process [GO:0006541] asparagine synthase (glutamine-hydrolyzing) activity [GO:0004066];ATP binding [GO:0005524] EAYYYRTIFEKFFPK 1.037 0 13.2478 0 0 0 0 0 13.2478 A0A2C9VYC1 Uncharacterized protein MANES_04G006000 A0A2C9VYC1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] SLANDASCSQIQELGK 0.99645 0 13.2554 0 0 0 0 13.2554 0 A0A2C9UXT4 Uncharacterized protein MANES_12G120000 A0A2C9UXT4_MANES Manihot esculenta (Cassava) (Jatropha manihot) SVTMPNKPVAPAKK 0.95917 15.5468 13.2556 14.0692 15.5468 0 13.2556 0 0 A0A2C9V7M0 Uncharacterized protein MANES_10G149800 A0A2C9V7M0_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553];carbohydrate metabolic process [GO:0005975]" "hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]" TASSAYQYEGAAHEDGR 1.033 0 13.2586 0 0 0 0 0 13.2586 A0A2C9VZ06 K-box domain-containing protein MANES_05G187800 A0A2C9VZ06_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];regulation of transcription by RNA polymerase II [GO:0006357]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]" DHMLMDEIQELKRK 0.97831 13.0949 13.2624 0 13.0949 0 0 0 13.2624 A0A251J0W9 Uncharacterized protein MANES_16G125800 A0A251J0W9_MANES Manihot esculenta (Cassava) (Jatropha manihot) Group II intron splicing [GO:0000373];mitochondrial respiratory chain complex I assembly [GO:0032981];mitochondrial RNA processing [GO:0000963] mitochondrion [GO:0005739] mitochondrion [GO:0005739];Group II intron splicing [GO:0000373];mitochondrial respiratory chain complex I assembly [GO:0032981];mitochondrial RNA processing [GO:0000963] EPTDAKR 0.96642 0 13.278 0 0 0 0 0 13.278 A0A2C9UTU9 Uncharacterized protein MANES_12G018100 A0A2C9UTU9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "hydrolase activity, acting on ester bonds [GO:0016788]" "hydrolase activity, acting on ester bonds [GO:0016788]" TIMLNHKKFHFEEPFK 0.9823 0 13.2792 0 0 0 0 0 13.2792 A0A2C9VCP8 Uncharacterized protein MANES_08G019200 A0A2C9VCP8_MANES Manihot esculenta (Cassava) (Jatropha manihot) "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" EGHEFFEAMDKVATWVGTPNIADFLPFLKR 1.01 0 13.2801 0 0 0 0 13.2801 0 A0A2C9VY24 SufE domain-containing protein MANES_05G202200 A0A2C9VY24_MANES Manihot esculenta (Cassava) (Jatropha manihot) PISFDSIATK 0.95957 0 13.2835 0 0 0 0 0 13.2835 A0A2C9V4I9 Thioredoxin domain-containing protein MANES_10G083100 A0A2C9V4I9_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell redox homeostasis [GO:0045454] chloroplast [GO:0009507] chloroplast [GO:0009507];cell redox homeostasis [GO:0045454] EATVLEFYSPKCRLCNSLLK 1.01 13.0395 13.2884 0 13.0395 0 0 13.2884 0 A0A2C9V0X0 SPARK domain-containing protein MANES_11G127200 A0A2C9V0X0_MANES Manihot esculenta (Cassava) (Jatropha manihot) membrane [GO:0016020] membrane [GO:0016020] CPVNFSAMSNLMDK 0.95851 0 13.2886 0 0 0 13.2886 0 0 A0A2C9WJL4 HTH myb-type domain-containing protein MANES_01G103800 A0A2C9WJL4_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] PLTQCIWK 0.99094 0 13.2919 0 0 0 0 0 13.2919 A0A2C9VPZ4 LRRNT_2 domain-containing protein MANES_06G042700 A0A2C9VPZ4_MANES Manihot esculenta (Cassava) (Jatropha manihot) MVMMILLLK 0.96226 0 13.2926 0 0 0 0 0 13.2926 A0A2C9V1T2 Uncharacterized protein MANES_11G161400 A0A2C9V1T2_MANES Manihot esculenta (Cassava) (Jatropha manihot) histone methylation [GO:0016571] histone methylation [GO:0016571] ACCGPFWK 1.0017 0 13.2965 0 0 0 13.2965 0 0 A0A2C9UHD3 Uncharacterized protein MANES_15G156800 A0A2C9UHD3_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial large ribosomal subunit [GO:0005762] mitochondrial large ribosomal subunit [GO:0005762];structural constituent of ribosome [GO:0003735] structural constituent of ribosome [GO:0003735] DGADPKILPDSEYPDWLWHLLDKR 1.014 0 13.2995 0 0 0 0 0 13.2995 A0A2C9VGL7 PCRF domain-containing protein MANES_08G111800 A0A2C9VGL7_MANES Manihot esculenta (Cassava) (Jatropha manihot) translational termination [GO:0006415] translational termination [GO:0006415] IVASNWTILDESESDWK 1 12.6401 13.3022 0 12.6401 0 0 13.3022 0 A0A2C9U9P2 Uncharacterized protein MANES_16G017700 A0A2C9U9P2_MANES Manihot esculenta (Cassava) (Jatropha manihot) YALVQCTRDLNSSSCTSCLSELSK 1.0125 0 13.3039 0 0 0 13.3039 0 0 A0A2C9VQS9 GMC_OxRdtase_N domain-containing protein MANES_06G142000 A0A2C9VQS9_MANES Manihot esculenta (Cassava) (Jatropha manihot) "flavin adenine dinucleotide binding [GO:0050660];oxidoreductase activity, acting on CH-OH group of donors [GO:0016614]" "flavin adenine dinucleotide binding [GO:0050660];oxidoreductase activity, acting on CH-OH group of donors [GO:0016614]" LGSGSTAYLNMNTK 0.98111 10.9828 13.3132 0 10.9828 0 0 0 13.3132 A0A2C9V762 DUF4005 domain-containing protein MANES_09G015700 A0A2C9V762_MANES Manihot esculenta (Cassava) (Jatropha manihot) WRWILGK 0.97806 0 13.3151 0 0 0 0 0 13.3151 A0A2C9W899 3-ketoacyl-CoA synthase (EC 2.3.1.-) MANES_03G170600 A0A2C9W899_MANES Manihot esculenta (Cassava) (Jatropha manihot) fatty acid biosynthetic process [GO:0006633] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];very-long-chain 3-ketoacyl-CoA synthase activity [GO:0102756];fatty acid biosynthetic process [GO:0006633] very-long-chain 3-ketoacyl-CoA synthase activity [GO:0102756] CYNCVFQREDESER 0.97705 0 13.3225 0 0 0 0 0 13.3225 A0A140H8T1 WRKY transcription factor 77 MANES_18G098700 A0A140H8T1_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] WSTSSGR 0.9813 0 13.3277 0 0 0 0 0 13.3277 A0A2C9VDI1 Lipoxygenase domain-containing protein MANES_09G160100 A0A2C9VDI1_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid oxidation [GO:0034440] "metal ion binding [GO:0046872];oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702];lipid oxidation [GO:0034440]" "metal ion binding [GO:0046872];oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]" MGSYQLNL 0.95215 0 13.3304 0 0 0 0 0 13.3304 A0A2C9UDI4 16S rRNA m5C967 methyltransferase (EC 2.1.1.176) (rRNA (cytosine-C(5)-)-methyltransferase RsmB) MANES_15G059300 A0A2C9UDI4_MANES Manihot esculenta (Cassava) (Jatropha manihot) "maturation of LSU-rRNA [GO:0000470];regulation of transcription, DNA-templated [GO:0006355];RNA methylation [GO:0001510];rRNA base methylation [GO:0070475]" cytoplasm [GO:0005737];nucleolus [GO:0005730] "cytoplasm [GO:0005737];nucleolus [GO:0005730];RNA binding [GO:0003723];rRNA (cytosine-C5-)-methyltransferase activity [GO:0009383];maturation of LSU-rRNA [GO:0000470];regulation of transcription, DNA-templated [GO:0006355];RNA methylation [GO:0001510];rRNA base methylation [GO:0070475]" RNA binding [GO:0003723];rRNA (cytosine-C5-)-methyltransferase activity [GO:0009383] YLDHLICSLCHDER 0.96628 0 13.3449 0 0 0 0 13.3449 0 A0A2C9V4G5 Protein kinase domain-containing protein MANES_10G083000 A0A2C9V4G5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] PTMKQVCR 0.96234 0 13.3525 0 0 0 0 13.3525 0 A0A2C9WIF9 UDP-glucose 4-epimerase (EC 5.1.3.-) MANES_01G065100 A0A2C9WIF9_MANES Manihot esculenta (Cassava) (Jatropha manihot) galactose metabolic process [GO:0006012] UDP-glucose 4-epimerase activity [GO:0003978];galactose metabolic process [GO:0006012] UDP-glucose 4-epimerase activity [GO:0003978] ELNWKAKYGIEEMCR 0.97596 0 13.3567 0 0 0 0 13.3567 0 V5N4C3 Alkaline/neutral invertase (EC 3.2.1.26) NINV6 MANES_04G006900 V5N4C3_MANES Manihot esculenta (Cassava) (Jatropha manihot) cotyledon development [GO:0048825];starch metabolic process [GO:0005982];sucrose catabolic process [GO:0005987] chloroplast [GO:0009507] chloroplast [GO:0009507];glycopeptide alpha-N-acetylgalactosaminidase activity [GO:0033926];sucrose alpha-glucosidase activity [GO:0004575];cotyledon development [GO:0048825];starch metabolic process [GO:0005982];sucrose catabolic process [GO:0005987] glycopeptide alpha-N-acetylgalactosaminidase activity [GO:0033926];sucrose alpha-glucosidase activity [GO:0004575] NNGGSLHQKSSR 0.33333 11.5445 13.3591 11.5445 0 0 0 13.3591 0 A0A2C9WBC7 Uncharacterized protein MANES_02G006800 A0A2C9WBC7_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular anatomical entity [GO:0110165] cellular anatomical entity [GO:0110165] VRTCQEYINHGGLSQQFLMVETPK 0.97442 0 13.368 0 0 0 0 13.368 0 A0A2C9WPA9 Uncharacterized protein MANES_01G264600 A0A2C9WPA9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" IIDDFVSYLIHTRRELFAEQR 0.97567 0 13.3695 0 0 0 0 0 13.3695 A0A251K4R5 E3 ubiquitin-protein ligase (EC 2.3.2.27) (Fragment) MANES_09G091600 A0A251K4R5_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567];ubiquitin-dependent protein catabolic process via the N-end rule pathway [GO:0071596] cytoplasm [GO:0005737];ubiquitin ligase complex [GO:0000151] cytoplasm [GO:0005737];ubiquitin ligase complex [GO:0000151];ubiquitin protein ligase activity [GO:0061630];zinc ion binding [GO:0008270];protein ubiquitination [GO:0016567];ubiquitin-dependent protein catabolic process via the N-end rule pathway [GO:0071596] ubiquitin protein ligase activity [GO:0061630];zinc ion binding [GO:0008270] IFPLQRNER 0.95936 0 13.3712 0 0 0 13.3712 0 0 A0A2C9UFV6 Uncharacterized protein (Fragment) MANES_15G110200 A0A2C9UFV6_MANES Manihot esculenta (Cassava) (Jatropha manihot) histone exchange [GO:0043486] Swr1 complex [GO:0000812] Swr1 complex [GO:0000812];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];histone binding [GO:0042393];histone exchange [GO:0043486] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];histone binding [GO:0042393] RALDDLVIQSGGYNTEFFKK 0.5 13.7994 13.3775 13.7994 0 0 13.3775 0 0 A0A2C9V5E8 Uncharacterized protein MANES_10G109800 A0A2C9V5E8_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672];ubiquitin-protein transferase activity [GO:0004842] ATP binding [GO:0005524];protein kinase activity [GO:0004672];ubiquitin-protein transferase activity [GO:0004842] DFQTFSRVLCK 0.9503 0 13.3925 0 0 0 13.3925 0 0 A0A2C9U616 Uncharacterized protein MANES_17G054400 A0A2C9U616_MANES Manihot esculenta (Cassava) (Jatropha manihot) proteolysis involved in cellular protein catabolic process [GO:0051603] extracellular space [GO:0005615];lysosome [GO:0005764] extracellular space [GO:0005615];lysosome [GO:0005764];cysteine-type endopeptidase activity [GO:0004197];proteolysis involved in cellular protein catabolic process [GO:0051603] cysteine-type endopeptidase activity [GO:0004197] VYKDSAEMERR 0.95395 0 13.4177 0 0 0 0 13.4177 0 A0A2C9WFE4 Uncharacterized protein MANES_02G118100 A0A2C9WFE4_MANES Manihot esculenta (Cassava) (Jatropha manihot) AALAFRNLNPGEHIDAVEFESDSWSDDSTNDK 0.97361 0 13.4213 0 0 0 0 0 13.4213 A0A2C9V2I5 MLO-like protein MLO MANES_11G142400 A0A2C9V2I5_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];response to biotic stimulus [GO:0009607] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];calmodulin binding [GO:0005516];defense response [GO:0006952];response to biotic stimulus [GO:0009607] calmodulin binding [GO:0005516] AGGGGGR 0.97979 15.5292 13.4221 0 12.9838 15.5292 13.4221 0 0 A0A2C9WG61 Uncharacterized protein MANES_02G218400 A0A2C9WG61_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA endoreduplication [GO:0042023] DNA binding [GO:0003677];DNA endoreduplication [GO:0042023] DNA binding [GO:0003677] NVLCEDYFDSMIVFSEAWWIGR 0.27778 0 13.4259 0 0 0 0 13.4259 12.3036 A0A2C9UV42 Glycosyltransferases (EC 2.4.-.-) MANES_12G107600 A0A2C9UV42_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975];cell wall organization [GO:0071555];glucuronoxylan biosynthetic process [GO:0010417];plant-type secondary cell wall biogenesis [GO:0009834] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021];galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity [GO:0015018];xylosyltransferase activity [GO:0042285];carbohydrate metabolic process [GO:0005975];cell wall organization [GO:0071555];glucuronoxylan biosynthetic process [GO:0010417];plant-type secondary cell wall biogenesis [GO:0009834] galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity [GO:0015018];xylosyltransferase activity [GO:0042285] MKLSALQQSYMSR 0.95842 15.1351 13.4299 15.1351 0 0 13.4299 0 0 A0A2C9WEC3 RRM_2 domain-containing protein MANES_02G159500 A0A2C9WEC3_MANES Manihot esculenta (Cassava) (Jatropha manihot) ribonucleoprotein complex [GO:1990904] ribonucleoprotein complex [GO:1990904];RNA binding [GO:0003723] RNA binding [GO:0003723] AELQSDSFKSEYDFLYLPMDFR 0.98184 0 13.4305 0 0 0 0 0 13.4305 A0A251LA29 Uncharacterized protein MANES_03G126700 A0A251LA29_MANES Manihot esculenta (Cassava) (Jatropha manihot) GGGGSVK 0.98042 0 13.4316 0 0 0 13.4316 0 0 A0A2C9VTQ2 RING-type E3 ubiquitin transferase (EC 2.3.2.27) MANES_05G010800 A0A2C9VTQ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567];rescue of stalled ribosome [GO:0072344] metal ion binding [GO:0046872];ribosome binding [GO:0043022];ubiquitin protein ligase activity [GO:0061630];protein ubiquitination [GO:0016567];rescue of stalled ribosome [GO:0072344] metal ion binding [GO:0046872];ribosome binding [GO:0043022];ubiquitin protein ligase activity [GO:0061630] NYDDLEIHFR 0.98246 0 13.4338 0 0 0 0 0 13.4338 A0A2C9VG49 AT-hook motif nuclear-localized protein MANES_08G137400 A0A2C9VG49_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];minor groove of adenine-thymine-rich DNA binding [GO:0003680] DNA-binding transcription factor activity [GO:0003700];minor groove of adenine-thymine-rich DNA binding [GO:0003680] KPDLGISMSNSNR 0.97555 0 13.4368 0 0 0 0 0 13.4368 A0A2C9U173 SET domain-containing protein MANES_18G073800 A0A2C9U173_MANES Manihot esculenta (Cassava) (Jatropha manihot) MGQQDDIRESAILEGYR 0.99843 0 13.4409 0 0 0 0 0 13.4409 A0A2C9UEL1 Uncharacterized protein MANES_15G102000 A0A2C9UEL1_MANES Manihot esculenta (Cassava) (Jatropha manihot) carotene catabolic process [GO:0016121] chloroplast stroma [GO:0009570] chloroplast stroma [GO:0009570];carotenoid dioxygenase activity [GO:0010436];metal ion binding [GO:0046872];carotene catabolic process [GO:0016121] carotenoid dioxygenase activity [GO:0010436];metal ion binding [GO:0046872] LPEMIHGGSPVIYDK 0.97346 0 13.4458 0 0 0 0 0 13.4458 A0A2C9U8A5 Uncharacterized protein MANES_16G038400 A0A2C9U8A5_MANES Manihot esculenta (Cassava) (Jatropha manihot) proteolysis involved in cellular protein catabolic process [GO:0051603] extracellular space [GO:0005615];lysosome [GO:0005764] extracellular space [GO:0005615];lysosome [GO:0005764];cysteine-type endopeptidase activity [GO:0004197];proteolysis involved in cellular protein catabolic process [GO:0051603] cysteine-type endopeptidase activity [GO:0004197] LMASSSKFR 0.96364 0 13.4503 0 0 0 0 0 13.4503 A0A251K650 GYF_2 domain-containing protein MANES_09G110300 A0A251K650_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein import into chloroplast stroma [GO:0045037] chloroplast inner membrane [GO:0009706] chloroplast inner membrane [GO:0009706];protein transmembrane transporter activity [GO:0008320];protein import into chloroplast stroma [GO:0045037] protein transmembrane transporter activity [GO:0008320] DTFIWGEDLDEWAPIHMIYGMER 1.0071 0 13.456 0 0 0 0 0 13.456 A0A2C9UHV1 Uncharacterized protein MANES_14G006900 A0A2C9UHV1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "developmental process [GO:0032502];DNA-templated transcription, termination [GO:0006353];regulation of transcription, DNA-templated [GO:0006355]" chloroplast [GO:0009507] "chloroplast [GO:0009507];double-stranded DNA binding [GO:0003690];developmental process [GO:0032502];DNA-templated transcription, termination [GO:0006353];regulation of transcription, DNA-templated [GO:0006355]" double-stranded DNA binding [GO:0003690] CPEIFAMSIEKTLR 0.29412 0 13.461 0 0 0 0 0 13.461 A0A2C9W482 Fucosyltransferase (EC 2.4.1.-) MANES_04G154800 A0A2C9W482_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall organization [GO:0071555];xyloglucan biosynthetic process [GO:0009969] Golgi cisterna membrane [GO:0032580] Golgi cisterna membrane [GO:0032580];fucosyltransferase activity [GO:0008417];galactoside 2-alpha-L-fucosyltransferase activity [GO:0008107];cell wall organization [GO:0071555];xyloglucan biosynthetic process [GO:0009969] fucosyltransferase activity [GO:0008417];galactoside 2-alpha-L-fucosyltransferase activity [GO:0008107] LLNGTSNPGLGK 1.0009 0 13.477 0 0 0 0 13.477 0 A0A2C9WBU4 Fe2OG dioxygenase domain-containing protein MANES_02G000400 A0A2C9WBU4_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] FSNWRDFLRLHCYPVEDYIQEWPSNPPSFR 0.42857 0 13.4784 0 0 0 0 13.4784 12.2051 A0A2C9ULL2 Uncharacterized protein MANES_14G105700 A0A2C9ULL2_MANES Manihot esculenta (Cassava) (Jatropha manihot) NAD transmembrane transport [GO:0035352] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];NAD transmembrane transporter activity [GO:0051724];NAD transmembrane transport [GO:0035352] NAD transmembrane transporter activity [GO:0051724] EGFPGFYR 0.95667 0 13.4795 0 0 0 13.4795 0 0 A0A2C9VR36 Uncharacterized protein MANES_06G082700 A0A2C9VR36_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" IVEEHRMR 0.96524 0 13.4803 0 0 0 0 13.4803 0 A0A2C9V504 Uncharacterized protein MANES_10G099000 A0A2C9V504_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive regulation of transcription by RNA polymerase II [GO:0045944];regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];positive regulation of transcription by RNA polymerase II [GO:0045944];regulation of transcription by RNA polymerase II [GO:0006357]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]" EIEERTHELRQMK 0.95399 0 13.4861 0 0 0 0 0 13.4861 A0A2C9VRA0 MFS domain-containing protein MANES_06G156700 A0A2C9VRA0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] DVYPAMGLIK 0.98056 0 13.4886 0 0 0 0 0 13.4886 A0A2C9W3M3 Uncharacterized protein MANES_04G108000 A0A2C9W3M3_MANES Manihot esculenta (Cassava) (Jatropha manihot) RALSALIHPSSHHLRR 0.98229 0 13.4959 0 0 0 0 13.4959 0 A0A2C9WDF0 Uncharacterized protein MANES_02G130800 A0A2C9WDF0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565];regulation of transcription, DNA-templated [GO:0006355]" DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] ERKHHQLEENAYLEGR 0.96003 0 13.4971 0 0 0 0 13.4971 0 A0A2C9VH97 Uncharacterized protein MANES_08G110400 A0A2C9VH97_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] LRSESASTIGMNFR 0.97572 0 13.4998 0 0 0 0 13.4998 0 A0A2C9VIS2 Uncharacterized protein MANES_07G001500 A0A2C9VIS2_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] beta-glucosidase activity [GO:0008422];carbohydrate metabolic process [GO:0005975] beta-glucosidase activity [GO:0008422] FGITYVDYRNDLR 0.95735 0 13.5033 0 0 0 13.5033 0 0 A0A2C9WE60 Uncharacterized protein MANES_02G141300 A0A2C9WE60_MANES Manihot esculenta (Cassava) (Jatropha manihot) "exonucleolytic catabolism of deadenylated mRNA [GO:0043928];exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000467];nuclear mRNA surveillance [GO:0071028];nuclear polyadenylation-dependent mRNA catabolic process [GO:0071042];nuclear polyadenylation-dependent rRNA catabolic process [GO:0071035];nuclear polyadenylation-dependent tRNA catabolic process [GO:0071038];nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5' [GO:0034427];rRNA catabolic process [GO:0016075];U1 snRNA 3'-end processing [GO:0034473];U4 snRNA 3'-end processing [GO:0034475];U5 snRNA 3'-end processing [GO:0034476]" cytoplasmic exosome (RNase complex) [GO:0000177];nuclear exosome (RNase complex) [GO:0000176] "cytoplasmic exosome (RNase complex) [GO:0000177];nuclear exosome (RNase complex) [GO:0000176];exonucleolytic catabolism of deadenylated mRNA [GO:0043928];exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000467];nuclear mRNA surveillance [GO:0071028];nuclear polyadenylation-dependent mRNA catabolic process [GO:0071042];nuclear polyadenylation-dependent rRNA catabolic process [GO:0071035];nuclear polyadenylation-dependent tRNA catabolic process [GO:0071038];nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5' [GO:0034427];rRNA catabolic process [GO:0016075];U1 snRNA 3'-end processing [GO:0034473];U4 snRNA 3'-end processing [GO:0034475];U5 snRNA 3'-end processing [GO:0034476]" IIDRGLR 0.95962 0 13.5038 0 0 0 0 0 13.5038 A0A2C9ULD8 HMA domain-containing protein MANES_14G100600 A0A2C9ULD8_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872] metal ion binding [GO:0046872] MTGTDSVSVNVLEK 0.98116 0 13.522 0 0 0 0 0 13.522 A0A2C9UKT1 USP domain-containing protein MANES_14G073700 A0A2C9UKT1_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein deubiquitination [GO:0016579] thiol-dependent deubiquitinase [GO:0004843];protein deubiquitination [GO:0016579] thiol-dependent deubiquitinase [GO:0004843] LEETLEYQR 0.9643 16.726 13.526 0 0 16.726 13.526 0 0 A0A2C9UY92 KH domain-containing protein MANES_11G036600 A0A2C9UY92_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] KTGPEIR 0.96253 0 13.5275 0 0 0 0 0 13.5275 A0A2C9W2M3 RING-type domain-containing protein MANES_04G146000 A0A2C9W2M3_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567];ubiquitin-dependent protein catabolic process [GO:0006511] cullin-RING ubiquitin ligase complex [GO:0031461];nucleus [GO:0005634] cullin-RING ubiquitin ligase complex [GO:0031461];nucleus [GO:0005634];cullin family protein binding [GO:0097602];ubiquitin protein ligase activity [GO:0061630];zinc ion binding [GO:0008270];protein ubiquitination [GO:0016567];ubiquitin-dependent protein catabolic process [GO:0006511] cullin family protein binding [GO:0097602];ubiquitin protein ligase activity [GO:0061630];zinc ion binding [GO:0008270] KWNAVALWAWDIVVDNCAICR 0.98473 0 13.5292 0 0 0 0 0 13.5292 A0A251K387 Uncharacterized protein MANES_09G018500 A0A251K387_MANES Manihot esculenta (Cassava) (Jatropha manihot) ASSSSSISRQLFLGMDR 0.9917 0 13.5427 0 0 0 0 13.5427 12.5332 A0A2C9W2J0 Uncharacterized protein MANES_04G098000 A0A2C9W2J0_MANES Manihot esculenta (Cassava) (Jatropha manihot) HQEKRNR 0.96912 0 13.5454 0 0 0 0 0 13.5454 A0A2C9VSP2 TIMELESS domain-containing protein MANES_06G155000 A0A2C9VSP2_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634] DNSHSLSNELADSTIFK 0.43333 0 13.5505 0 0 0 13.5505 0 0 A0A2C9U7N9 Uncharacterized protein MANES_17G106200 A0A2C9U7N9_MANES Manihot esculenta (Cassava) (Jatropha manihot) endocytosis [GO:0006897] endocytosis [GO:0006897] AAEPPPK 0.97803 0 13.5613 0 0 0 13.5613 0 0 A0A251KBB2 J domain-containing protein MANES_08G045600 A0A251KBB2_MANES Manihot esculenta (Cassava) (Jatropha manihot) YLGHNLVCPSCK 0.95561 0 13.5668 0 0 0 0 13.5668 0 A0A2C9U4F4 Pectin acetylesterase (EC 3.1.1.-) MANES_17G001900 A0A2C9U4F4_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall organization [GO:0071555] extracellular region [GO:0005576] extracellular region [GO:0005576];hydrolase activity [GO:0016787];cell wall organization [GO:0071555] hydrolase activity [GO:0016787] GMKNAQNAILSGCSAGGLAAILHCDRFK 0.38462 0 13.5682 0 0 0 0 13.5682 0 A0A2C9W9Y6 Potassium transporter MANES_02G015200 A0A2C9W9Y6_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];potassium ion transmembrane transporter activity [GO:0015079] potassium ion transmembrane transporter activity [GO:0015079] VEIKTPR 0.9637 0 13.5731 0 0 0 0 13.5731 0 A0A2C9VT45 Uncharacterized protein MANES_06G151100 A0A2C9VT45_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] STQSDCSNLLKKLESTR 1.0039 0 13.5766 0 0 0 0 0 13.5766 A0A2C9VL74 RNase H type-1 domain-containing protein MANES_07G054800 A0A2C9VL74_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleic acid binding [GO:0003676];RNA-DNA hybrid ribonuclease activity [GO:0004523] nucleic acid binding [GO:0003676];RNA-DNA hybrid ribonuclease activity [GO:0004523] QANNAAHFIASIALKDLNFLSNPLYQFHLL 1.005 0 13.577 0 0 0 0 0 13.577 A0A2C9VU54 Uncharacterized protein MANES_05G073000 A0A2C9VU54_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular response to salt stress [GO:0071472];protein ubiquitination [GO:0016567] cellular response to salt stress [GO:0071472];protein ubiquitination [GO:0016567] FEVDGEVFAAHK 0.96864 14.6078 13.5791 0 14.6078 0 0 0 13.5791 A0A2C9V3T1 Uncharacterized protein MANES_10G061100 A0A2C9V3T1_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein glycosylation [GO:0006486] endoplasmic reticulum [GO:0005783] endoplasmic reticulum [GO:0005783];mannosyltransferase activity [GO:0000030];protein glycosylation [GO:0006486] mannosyltransferase activity [GO:0000030] MLLEAAVMYDRR 0.95473 0 13.5793 0 0 0 0 13.5793 0 A0A2C9WQ86 BAG domain-containing protein MANES_01G250800 A0A2C9WQ86_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein folding [GO:0006457] chaperone binding [GO:0051087];protein folding [GO:0006457] chaperone binding [GO:0051087] LVEENEKMREMVEK 0.96116 0 13.5837 0 0 0 13.5837 0 0 A0A2C9VPS3 FAD-binding PCMH-type domain-containing protein MANES_06G059000 A0A2C9VPS3_MANES Manihot esculenta (Cassava) (Jatropha manihot) FAD binding [GO:0071949];oxidoreductase activity [GO:0016491] FAD binding [GO:0071949];oxidoreductase activity [GO:0016491] YFKHNFNR 0.9667 0 13.5861 0 0 0 13.5861 0 0 A0A2C9VHG8 LRRNT_2 domain-containing protein MANES_08G116000 A0A2C9VHG8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] PAWFVMMVEGYQKSR 0.98067 0 13.5879 0 0 0 0 0 13.5879 A0A251KRH4 Uncharacterized protein MANES_06G176900 A0A251KRH4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] KSGELGKMFDIPMDGSK 1.0023 0 13.597 0 0 0 13.597 0 0 A0A2C9U8X2 Uncharacterized protein MANES_16G045300 A0A2C9U8X2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] QNARPESLMMGK 0.95566 0 13.5983 0 0 0 0 13.5983 0 A0A199UA54 Uncharacterized protein MANES_S095800 A0A199UA54_MANES Manihot esculenta (Cassava) (Jatropha manihot) "acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]" "acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]" PNGDGEKAEAVVTGVQVNVFECGSVGIGLCVSHK 0.97522 0 13.6005 0 0 0 0 13.6005 0 A0A199UB19 Uncharacterized protein MANES_S042700 A0A199UB19_MANES Manihot esculenta (Cassava) (Jatropha manihot) EFIDLFNFCWFDMEILK 1 0 13.6014 0 0 0 13.6014 0 0 A0A2C9UPP8 Uncharacterized protein MANES_13G065900 A0A2C9UPP8_MANES Manihot esculenta (Cassava) (Jatropha manihot) NDPALDK 0.95607 0 13.6132 0 0 0 0 0 13.6132 A0A2C9U502 Uncharacterized protein MANES_17G045400 A0A2C9U502_MANES Manihot esculenta (Cassava) (Jatropha manihot) (1->3)-beta-D-glucan biosynthetic process [GO:0006075] "1,3-beta-D-glucan synthase complex [GO:0000148];integral component of membrane [GO:0016021]" "1,3-beta-D-glucan synthase complex [GO:0000148];integral component of membrane [GO:0016021];1,3-beta-D-glucan synthase activity [GO:0003843];(1->3)-beta-D-glucan biosynthetic process [GO:0006075]" "1,3-beta-D-glucan synthase activity [GO:0003843]" TVYDFEDFMNWIWFRGVLAK 0.96698 0 13.6134 0 0 0 0 0 13.6134 A0A2C9U3R6 NAC domain-containing protein MANES_17G016500 A0A2C9U3R6_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" "DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] VEPWELQERCRIGSTPQNEWYFFSHK 1.0192 0 13.6204 0 0 0 13.6204 0 0 A0A2C9UZE6 Uncharacterized protein MANES_11G079100 A0A2C9UZE6_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];zinc ion binding [GO:0008270] zinc ion binding [GO:0008270] ADSAKLCFLCDHQVHSANALSLK 0.99726 0 13.6287 0 0 0 13.6287 0 0 A0A2C9VYL4 Uncharacterized protein MANES_04G016500 A0A2C9VYL4_MANES Manihot esculenta (Cassava) (Jatropha manihot) RWNQMVK 0.96766 0 13.629 0 0 0 0 13.629 12.4329 A0A2C9WIQ0 RF_PROK_I domain-containing protein MANES_01G073500 A0A2C9WIQ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation release factor activity [GO:0003747] translation release factor activity [GO:0003747] IAKMAAIGEQKR 0.95307 0 13.6323 0 0 0 13.6323 0 0 A0A2C9VZU7 FAD-binding PCMH-type domain-containing protein MANES_04G057200 A0A2C9VZU7_MANES Manihot esculenta (Cassava) (Jatropha manihot) FAD binding [GO:0071949];iron ion binding [GO:0005506];iron-sulfur cluster binding [GO:0051536];oxidoreductase activity [GO:0016491] FAD binding [GO:0071949];iron ion binding [GO:0005506];iron-sulfur cluster binding [GO:0051536];oxidoreductase activity [GO:0016491] GERQEVNISGIPLYNHEICTFPAFLK 1.035 0 13.6371 0 0 0 0 13.6371 0 A0A2C9UN75 Uncharacterized protein MANES_13G016100 A0A2C9UN75_MANES Manihot esculenta (Cassava) (Jatropha manihot) FAD binding [GO:0071949] FAD binding [GO:0071949] LVSIHFFSR 0.97904 13.4742 13.6547 0 13.4742 0 0 13.6547 0 A0A2C9UTN5 "Ubiquinone biosynthesis O-methyltransferase, mitochondrial (3-demethylubiquinol 3-O-methyltransferase) (EC 2.1.1.64) (Polyprenyldihydroxybenzoate methyltransferase) (EC 2.1.1.114)" COQ3 MANES_12G048800 A0A2C9UTN5_MANES Manihot esculenta (Cassava) (Jatropha manihot) methylation [GO:0032259];ubiquinone biosynthetic process [GO:0006744] extrinsic component of mitochondrial inner membrane [GO:0031314] "extrinsic component of mitochondrial inner membrane [GO:0031314];2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity [GO:0008425];3-demethylubiquinone-9 3-O-methyltransferase activity [GO:0008689];hexaprenyldihydroxybenzoate methyltransferase activity [GO:0004395];methylation [GO:0032259];ubiquinone biosynthetic process [GO:0006744]" "2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity [GO:0008425];3-demethylubiquinone-9 3-O-methyltransferase activity [GO:0008689];hexaprenyldihydroxybenzoate methyltransferase activity [GO:0004395]" ASINVKEMAGFVYNPLTGR 1.0108 0 13.6573 0 0 0 0 13.6573 0 A0A2C9VMZ7 RNA helicase (EC 3.6.4.13) MANES_06G049200 A0A2C9VMZ7_MANES Manihot esculenta (Cassava) (Jatropha manihot) "maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463]" nucleolus [GO:0005730] "nucleolus [GO:0005730];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];RNA binding [GO:0003723];RNA helicase activity [GO:0003724];maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463]" ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];RNA binding [GO:0003723];RNA helicase activity [GO:0003724] ELGEEDLK 0.96999 0 13.6577 0 0 0 13.6577 0 0 A0A2C9V6E5 AB hydrolase-1 domain-containing protein MANES_10G105700 A0A2C9V6E5_MANES Manihot esculenta (Cassava) (Jatropha manihot) VPNLDEAANILLPQTPEK 0.95896 0 13.6619 0 0 0 0 0 13.6619 A0A2C9UGA0 C2H2-type domain-containing protein MANES_15G155700 A0A2C9UGA0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] EFYDEKYLDK 0.95221 12.6919 13.6624 0 12.6919 0 13.6624 0 0 A0A199UC41 Uncharacterized protein MANES_S036600 A0A199UC41_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] LRDCDELIELPK 0.9552 0 13.6667 0 0 0 0 0 13.6667 A0A251L522 Exonuclease domain-containing protein MANES_04G156500 A0A251L522_MANES Manihot esculenta (Cassava) (Jatropha manihot) "exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000467]" "3'-5'-exoribonuclease activity [GO:0000175];nucleic acid binding [GO:0003676];exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000467]" 3'-5'-exoribonuclease activity [GO:0000175];nucleic acid binding [GO:0003676] MMALENK 0.97992 0 13.67 0 0 0 13.67 0 0 A0A2C9UYN2 Uncharacterized protein MANES_11G049500 A0A2C9UYN2_MANES Manihot esculenta (Cassava) (Jatropha manihot) DAMHQSIIYKEQMR 0.96106 0 13.6739 0 0 0 13.6739 0 0 A0A251LF15 1-phosphatidylinositol 4-kinase (EC 2.7.1.67) MANES_02G060500 A0A251LF15_MANES Manihot esculenta (Cassava) (Jatropha manihot) 1-phosphatidylinositol 4-kinase activity [GO:0004430] 1-phosphatidylinositol 4-kinase activity [GO:0004430] DSDMLRRELPMIR 0.96226 0 13.6821 0 0 0 0 0 13.6821 A0A251KR69 Protein kinase domain-containing protein MANES_06G166700 A0A251KR69_MANES Manihot esculenta (Cassava) (Jatropha manihot) cortical microtubule organization [GO:0043622];lateral root formation [GO:0010311];negative regulation of ethylene biosynthetic process [GO:0010366] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];cortical microtubule organization [GO:0043622];lateral root formation [GO:0010311];negative regulation of ethylene biosynthetic process [GO:0010366] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] KNPEHRPTAAELLR 0.96467 0 13.6821 0 0 0 0 0 13.6821 A0A2C9VUP0 Epimerase domain-containing protein MANES_05G045600 A0A2C9VUP0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]" "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]" PHPEHKR 0.95561 14.0278 13.6824 12.627 14.0278 0 0 13.6824 12.7487 A0A2C9VTQ6 Uncharacterized protein MANES_05G058900 A0A2C9VTQ6_MANES Manihot esculenta (Cassava) (Jatropha manihot) MIVPSSSSTNSGLHPSNRMMETLSIQVK 0.95412 0 13.6872 0 0 0 0 0 13.6872 A0A251JYB6 Uncharacterized protein MANES_10G052700 A0A251JYB6_MANES Manihot esculenta (Cassava) (Jatropha manihot) WGNKLLLLGGHSKK 0.96212 0 13.6956 0 0 0 0 13.6956 0 A0A2C9W0T7 CASP-like protein MANES_04G090700 A0A2C9W0T7_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] "integral component of membrane [GO:0016021];plasma membrane [GO:0005886];4 iron, 4 sulfur cluster binding [GO:0051539]" "4 iron, 4 sulfur cluster binding [GO:0051539]" LMIRPTD 0.97842 0 13.7022 0 0 0 13.7022 0 0 A0A2C9VJN6 Uncharacterized protein MANES_07G086200 A0A2C9VJN6_MANES Manihot esculenta (Cassava) (Jatropha manihot) exocytosis [GO:0006887] exocyst [GO:0000145] exocyst [GO:0000145];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];exocytosis [GO:0006887] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] VVSSVSHK 0.96992 16.9113 13.7041 16.9113 0 0 0 0 13.7041 A0A251JS59 Uncharacterized protein MANES_11G034200 A0A251JS59_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524] ABC-type transporter activity [GO:0140359];ATP binding [GO:0005524] ISGFTKK 0.9556 12.362 13.705 0 0 12.362 13.705 0 0 A0A2C9VSE1 Pectin acetylesterase (EC 3.1.1.-) MANES_06G148800 A0A2C9VSE1_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall organization [GO:0071555] extracellular region [GO:0005576] extracellular region [GO:0005576];pectin acetylesterase activity [GO:0052793];cell wall organization [GO:0071555] pectin acetylesterase activity [GO:0052793] GFGAGAR 0.9526 0 13.7074 0 0 0 0 13.7074 0 A0A2C9WKV2 Uncharacterized protein MANES_01G062700 A0A2C9WKV2_MANES Manihot esculenta (Cassava) (Jatropha manihot) copper ion homeostasis [GO:0055070] integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];ATP binding [GO:0005524];copper ion binding [GO:0005507];P-type divalent copper transporter activity [GO:0043682];copper ion homeostasis [GO:0055070] ATP binding [GO:0005524];copper ion binding [GO:0005507];P-type divalent copper transporter activity [GO:0043682] QEEIKQYYR 0.95955 0 13.7115 0 0 0 13.7115 0 0 A0A140H8T7 WRKY transcription factor 83 MANES_07G142400 A0A140H8T7_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] SEDSGESK 0.99011 0 13.7213 0 0 0 0 0 13.7213 A0A2C9VQK5 Uncharacterized protein MANES_06G137600 A0A2C9VQK5_MANES Manihot esculenta (Cassava) (Jatropha manihot) GTCPNFNSVFR 0.9992 0 13.7232 0 0 0 0 0 13.7232 A0A2C9VJP2 Glycine cleavage system H protein MANES_07G087900 A0A2C9VJP2_MANES Manihot esculenta (Cassava) (Jatropha manihot) glycine decarboxylation via glycine cleavage system [GO:0019464];protein lipoylation [GO:0009249] cytoplasm [GO:0005737];glycine cleavage complex [GO:0005960];mitochondrion [GO:0005739] cytoplasm [GO:0005737];glycine cleavage complex [GO:0005960];mitochondrion [GO:0005739];glycine decarboxylation via glycine cleavage system [GO:0019464];protein lipoylation [GO:0009249] NLKDSDEYVKFCEEEDGK 1.0026 0 13.7263 0 0 0 0 13.7263 0 A0A2C9UX94 AAA domain-containing protein MANES_11G011400 A0A2C9UX94_MANES Manihot esculenta (Cassava) (Jatropha manihot) proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161] "cytoplasm [GO:0005737];nucleus [GO:0005634];proteasome regulatory particle, base subcomplex [GO:0008540]" "cytoplasm [GO:0005737];nucleus [GO:0005634];proteasome regulatory particle, base subcomplex [GO:0008540];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];proteasome-activating activity [GO:0036402];proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]" ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];proteasome-activating activity [GO:0036402] TVTEKDFLDAVNK 0.96992 0 13.7276 0 0 0 0 13.7276 0 A0A2C9WCM5 Uncharacterized protein MANES_02G026800 A0A2C9WCM5_MANES Manihot esculenta (Cassava) (Jatropha manihot) brassinosteroid biosynthetic process [GO:0016132];brassinosteroid homeostasis [GO:0010268];sterol metabolic process [GO:0016125] "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity [GO:0016491];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705];brassinosteroid biosynthetic process [GO:0016132];brassinosteroid homeostasis [GO:0010268];sterol metabolic process [GO:0016125]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity [GO:0016491];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" TPGLQFPDGYHVKIMEK 0.99089 0 13.7312 0 0 0 0 0 13.7312 A0A2C9WCG2 Uncharacterized protein MANES_02G096200 A0A2C9WCG2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] EMSQRNQEAVEMARR 0.97772 0 13.7323 0 0 0 0 13.7323 0 A0A2C9UA49 DWNN domain-containing protein MANES_16G090800 A0A2C9UA49_MANES Manihot esculenta (Cassava) (Jatropha manihot) mRNA processing [GO:0006397];protein ubiquitination [GO:0016567];ubiquitin-dependent protein catabolic process [GO:0006511] nucleus [GO:0005634] nucleus [GO:0005634];nucleic acid binding [GO:0003676];ubiquitin protein ligase activity [GO:0061630];zinc ion binding [GO:0008270];mRNA processing [GO:0006397];protein ubiquitination [GO:0016567];ubiquitin-dependent protein catabolic process [GO:0006511] nucleic acid binding [GO:0003676];ubiquitin protein ligase activity [GO:0061630];zinc ion binding [GO:0008270] QQPLSVSCRTGSSSSNTSSKTVVTASSR 1.0591 0 13.7326 0 0 0 0 0 13.7326 A0A2C9UAC4 Uncharacterized protein MANES_16G065800 A0A2C9UAC4_MANES Manihot esculenta (Cassava) (Jatropha manihot) diterpenoid biosynthetic process [GO:0016102];gibberellin biosynthetic process [GO:0009686];hydrocarbon biosynthetic process [GO:0120251] chloroplast [GO:0009507] chloroplast [GO:0009507];magnesium ion binding [GO:0000287];terpene synthase activity [GO:0010333];diterpenoid biosynthetic process [GO:0016102];gibberellin biosynthetic process [GO:0009686];hydrocarbon biosynthetic process [GO:0120251] magnesium ion binding [GO:0000287];terpene synthase activity [GO:0010333] IESRRYMENYHLDNVSLLK 0.97341 0 13.7328 0 0 0 0 13.7328 0 A0A2C9VUN6 Uncharacterized protein MANES_05G090900 A0A2C9VUN6_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];hydrolase activity [GO:0016787];mRNA binding [GO:0003729];RNA binding [GO:0003723];RNA helicase activity [GO:0003724] ATP binding [GO:0005524];hydrolase activity [GO:0016787];mRNA binding [GO:0003729];RNA binding [GO:0003723];RNA helicase activity [GO:0003724] WVEVTVDTQVDK 0.95674 16.0514 13.7338 0 16.0514 0 0 13.7338 0 A0A2C9W629 LEA_2 domain-containing protein MANES_03G048200 A0A2C9W629_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] LGIRVTCEGFK 0.95459 0 13.7349 0 0 0 0 13.7349 0 A0A2C9V9G6 Uncharacterized protein MANES_09G050800 A0A2C9V9G6_MANES Manihot esculenta (Cassava) (Jatropha manihot) CKEMLSAR 0.95871 0 13.7353 0 0 0 13.7353 0 0 A0A199UCA0 NAC domain-containing protein MANES_S015700 A0A199UCA0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" "DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] KKTLVFYK 0.96368 0 13.736 0 0 0 0 13.736 0 A0A2C9VDK9 Epimerase domain-containing protein MANES_09G179000 A0A2C9VDK9_MANES Manihot esculenta (Cassava) (Jatropha manihot) rRNA processing [GO:0006364] cytosol [GO:0005829] cytosol [GO:0005829];catalytic activity [GO:0003824];RNA binding [GO:0003723];rRNA processing [GO:0006364] catalytic activity [GO:0003824];RNA binding [GO:0003723] FIGVFLSR 0.96253 0 13.741 0 0 0 0 0 13.741 A0A2C9V7J8 Uncharacterized protein MANES_10G119600 A0A2C9V7J8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];DNA-binding transcription factor activity [GO:0003700] DNA-binding transcription factor activity [GO:0003700] EEVVHGFRR 0.97927 0 13.7458 0 0 0 13.7458 0 0 B1NWG2 Chloroplast envelope membrane protein cemA CEMA_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast inner membrane [GO:0009706];integral component of membrane [GO:0016021] chloroplast inner membrane [GO:0009706];integral component of membrane [GO:0016021];proton transmembrane transporter activity [GO:0015078] proton transmembrane transporter activity [GO:0015078] VSPSLVVIYHSMND 0.98 0 13.746 0 0 0 0 0 13.746 B1NWI7 "50S ribosomal protein L16, chloroplastic" rpl16 RK16_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] chloroplast [GO:0009507];ribosome [GO:0005840] chloroplast [GO:0009507];ribosome [GO:0005840];rRNA binding [GO:0019843];structural constituent of ribosome [GO:0003735];translation [GO:0006412] rRNA binding [GO:0019843];structural constituent of ribosome [GO:0003735] PTETRMGSGK 1.0109 0 13.7476 0 0 0 0 9.93241 13.7476 A0A2C9VBH3 Uncharacterized protein MANES_09G168900 A0A2C9VBH3_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];transcription corepressor activity [GO:0003714] transcription corepressor activity [GO:0003714] LSRVREMR 0.96367 0 13.7556 0 0 0 0 13.7556 0 A0A2C9VHR1 Nuclear proteasome inhibitor UBLCP1 (EC 3.1.3.16) MANES_07G021300 A0A2C9VHR1_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];protein serine phosphatase activity [GO:0106306];protein threonine phosphatase activity [GO:0106307] protein serine phosphatase activity [GO:0106306];protein threonine phosphatase activity [GO:0106307] WSGKEYTVR 0.95605 0 13.757 0 0 0 0 0 13.757 A0A2C9UTV4 VOC domain-containing protein MANES_12G054100 A0A2C9UTV4_MANES Manihot esculenta (Cassava) (Jatropha manihot) MAQQEVQNGGSAK 0.95871 0 13.76 0 0 0 0 0 13.76 A0A2C9V588 Uncharacterized protein MANES_10G043600 A0A2C9V588_MANES Manihot esculenta (Cassava) (Jatropha manihot) KSVDKYDFPMK 0.95426 0 13.7613 0 0 0 13.7613 0 0 A0A2C9V533 SHSP domain-containing protein MANES_10G105900 A0A2C9V533_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein complex oligomerization [GO:0051259];protein folding [GO:0006457];response to heat [GO:0009408];response to hydrogen peroxide [GO:0042542];response to salt stress [GO:0009651] protein self-association [GO:0043621];unfolded protein binding [GO:0051082];protein complex oligomerization [GO:0051259];protein folding [GO:0006457];response to heat [GO:0009408];response to hydrogen peroxide [GO:0042542];response to salt stress [GO:0009651] protein self-association [GO:0043621];unfolded protein binding [GO:0051082] QFRLPNNADLDHIK 0.97616 0 13.7639 0 0 0 0 13.7639 0 A0A2C9UFR2 Uncharacterized protein MANES_15G100900 A0A2C9UFR2_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein deubiquitination [GO:0016579];ubiquitin-dependent protein catabolic process [GO:0006511] cytosol [GO:0005829];integral component of membrane [GO:0016021];nucleus [GO:0005634] cytosol [GO:0005829];integral component of membrane [GO:0016021];nucleus [GO:0005634];cysteine-type endopeptidase activity [GO:0004197];metal ion binding [GO:0046872];thiol-dependent deubiquitinase [GO:0004843];protein deubiquitination [GO:0016579];ubiquitin-dependent protein catabolic process [GO:0006511] cysteine-type endopeptidase activity [GO:0004197];metal ion binding [GO:0046872];thiol-dependent deubiquitinase [GO:0004843] SCPRLQREFYEK 0.95481 0 13.7684 0 0 0 0 0 13.7684 A0A2C9UEH0 Epimerase domain-containing protein MANES_15G034700 A0A2C9UEH0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "GDP-mannose 3,5-epimerase activity [GO:0047918];NAD binding [GO:0051287]" "GDP-mannose 3,5-epimerase activity [GO:0047918];NAD binding [GO:0051287]" SEGHYIIASDWKKNEQYDR 0.9963 0 13.7708 0 0 0 0 13.7708 13.1576 A0A2C9VSF9 Tubulin beta chain MANES_06G147900 A0A2C9VSF9_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule cytoskeleton organization [GO:0000226];mitotic cell cycle [GO:0000278] cytoplasm [GO:0005737];microtubule [GO:0005874] cytoplasm [GO:0005737];microtubule [GO:0005874];GTP binding [GO:0005525];GTPase activity [GO:0003924];structural constituent of cytoskeleton [GO:0005200];microtubule cytoskeleton organization [GO:0000226];mitotic cell cycle [GO:0000278] GTPase activity [GO:0003924];GTP binding [GO:0005525];structural constituent of cytoskeleton [GO:0005200] VNVYYNEASCGRYVPR 0.95865 0 13.7776 0 0 0 13.7776 0 0 A0A2C9U487 Receptor-like serine/threonine-protein kinase (EC 2.7.11.1) MANES_17G032400 A0A2C9U487_MANES Manihot esculenta (Cassava) (Jatropha manihot) recognition of pollen [GO:0048544] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];recognition of pollen [GO:0048544] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] YFSEGPNSYFMYTPSNISELVRFHLQWDGIEK 1.0168 0 13.7802 0 0 0 13.7802 0 0 A0A2C9VSM2 Uncharacterized protein MANES_06G155800 A0A2C9VSM2_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial cytochrome c oxidase assembly [GO:0033617] mitochondrion [GO:0005739] mitochondrion [GO:0005739];mitochondrial cytochrome c oxidase assembly [GO:0033617] SPCIPSECVGLRETYFNCK 1.0048 13.1014 13.7894 13.1014 0 0 0 0 13.7894 A0A2C9WM71 Uncharacterized protein MANES_01G142800 A0A2C9WM71_MANES Manihot esculenta (Cassava) (Jatropha manihot) Cdc73/Paf1 complex [GO:0016593] Cdc73/Paf1 complex [GO:0016593];DNA binding [GO:0003677];metal ion binding [GO:0046872];RNA polymerase II C-terminal domain phosphoserine binding [GO:1990269] DNA binding [GO:0003677];metal ion binding [GO:0046872];RNA polymerase II C-terminal domain phosphoserine binding [GO:1990269] HSDGGLK 0.96993 0 13.7914 0 0 0 0 0 13.7914 A0A2C9UBI8 Uncharacterized protein MANES_15G002800 A0A2C9UBI8_MANES Manihot esculenta (Cassava) (Jatropha manihot) ISFGWYLR 0.96893 0 13.7919 0 0 0 0 0 13.7919 A0A2C9VBM4 S-acyltransferase (EC 2.3.1.225) (Palmitoyltransferase) MANES_09G172800 A0A2C9VBM4_MANES Manihot esculenta (Cassava) (Jatropha manihot) peptidyl-L-cysteine S-palmitoylation [GO:0018230];protein targeting to membrane [GO:0006612] endoplasmic reticulum [GO:0005783];Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] endoplasmic reticulum [GO:0005783];Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];protein-cysteine S-palmitoyltransferase activity [GO:0019706];peptidyl-L-cysteine S-palmitoylation [GO:0018230];protein targeting to membrane [GO:0006612] protein-cysteine S-palmitoyltransferase activity [GO:0019706] HTNRDQK 0.96293 11.5612 13.7962 11.5612 0 0 0 0 13.7962 A0A251L0I0 NB-ARC domain-containing protein MANES_04G039900 A0A251L0I0_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] KLSAIQRR 0.98081 10.9592 13.7964 10.9592 0 0 0 0 13.7964 A0A2C9W2G9 Phospholipid-transporting ATPase (EC 7.6.2.1) MANES_04G141200 A0A2C9W2G9_MANES Manihot esculenta (Cassava) (Jatropha manihot) phospholipid translocation [GO:0045332] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];ATPase-coupled intramembrane lipid transporter activity [GO:0140326];magnesium ion binding [GO:0000287];phospholipid translocation [GO:0045332] ATPase-coupled intramembrane lipid transporter activity [GO:0140326];ATP binding [GO:0005524];magnesium ion binding [GO:0000287] KGRMYEETTTK 0.95403 0 13.7999 0 0 0 0 13.7999 0 A0A2C9UMR8 START domain-containing protein MANES_14G140000 A0A2C9UMR8_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid binding [GO:0008289] lipid binding [GO:0008289] GKYVEMYKR 0.956 0 13.8111 0 0 0 0 13.8111 0 A0A251K844 GTD-binding domain-containing protein MANES_09G150400 A0A251K844_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];myosin XI tail binding [GO:0080115] myosin XI tail binding [GO:0080115] DTKEHISEMKTK 0.95286 0 13.8146 0 0 0 0 13.8146 0 A0A2C9V8G3 Uncharacterized protein MANES_09G059000 A0A2C9V8G3_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634] DSTSEPSEVAQTK 0.9322 0 13.8194 0 0 0 0 13.8194 0 A0A2C9VGC1 "Chlorophyll a-b binding protein, chloroplastic" MANES_08G091700 A0A2C9VGC1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "photosynthesis, light harvesting in photosystem I [GO:0009768];protein-chromophore linkage [GO:0018298];response to light stimulus [GO:0009416]" chloroplast thylakoid membrane [GO:0009535];photosystem I [GO:0009522];photosystem II [GO:0009523] "chloroplast thylakoid membrane [GO:0009535];photosystem I [GO:0009522];photosystem II [GO:0009523];chlorophyll binding [GO:0016168];photosynthesis, light harvesting in photosystem I [GO:0009768];protein-chromophore linkage [GO:0018298];response to light stimulus [GO:0009416]" chlorophyll binding [GO:0016168] LYPGGSFFDPLGLAADPEK 0.96315 0 13.8196 0 0 0 0 13.8196 0 A0A2C9W1S3 RNase H type-1 domain-containing protein MANES_04G073100 A0A2C9W1S3_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleic acid binding [GO:0003676];RNA-DNA hybrid ribonuclease activity [GO:0004523] nucleic acid binding [GO:0003676];RNA-DNA hybrid ribonuclease activity [GO:0004523] GAVGTVFRDNECR 0.97412 0 13.8202 0 0 0 0 13.8202 13.1443 A0A2C9V4S7 LOB domain-containing protein MANES_10G027400 A0A2C9V4S7_MANES Manihot esculenta (Cassava) (Jatropha manihot) "hormone-mediated signaling pathway [GO:0009755];positive regulation of transcription, DNA-templated [GO:0045893]" nucleus [GO:0005634] "nucleus [GO:0005634];hormone-mediated signaling pathway [GO:0009755];positive regulation of transcription, DNA-templated [GO:0045893]" LLEGADQEVFPYCSWLDTGN 0.95907 0 13.8204 0 0 0 13.8204 0 0 A0A2C9W5T3 Calpain catalytic domain-containing protein MANES_03G087600 A0A2C9W5T3_MANES Manihot esculenta (Cassava) (Jatropha manihot) proteolysis [GO:0006508] cytoplasm [GO:0005737];integral component of membrane [GO:0016021] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];calcium-dependent cysteine-type endopeptidase activity [GO:0004198];proteolysis [GO:0006508] calcium-dependent cysteine-type endopeptidase activity [GO:0004198] ELTSLLQDK 0.96163 0 13.8216 0 0 0 0 13.8216 0 A0A2C9U1M0 F-box domain-containing protein MANES_18G080800 A0A2C9U1M0_MANES Manihot esculenta (Cassava) (Jatropha manihot) SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146] ubiquitin-protein transferase activity [GO:0004842];SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146] ubiquitin-protein transferase activity [GO:0004842] SLHRFSCVCRDWK 0.95397 0 13.8233 0 0 0 0 13.8233 0 A0A2C9UAZ1 Dolichyl-diphosphooligosaccharide--protein glycotransferase (EC 2.4.99.18) MANES_16G110700 A0A2C9UAZ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein glycosylation [GO:0006486] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];dolichyl-diphosphooligosaccharide-protein glycotransferase activity [GO:0004579];metal ion binding [GO:0046872];protein glycosylation [GO:0006486] dolichyl-diphosphooligosaccharide-protein glycotransferase activity [GO:0004579];metal ion binding [GO:0046872] SKSVCMKVECCNYIFDIA 0.97508 0 13.8281 0 0 0 0 13.8281 0 A0A2C9V4C9 Arginyl-tRNA--protein transferase (EC 2.3.2.8) MANES_10G013900 A0A2C9V4C9_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein arginylation [GO:0016598] cytoplasm [GO:0005737] cytoplasm [GO:0005737];arginyltransferase activity [GO:0004057];protein arginylation [GO:0016598] arginyltransferase activity [GO:0004057] YEWVPFNIASPLLDRK 0.97618 0 13.8297 0 0 0 0 13.8297 0 A0A2C9USW0 CCT-epsilon (T-complex protein 1 subunit epsilon) MANES_12G019200 A0A2C9USW0_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein folding [GO:0006457] chaperonin-containing T-complex [GO:0005832] chaperonin-containing T-complex [GO:0005832];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];unfolded protein binding [GO:0051082];protein folding [GO:0006457] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];unfolded protein binding [GO:0051082] FQTLRKQEQQYFDDMVQK 0.97473 0 13.8358 0 0 0 0 13.8358 0 A0A2C9WMH1 Uncharacterized protein MANES_01G152900 A0A2C9WMH1_MANES Manihot esculenta (Cassava) (Jatropha manihot) maturation of LSU-rRNA [GO:0000470] 90S preribosome [GO:0030686] 90S preribosome [GO:0030686];RNA binding [GO:0003723];maturation of LSU-rRNA [GO:0000470] RNA binding [GO:0003723] IIPLLPK 0.96908 15.2053 13.8432 14.7322 14.6905 15.2053 13.8432 13.567 12.0013 A0A2C9VTX4 Uncharacterized protein MANES_05G017500 A0A2C9VTX4_MANES Manihot esculenta (Cassava) (Jatropha manihot) LDELEQRLK 0.95947 0 13.8477 0 0 0 0 0 13.8477 A0A2C9WE46 Valyl-tRNA synthetase (EC 6.1.1.9) MANES_02G076200 A0A2C9WE46_MANES Manihot esculenta (Cassava) (Jatropha manihot) valyl-tRNA aminoacylation [GO:0006438] cytosol [GO:0005829] cytosol [GO:0005829];aminoacyl-tRNA editing activity [GO:0002161];ATP binding [GO:0005524];valine-tRNA ligase activity [GO:0004832];valyl-tRNA aminoacylation [GO:0006438] aminoacyl-tRNA editing activity [GO:0002161];ATP binding [GO:0005524];valine-tRNA ligase activity [GO:0004832] RCFPFSHWR 0.9805 0 13.8495 0 0 0 0 13.8495 0 A0A2C9UWJ6 Uncharacterized protein MANES_12G140600 A0A2C9UWJ6_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein import into nucleus [GO:0006606] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];nuclear import signal receptor activity [GO:0061608];nuclear localization sequence binding [GO:0008139];protein import into nucleus [GO:0006606] nuclear import signal receptor activity [GO:0061608];nuclear localization sequence binding [GO:0008139] LLLLKLST 0.95814 0 13.8539 0 0 0 0 13.8539 0 A0A2C9WIT6 AAA domain-containing protein MANES_01G035500 A0A2C9WIT6_MANES Manihot esculenta (Cassava) (Jatropha manihot) ADP binding [GO:0043531] ADP binding [GO:0043531] ETEDLCLDEVR 0.96813 0 13.8546 0 0 0 0 13.8546 0 A0A2C9UW98 Uncharacterized protein MANES_12G137400 A0A2C9UW98_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein polymerization [GO:0051258] plasma membrane [GO:0005886] plasma membrane [GO:0005886];protein polymerization [GO:0051258] LEEEEVQEECK 0.99759 0 13.8548 0 0 0 13.8548 0 0 A0A2C9UWH9 Uncharacterized protein MANES_12G102700 A0A2C9UWH9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] LIDSCLNK 0.96921 0 13.8674 0 0 0 13.8674 0 0 A0A2C9V2M0 NB-ARC domain-containing protein MANES_10G028400 A0A2C9V2M0_MANES Manihot esculenta (Cassava) (Jatropha manihot) ADP binding [GO:0043531] ADP binding [GO:0043531] TWHTQLPEGSFCKLNSLRIQDCK 0.96133 0 13.8713 0 0 0 0 13.8713 0 A0A2C9V3Z8 Uncharacterized protein MANES_10G067200 A0A2C9V3Z8_MANES Manihot esculenta (Cassava) (Jatropha manihot) EQRPTPMVNQSNR 0.97149 0 13.873 0 0 0 0 13.873 0 A0A251KC79 Uncharacterized protein MANES_08G089000 A0A251KC79_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565];regulation of transcription, DNA-templated [GO:0006355]" DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] CATDKVR 0.97877 0 13.8733 0 0 0 0 0 13.8733 A0A2C9WII4 Uncharacterized protein MANES_01G073000 A0A2C9WII4_MANES Manihot esculenta (Cassava) (Jatropha manihot) CEANYASFNVLNELTWEEVLNK 0.97931 0 13.8756 0 0 0 0 13.8756 0 A0A2C9WGW8 O-fucosyltransferase family protein MANES_02G195300 A0A2C9WGW8_MANES Manihot esculenta (Cassava) (Jatropha manihot) fucose metabolic process [GO:0006004] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];transferase activity [GO:0016740];fucose metabolic process [GO:0006004] transferase activity [GO:0016740] LRCLSNFQALRFSEPIR 0.9742 0 13.8894 0 0 0 0 0 13.8894 A0A2C9U7G0 Glycosyltransferase (EC 2.4.1.-) MANES_17G122700 A0A2C9U7G0_MANES Manihot esculenta (Cassava) (Jatropha manihot) anthocyanin-containing compound biosynthetic process [GO:0009718] anthocyanidin 3-O-glucosyltransferase activity [GO:0047213];anthocyanin-containing compound biosynthetic process [GO:0009718] anthocyanidin 3-O-glucosyltransferase activity [GO:0047213] GPPFELLLK 0.96267 0 13.8929 0 0 0 0 0 13.8929 A0A2C9U1A4 Uncharacterized protein MANES_18G068600 A0A2C9U1A4_MANES Manihot esculenta (Cassava) (Jatropha manihot) QMGSEISSEPTSPK 0.97992 0 13.9013 0 0 0 0 0 13.9013 A0A2C9UEX8 Uncharacterized protein MANES_15G078900 A0A2C9UEX8_MANES Manihot esculenta (Cassava) (Jatropha manihot) diterpenoid biosynthetic process [GO:0016102];hydrocarbon biosynthetic process [GO:0120251] magnesium ion binding [GO:0000287];terpene synthase activity [GO:0010333];diterpenoid biosynthetic process [GO:0016102];hydrocarbon biosynthetic process [GO:0120251] magnesium ion binding [GO:0000287];terpene synthase activity [GO:0010333] TFLNVYTEIEKNLFDQGRLYR 0.97674 0 13.9033 0 0 0 0 0 13.9033 A0A2C9UG72 Kinesin motor domain-containing protein MANES_15G144100 A0A2C9UG72_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777] DMESLVLASHVKEMFIEK 0.97015 0 13.9053 0 0 0 0 13.9053 0 A0A2C9UEV0 SEC7 domain-containing protein MANES_15G114000 A0A2C9UEV0_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein transport [GO:0015031];regulation of ARF protein signal transduction [GO:0032012] cytosol [GO:0005829];membrane [GO:0016020];trans-Golgi network [GO:0005802] cytosol [GO:0005829];membrane [GO:0016020];trans-Golgi network [GO:0005802];guanyl-nucleotide exchange factor activity [GO:0005085];protein transport [GO:0015031];regulation of ARF protein signal transduction [GO:0032012] guanyl-nucleotide exchange factor activity [GO:0005085] CLVGIIKSMGAWMDQQLR 0.97181 0 13.9053 0 0 0 0 13.9053 0 A0A2C9UAY8 Uncharacterized protein MANES_16G124800 A0A2C9UAY8_MANES Manihot esculenta (Cassava) (Jatropha manihot) "post-embryonic development [GO:0009791];regulation of transcription, DNA-templated [GO:0006355];reproductive structure development [GO:0048608];shoot system development [GO:0048367]" "post-embryonic development [GO:0009791];regulation of transcription, DNA-templated [GO:0006355];reproductive structure development [GO:0048608];shoot system development [GO:0048367]" VLSDTFMKNWESK 0.9741 0 13.9063 0 0 0 0 13.9063 0 A0A2C9V2M4 Uncharacterized protein MANES_11G148700 A0A2C9V2M4_MANES Manihot esculenta (Cassava) (Jatropha manihot) EYQFNEEVKFQER 0.9699 0 13.9083 0 0 0 0 0 13.9083 A0A2C9WI25 SnoaL-like domain-containing protein MANES_01G058300 A0A2C9WI25_MANES Manihot esculenta (Cassava) (Jatropha manihot) VVVESPIK 0.97 0 13.9084 0 0 0 0 13.9084 0 A0A2C9VF13 ML domain-containing protein MANES_08G035400 A0A2C9VF13_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular sterol transport [GO:0032366];sterol transport [GO:0015918] sterol binding [GO:0032934];intracellular sterol transport [GO:0032366];sterol transport [GO:0015918] sterol binding [GO:0032934] GVEISPNPVVR 0.9984 0 13.9107 0 0 0 0 13.9107 0 A0A2C9TZR0 Phospholipase D (EC 3.1.4.4) MANES_18G009000 A0A2C9TZR0_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphatidylcholine metabolic process [GO:0046470];phospholipid catabolic process [GO:0009395] plasma membrane [GO:0005886] plasma membrane [GO:0005886];calcium ion binding [GO:0005509];N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290];phospholipase D activity [GO:0004630];phosphatidylcholine metabolic process [GO:0046470];phospholipid catabolic process [GO:0009395] calcium ion binding [GO:0005509];N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290];phospholipase D activity [GO:0004630] GMIVDDEYVILGSANINQR 1.0658 0 13.9109 0 0 0 0 13.9109 12.9272 A0A2C9UEL3 Phosphoenolpyruvate carboxylase (EC 4.1.1.31) MANES_15G093700 A0A2C9UEL3_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbon fixation [GO:0015977];leaf development [GO:0048366];tricarboxylic acid cycle [GO:0006099] cytosol [GO:0005829] cytosol [GO:0005829];phosphoenolpyruvate carboxylase activity [GO:0008964];carbon fixation [GO:0015977];leaf development [GO:0048366];tricarboxylic acid cycle [GO:0006099] phosphoenolpyruvate carboxylase activity [GO:0008964] DSYITTLNVCQVYTLK 0.9849 13.1423 13.9153 0 0 13.1423 13.0238 13.9153 0 A0A2C9W8Z9 Beta-galactosidase (EC 3.2.1.23) MANES_03G145400 A0A2C9W8Z9_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] apoplast [GO:0048046];vacuole [GO:0005773] apoplast [GO:0048046];vacuole [GO:0005773];beta-galactosidase activity [GO:0004565];carbohydrate binding [GO:0030246];carbohydrate metabolic process [GO:0005975] beta-galactosidase activity [GO:0004565];carbohydrate binding [GO:0030246] VWSEKNFTVEGILEHLNVTKDYSDYLWYFTR 0.90789 0 13.9164 0 0 0 0 0 13.9164 A0A2C9VZ90 Uncharacterized protein MANES_05G161800 A0A2C9VZ90_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] MSDVSTNIEESSLEAKTLDK 1.0141 0 13.9208 0 0 0 0 0 13.9208 A0A2C9W6Y4 Protein kinase domain-containing protein MANES_03G126400 A0A2C9W6Y4_MANES Manihot esculenta (Cassava) (Jatropha manihot) hormone-mediated signaling pathway [GO:0009755] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];protein kinase activity [GO:0004672];hormone-mediated signaling pathway [GO:0009755] ATP binding [GO:0005524];protein kinase activity [GO:0004672] TNGAAPK 0.95391 0 13.9211 0 0 0 0 13.9211 12.615 A0A2C9U1N9 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) MANES_18G059500 A0A2C9U1N9_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrion [GO:0005739] mitochondrion [GO:0005739];carbonate dehydratase activity [GO:0004089];zinc ion binding [GO:0008270] carbonate dehydratase activity [GO:0004089];zinc ion binding [GO:0008270] VEDNDRLGLPSSHK 0.97651 0 13.9216 0 0 0 0 0 13.9216 A0A2C9WGH2 Uncharacterized protein MANES_02G181000 A0A2C9WGH2_MANES Manihot esculenta (Cassava) (Jatropha manihot) KSQEAIDYK 0.96386 0 13.922 0 0 0 0 0 13.922 A0A2C9VZI0 Uncharacterized protein MANES_04G047100 A0A2C9VZI0_MANES Manihot esculenta (Cassava) (Jatropha manihot) GFFGSSNVGEK 0.33333 0 13.9269 0 0 0 13.9269 0 0 A0A2C9VEG8 Beta-galactosidase (EC 3.2.1.23) MANES_08G017800 A0A2C9VEG8_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] apoplast [GO:0048046];vacuole [GO:0005773] apoplast [GO:0048046];vacuole [GO:0005773];beta-galactosidase activity [GO:0004565];carbohydrate binding [GO:0030246];carbohydrate metabolic process [GO:0005975] beta-galactosidase activity [GO:0004565];carbohydrate binding [GO:0030246] FASFGLPEGDCGHFNVGTCHSEK 0.95817 0 13.9278 0 0 0 0 13.9278 0 A0A2C9V9F3 Uncharacterized protein MANES_09G092300 A0A2C9V9F3_MANES Manihot esculenta (Cassava) (Jatropha manihot) maintenance of protein location in nucleus [GO:0051457];response to light stimulus [GO:0009416];response to red or far red light [GO:0009639] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];maintenance of protein location in nucleus [GO:0051457];response to light stimulus [GO:0009416];response to red or far red light [GO:0009639] DLDDILYSNGNNSNIR 0.99716 0 13.9298 0 0 0 0 13.9298 0 A0A2C9WFJ0 Uncharacterized protein MANES_02G196900 A0A2C9WFJ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] LPDPRWFSLFK 0.95672 14.4958 13.9358 14.4958 0 0 13.9358 0 0 A0A2C9VUN8 Uncharacterized protein MANES_05G090400 A0A2C9VUN8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] TDTRSEEFYSLPFNLNKFFPSV 0.97433 0 13.9382 0 0 0 0 13.9382 0 A0A2C9W5N7 Calcium-transporting ATPase (EC 7.2.2.10) MANES_03G081400 A0A2C9W5N7_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of plasma membrane [GO:0005887];intracellular membrane-bounded organelle [GO:0043231] integral component of plasma membrane [GO:0005887];intracellular membrane-bounded organelle [GO:0043231];ATP binding [GO:0005524];ATPase-coupled cation transmembrane transporter activity [GO:0019829];P-type calcium transporter activity [GO:0005388] ATPase-coupled cation transmembrane transporter activity [GO:0019829];ATP binding [GO:0005524];P-type calcium transporter activity [GO:0005388] RGGVAVQR 0.96826 0 13.9425 0 0 0 13.9425 0 0 A0A2C9VAU6 Galactinol--sucrose galactosyltransferase (EC 2.4.1.82) MANES_09G072200 A0A2C9VAU6_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] carbohydrate metabolic process [GO:0005975] EGEPFVEGSQFGGR 0.97987 0 13.9426 0 0 0 0 0 13.9426 A0A251KAS6 BTB domain-containing protein MANES_08G056500 A0A251KAS6_MANES Manihot esculenta (Cassava) (Jatropha manihot) plant organ development [GO:0099402] plant organ development [GO:0099402] RSLMPHHHHHHHHHHDLTAAADLEDQKIR 1.0023 0 13.9443 0 0 0 0 0 13.9443 A0A2C9W0G0 Uncharacterized protein MANES_04G073500 A0A2C9W0G0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] NQIMQRYEAGNR 0.95285 0 13.9506 0 0 0 0 0 13.9506 A0A2C9V7C2 Uncharacterized protein MANES_10G129600 A0A2C9V7C2_MANES Manihot esculenta (Cassava) (Jatropha manihot) WHYKQHK 0.96562 0 13.9506 0 0 0 13.9506 0 0 A0A2C9VQS5 Uncharacterized protein MANES_06G094000 A0A2C9VQS5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] QLYDDAILHTSFAR 0.96661 0 13.9522 0 0 0 13.9522 0 0 A0A2C9W2X1 Uncharacterized protein MANES_04G156100 A0A2C9W2X1_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrion [GO:0005739] mitochondrion [GO:0005739] RMKEFGYSGR 0.95295 0 13.9572 0 0 0 13.9572 0 0 A0A2C9UB48 UBC core domain-containing protein MANES_16G116300 A0A2C9UB48_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular response to DNA damage stimulus [GO:0006974];protein polyubiquitination [GO:0000209] nucleus [GO:0005634] nucleus [GO:0005634];ubiquitin conjugating enzyme activity [GO:0061631];cellular response to DNA damage stimulus [GO:0006974];protein polyubiquitination [GO:0000209] ubiquitin conjugating enzyme activity [GO:0061631] AFKVSQK 0.97912 11.5668 13.9582 0 0 11.5668 0 12.053 13.9582 A0A2C9UX57 Uncharacterized protein MANES_11G002900 A0A2C9UX57_MANES Manihot esculenta (Cassava) (Jatropha manihot) PVEGSGTTSIGKDGEDPVSVKVAMEK 0.98256 0 13.9609 0 0 0 13.9609 0 0 A0A251KAD2 Uncharacterized protein MANES_08G020300 A0A251KAD2_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA splicing, via spliceosome [GO:0000398]" spliceosomal complex [GO:0005681];U2AF complex [GO:0089701] "spliceosomal complex [GO:0005681];U2AF complex [GO:0089701];metal ion binding [GO:0046872];pre-mRNA 3'-splice site binding [GO:0030628];mRNA splicing, via spliceosome [GO:0000398]" metal ion binding [GO:0046872];pre-mRNA 3'-splice site binding [GO:0030628] EEEHAANALNNLNGR 1.033 0 13.9614 0 0 0 0 0 13.9614 A0A2C9W8Q9 Uncharacterized protein MANES_03G116600 A0A2C9W8Q9_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin filament-based movement [GO:0030048] myosin complex [GO:0016459] myosin complex [GO:0016459];actin binding [GO:0003779];ATP binding [GO:0005524];calmodulin binding [GO:0005516];cytoskeletal motor activity [GO:0003774];actin filament-based movement [GO:0030048] actin binding [GO:0003779];ATP binding [GO:0005524];calmodulin binding [GO:0005516];cytoskeletal motor activity [GO:0003774] CRYSQDMIYSK 0.95654 0 13.9687 0 0 0 0 13.9687 0 A0A251K2W8 FRIGIDA-like protein MANES_12G055300 A0A251K2W8_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell differentiation [GO:0030154];flower development [GO:0009908] cell differentiation [GO:0030154];flower development [GO:0009908] AQELLEKR 0.97081 0 13.9693 0 0 0 0 0 13.9693 A0A2C9WKZ1 Uncharacterized protein MANES_01G066400 A0A2C9WKZ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565];regulation of transcription, DNA-templated [GO:0006355]" DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] SLESKTSSCSLK 0.96761 0 13.9727 0 0 0 0 0 13.9727 A0A2C9URK5 GPI ethanolamine phosphate transferase 2 MANES_13G098700 A0A2C9URK5_MANES Manihot esculenta (Cassava) (Jatropha manihot) GPI anchor biosynthetic process [GO:0006506] integral component of endoplasmic reticulum membrane [GO:0030176] integral component of endoplasmic reticulum membrane [GO:0030176];CP2 mannose-ethanolamine phosphotransferase activity [GO:0051267];GPI anchor biosynthetic process [GO:0006506] CP2 mannose-ethanolamine phosphotransferase activity [GO:0051267] STIAAYHEFLK 0.95747 0 13.9739 0 0 0 0 0 13.9739 A0A2C9UIP7 FRIGIDA-like protein MANES_14G042300 A0A2C9UIP7_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell differentiation [GO:0030154];flower development [GO:0009908] cell differentiation [GO:0030154];flower development [GO:0009908] AYTKNSPMIPGR 0.9821 15.5475 13.9797 0 0 15.5475 0 0 13.9797 A0A2C9VME6 Myb-like domain-containing protein MANES_07G124500 A0A2C9VME6_MANES Manihot esculenta (Cassava) (Jatropha manihot) VMEKQEQMHK 0.95778 0 13.9804 0 0 0 13.9804 0 0 A0A2C9V9C3 Kinesin motor domain-containing protein MANES_09G053600 A0A2C9V9C3_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];plus-end-directed microtubule motor activity [GO:0008574];zinc ion binding [GO:0008270];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];plus-end-directed microtubule motor activity [GO:0008574];zinc ion binding [GO:0008270] AGRLNEAFGFIENMTVEK 0.96844 12.3637 13.9825 0 0 12.3637 0 0 13.9825 A0A2C9VNL9 Protein kinase domain-containing protein MANES_06G065400 A0A2C9VNL9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];polysaccharide binding [GO:0030247];protein kinase activity [GO:0004672] ATP binding [GO:0005524];polysaccharide binding [GO:0030247];protein kinase activity [GO:0004672] HASSNFLSTSSFTDRSSK 0.99726 0 13.9936 0 0 0 13.9936 0 0 A0A2C9W993 Condensin-2 complex subunit H2 (Non-SMC condensin II complex subunit H2) MANES_03G200100 A0A2C9W993_MANES Manihot esculenta (Cassava) (Jatropha manihot) meiotic chromosome condensation [GO:0010032];mitotic sister chromatid separation [GO:0051306] condensin complex [GO:0000796];nucleus [GO:0005634] condensin complex [GO:0000796];nucleus [GO:0005634];chromatin binding [GO:0003682];meiotic chromosome condensation [GO:0010032];mitotic sister chromatid separation [GO:0051306] chromatin binding [GO:0003682] DGPFYHFVK 0.98079 0 13.9938 0 0 0 0 0 13.9938 A0A2C9UX03 Hexosyltransferase (EC 2.4.1.-) MANES_12G153100 A0A2C9UX03_MANES Manihot esculenta (Cassava) (Jatropha manihot) xylan biosynthetic process [GO:0045492] glycosyltransferase activity [GO:0016757];xylan biosynthetic process [GO:0045492] glycosyltransferase activity [GO:0016757] CIDNLCNWKSMLR 0.96022 15.5704 13.9957 0 15.5704 0 0 0 13.9957 A0A2C9VZA3 RNA helicase (EC 3.6.4.13) MANES_04G035200 A0A2C9VZA3_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];RNA binding [GO:0003723];RNA helicase activity [GO:0003724] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];RNA binding [GO:0003723];RNA helicase activity [GO:0003724] AKSGGFESLNLSPNVYR 0.99089 0 13.9984 0 0 0 0 13.9984 0 A0A2C9V512 Exocyst subunit Exo70 family protein MANES_10G036300 A0A2C9V512_MANES Manihot esculenta (Cassava) (Jatropha manihot) exocytosis [GO:0006887];protein transport [GO:0015031] exocyst [GO:0000145] exocyst [GO:0000145];exocytosis [GO:0006887];protein transport [GO:0015031] TVINYIYK 0.95229 0 13.9996 0 0 0 13.9996 0 0 A0A251K713 TPX2 domain-containing protein MANES_09G151100 A0A251K713_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule cytoskeleton organization [GO:0000226] cytoplasm [GO:0005737];microtubule [GO:0005874] cytoplasm [GO:0005737];microtubule [GO:0005874];microtubule binding [GO:0008017];microtubule cytoskeleton organization [GO:0000226] microtubule binding [GO:0008017] NQAEARSKEEQQADIK 0.96722 0 14.0086 0 0 0 0 12.1611 14.0086 A0A2C9W892 Serine/threonine-protein phosphatase (EC 3.1.3.16) MANES_03G084800 A0A2C9W892_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein serine phosphatase activity [GO:0106306];protein threonine phosphatase activity [GO:0106307] protein serine phosphatase activity [GO:0106306];protein threonine phosphatase activity [GO:0106307] GAGYTFGQDISEQFNHTNNLK 0.97297 0 14.015 0 0 0 0 14.015 13.4464 A0A2C9VWC2 Uncharacterized protein MANES_05G147200 A0A2C9VWC2_MANES Manihot esculenta (Cassava) (Jatropha manihot) MEERSSPQYQSK 0.95005 0 14.0179 0 0 0 0 14.0179 0 A0A2C9VSC6 Uncharacterized protein MANES_05G015200 A0A2C9VSC6_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to virus [GO:0051607];immune response [GO:0006955];production of miRNAs involved in gene silencing by miRNA [GO:0035196];production of siRNA involved in RNA interference [GO:0030422] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];ATP binding [GO:0005524];DNA binding [GO:0003677];ribonuclease III activity [GO:0004525];RNA binding [GO:0003723];defense response to virus [GO:0051607];immune response [GO:0006955];production of miRNAs involved in gene silencing by miRNA [GO:0035196];production of siRNA involved in RNA interference [GO:0030422] ATP binding [GO:0005524];DNA binding [GO:0003677];ribonuclease III activity [GO:0004525];RNA binding [GO:0003723] IVDPIKEIDWDLVEK 1.046 0 14.0233 0 0 0 14.0233 0 0 A0A251K3L8 Guanylate kinase (EC 2.7.4.8) MANES_09G025300 A0A251K3L8_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytosol [GO:0005829] cytosol [GO:0005829];ATP binding [GO:0005524];guanylate kinase activity [GO:0004385] ATP binding [GO:0005524];guanylate kinase activity [GO:0004385] RLRNAEVEMEQGK 0.95872 0 14.0255 0 0 0 14.0255 0 0 A0A2C9W721 Uncharacterized protein MANES_03G080100 A0A2C9W721_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634];ribonucleoprotein complex [GO:1990904] nucleus [GO:0005634];ribonucleoprotein complex [GO:1990904];ATP binding [GO:0005524];hydrolase activity [GO:0016787];RNA binding [GO:0003723];RNA helicase activity [GO:0003724] ATP binding [GO:0005524];hydrolase activity [GO:0016787];RNA binding [GO:0003723];RNA helicase activity [GO:0003724] DRAGMNRFDSSSGNAGGGR 0.95731 13.9437 14.0305 13.4411 13.9437 0 0 14.0305 0 A0A2C9UQ38 J domain-containing protein MANES_13G050800 A0A2C9UQ38_MANES Manihot esculenta (Cassava) (Jatropha manihot) chaperone-mediated protein folding [GO:0061077] chloroplast [GO:0009507] chloroplast [GO:0009507];chaperone-mediated protein folding [GO:0061077] SFLELSSHFSFNTHFPK 0.9725 0 14.0314 0 0 0 0 14.0314 0 A0A251LAC5 Uncharacterized protein MANES_03G144900 A0A251LAC5_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to peptide [GO:1901652] metal ion binding [GO:0046872];RNA binding [GO:0003723];response to peptide [GO:1901652] metal ion binding [GO:0046872];RNA binding [GO:0003723] QLFGYFGTVVDCTITDSKHFAFIEYSK 0.99454 0 14.0432 0 0 0 0 14.0432 0 A0A2C9VCX0 Kinesin motor domain-containing protein MANES_08G027100 A0A2C9VCX0_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];plus-end-directed microtubule motor activity [GO:0008574];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];plus-end-directed microtubule motor activity [GO:0008574] AMPMENLLEEFRENNSYESFEVK 0.97674 0 14.0491 0 0 0 14.0491 0 0 A0A2C9VI85 Uncharacterized protein MANES_07G037000 A0A2C9VI85_MANES Manihot esculenta (Cassava) (Jatropha manihot) FFIFDQSGNETRLR 0.9608 0 14.0496 0 0 0 14.0496 0 0 A0A251K4S0 Uncharacterized protein MANES_09G085700 A0A251K4S0_MANES Manihot esculenta (Cassava) (Jatropha manihot) TAPTERSQR 0.95971 0 14.0554 0 0 0 14.0554 0 0 A0A2C9V6M8 Glutamine amidotransferase type-2 domain-containing protein MANES_09G005600 A0A2C9V6M8_MANES Manihot esculenta (Cassava) (Jatropha manihot) ammonia assimilation cycle [GO:0019676];glutamate biosynthetic process [GO:0006537] "3 iron, 4 sulfur cluster binding [GO:0051538];glutamate synthase (NADH) activity [GO:0016040];glutamate synthase activity [GO:0015930];metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491];ammonia assimilation cycle [GO:0019676];glutamate biosynthetic process [GO:0006537]" "3 iron, 4 sulfur cluster binding [GO:0051538];glutamate synthase (NADH) activity [GO:0016040];glutamate synthase activity [GO:0015930];metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491]" QEGLEVLGWR 0.96088 15.9124 14.0554 0 15.9124 0 0 14.0554 0 A0A2C9VNG0 NAB domain-containing protein MANES_07G141800 A0A2C9VNG0_MANES Manihot esculenta (Cassava) (Jatropha manihot) vacuolar membrane [GO:0005774] vacuolar membrane [GO:0005774];actin binding [GO:0003779] actin binding [GO:0003779] LVDELRLR 0.96408 0 14.0555 0 0 0 0 14.0555 12.7474 A0A2C9UQV8 Uncharacterized protein MANES_13G074000 A0A2C9UQV8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];acetylglucosaminyltransferase activity [GO:0008375] acetylglucosaminyltransferase activity [GO:0008375] SYDNNSISLPPLCISEDTSRFR 0.98085 0 14.0609 0 0 0 0 0 14.0609 A0A2C9UQP0 Vacuolar protein sorting-associated protein 11 homolog MANES_13G062700 A0A2C9UQP0_MANES Manihot esculenta (Cassava) (Jatropha manihot) endosome organization [GO:0007032];intracellular protein transport [GO:0006886];organelle fusion [GO:0048284];vacuole organization [GO:0007033];vesicle docking involved in exocytosis [GO:0006904] CORVET complex [GO:0033263];endosome [GO:0005768];HOPS complex [GO:0030897];plant-type vacuole membrane [GO:0009705] CORVET complex [GO:0033263];endosome [GO:0005768];HOPS complex [GO:0030897];plant-type vacuole membrane [GO:0009705];metal ion binding [GO:0046872];protein-macromolecule adaptor activity [GO:0030674];endosome organization [GO:0007032];intracellular protein transport [GO:0006886];organelle fusion [GO:0048284];vacuole organization [GO:0007033];vesicle docking involved in exocytosis [GO:0006904] metal ion binding [GO:0046872];protein-macromolecule adaptor activity [GO:0030674] MQPEGTSSSVPDCIGILR 1.0629 0 14.0642 0 0 0 0 14.0642 0 A0A2C9UXL1 "Magnesium-transporting ATPase, P-type 1 (EC 7.2.2.14) (Mg(2+) transport ATPase, P-type 1)" MANES_12G129300 A0A2C9UXL1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of plasma membrane [GO:0005887];intracellular membrane-bounded organelle [GO:0043231] integral component of plasma membrane [GO:0005887];intracellular membrane-bounded organelle [GO:0043231];ATP binding [GO:0005524];ATPase-coupled cation transmembrane transporter activity [GO:0019829];P-type magnesium transporter activity [GO:0015444] ATPase-coupled cation transmembrane transporter activity [GO:0019829];ATP binding [GO:0005524];P-type magnesium transporter activity [GO:0015444] ILPSYSPIR 0.96214 0 14.0718 0 0 0 0 14.0718 12.9621 A0A2C9V7G1 Receptor-like serine/threonine-protein kinase (EC 2.7.11.1) MANES_09G025000 A0A2C9V7G1_MANES Manihot esculenta (Cassava) (Jatropha manihot) recognition of pollen [GO:0048544] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];recognition of pollen [GO:0048544] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] CFAQDCK 1.0045 0 14.0729 0 0 0 10.319 0 14.0729 A0A2C9UJE2 Protein DETOXIFICATION (Multidrug and toxic compound extrusion protein) MANES_14G060800 A0A2C9UJE2_MANES Manihot esculenta (Cassava) (Jatropha manihot) xenobiotic detoxification by transmembrane export across the plasma membrane [GO:1990961] integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];antiporter activity [GO:0015297];transmembrane transporter activity [GO:0022857];xenobiotic transmembrane transporter activity [GO:0042910];xenobiotic detoxification by transmembrane export across the plasma membrane [GO:1990961] antiporter activity [GO:0015297];transmembrane transporter activity [GO:0022857];xenobiotic transmembrane transporter activity [GO:0042910] VTVYGSR 0.98212 0 14.079 0 0 0 14.079 0 0 A0A2C9U8B2 GPI ethanolamine phosphate transferase 1 (EC 2.-.-.-) MANES_17G118300 A0A2C9U8B2_MANES Manihot esculenta (Cassava) (Jatropha manihot) GPI anchor biosynthetic process [GO:0006506] endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021] endoplasmic reticulum membrane [GO:0005789];integral component of membrane [GO:0016021];mannose-ethanolamine phosphotransferase activity [GO:0051377];sulfuric ester hydrolase activity [GO:0008484];GPI anchor biosynthetic process [GO:0006506] mannose-ethanolamine phosphotransferase activity [GO:0051377];sulfuric ester hydrolase activity [GO:0008484] QILNQFLHK 0.97687 0 14.0822 0 0 0 14.0822 0 0 A0A2C9WKA1 START domain-containing protein MANES_01G043000 A0A2C9WKA1_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to wounding [GO:0009611] lipid binding [GO:0008289];response to wounding [GO:0009611] lipid binding [GO:0008289] RIWELDGSYYCVTK 0.96435 0 14.0911 0 0 0 0 0 14.0911 A0A2C9UR72 Beta-galactosidase (EC 3.2.1.23) MANES_13G084900 A0A2C9UR72_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] apoplast [GO:0048046];vacuole [GO:0005773] apoplast [GO:0048046];vacuole [GO:0005773];beta-galactosidase activity [GO:0004565];carbohydrate metabolic process [GO:0005975] beta-galactosidase activity [GO:0004565] VEIQCTLEK 0.9627 0 14.105 0 0 0 14.105 0 0 A0A2C9VJZ0 PORR domain-containing protein MANES_07G095800 A0A2C9VJZ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] ANNPFLEYKKLDFEMDSVNEK 0.95194 0 14.1131 0 0 0 0 14.1131 0 A0A2C9VQB5 Uncharacterized protein MANES_06G127900 A0A2C9VQB5_MANES Manihot esculenta (Cassava) (Jatropha manihot) VQEEEEK 0.95687 14.6007 14.1203 0 14.6007 0 0 14.1203 0 A0A2C9UNF2 Uncharacterized protein MANES_13G029800 A0A2C9UNF2_MANES Manihot esculenta (Cassava) (Jatropha manihot) PVYPLFNTDLLFADGDSEAK 0.88889 0 14.1224 0 0 0 0 0 14.1224 A0A2C9U3R3 Uncharacterized protein MANES_17G011500 A0A2C9U3R3_MANES Manihot esculenta (Cassava) (Jatropha manihot) AMMSDSEDTCSSSSSHGQYK 0.95952 0 14.1251 0 0 0 0 0 14.1251 A0A2C9ULD4 Peroxidase (EC 1.11.1.7) MANES_14G132500 A0A2C9ULD4_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrogen peroxide catabolic process [GO:0042744];response to oxidative stress [GO:0006979] extracellular region [GO:0005576];plant-type cell wall [GO:0009505] extracellular region [GO:0005576];plant-type cell wall [GO:0009505];heme binding [GO:0020037];metal ion binding [GO:0046872];peroxidase activity [GO:0004601];hydrogen peroxide catabolic process [GO:0042744];response to oxidative stress [GO:0006979] heme binding [GO:0020037];metal ion binding [GO:0046872];peroxidase activity [GO:0004601] MSSIEVKTGSDGEIRQICSK 0.97629 0 14.1272 0 0 0 0 14.1272 0 A0A2C9VP74 Uncharacterized protein MANES_06G093300 A0A2C9VP74_MANES Manihot esculenta (Cassava) (Jatropha manihot) EIHGYVFRAGMGR 0.96939 0 14.1286 0 0 0 14.1286 0 0 A0A199UBK9 Homoserine dehydrogenase (EC 1.1.1.3) MANES_S033500 A0A199UBK9_MANES Manihot esculenta (Cassava) (Jatropha manihot) isoleucine biosynthetic process [GO:0009097];methionine biosynthetic process [GO:0009086];threonine biosynthetic process [GO:0009088] aspartate kinase activity [GO:0004072];homoserine dehydrogenase activity [GO:0004412];NADP binding [GO:0050661];isoleucine biosynthetic process [GO:0009097];methionine biosynthetic process [GO:0009086];threonine biosynthetic process [GO:0009088] aspartate kinase activity [GO:0004072];homoserine dehydrogenase activity [GO:0004412];NADP binding [GO:0050661] YVCVIEGSRCEVGIQELPK 1.0038 0 14.1291 0 0 0 0 14.1291 0 A0A2C9UCG8 Uncharacterized protein MANES_15G023000 A0A2C9UCG8_MANES Manihot esculenta (Cassava) (Jatropha manihot) GRWIFFWGDSNHVDTIR 0.9606 0 14.1298 0 0 0 14.1298 0 0 A0A2C9VLJ8 p-aminobenzoic acid synthase (EC 2.6.1.85) (Para-aminobenzoate synthase) MANES_07G101300 A0A2C9VLJ8_MANES Manihot esculenta (Cassava) (Jatropha manihot) folic acid biosynthetic process [GO:0046656];para-aminobenzoic acid biosynthetic process [GO:0008153];tetrahydrofolate biosynthetic process [GO:0046654] cytoplasm [GO:0005737] cytoplasm [GO:0005737];4-amino-4-deoxychorismate synthase activity [GO:0046820];folic acid biosynthetic process [GO:0046656];para-aminobenzoic acid biosynthetic process [GO:0008153];tetrahydrofolate biosynthetic process [GO:0046654] 4-amino-4-deoxychorismate synthase activity [GO:0046820] LAAQLGGAR 0.96271 0 14.1305 0 0 0 0 14.1305 0 A0A2C9UM97 Protein kinase domain-containing protein MANES_14G162000 A0A2C9UM97_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] KNGEFLRFYPEMNPK 0.97123 0 14.1348 0 0 0 0 14.1348 11.8571 A0A2C9VTG8 SWIM-type domain-containing protein MANES_05G052400 A0A2C9VTG8_MANES Manihot esculenta (Cassava) (Jatropha manihot) zinc ion binding [GO:0008270] zinc ion binding [GO:0008270] FGNRSLLASDSRFGTNK 0.9749 0 14.1348 0 0 0 0 14.1348 0 A0A2C9WNZ9 CUE domain-containing protein MANES_01G209500 A0A2C9WNZ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];ubiquitin binding [GO:0043130];regulation of transcription by RNA polymerase II [GO:0006357]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];ubiquitin binding [GO:0043130]" TLMELFPQVDSR 0.95597 0 14.1349 0 0 0 14.1349 0 0 A0A2C9UH65 Uncharacterized protein MANES_15G120900 A0A2C9UH65_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];voltage-gated potassium channel activity [GO:0005249] voltage-gated potassium channel activity [GO:0005249] LLLEEGANADK 0.95894 0 14.1372 0 0 0 0 0 14.1372 A0A199U9P3 Uncharacterized protein MANES_S084500 A0A199U9P3_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] LRWDIILPIIAVGADAISAALEQTSPHK 1.0719 0 14.1454 0 0 0 14.1454 0 0 A0A251J9E4 Peptidylprolyl isomerase (EC 5.2.1.8) MANES_14G033300 A0A251J9E4_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleosome assembly [GO:0006334] nucleolus [GO:0005730] nucleolus [GO:0005730];histone binding [GO:0042393];peptidyl-prolyl cis-trans isomerase activity [GO:0003755];nucleosome assembly [GO:0006334] histone binding [GO:0042393];peptidyl-prolyl cis-trans isomerase activity [GO:0003755] SILQCSVGHK 0.98228 0 14.1493 0 0 0 13.7521 0 14.1493 A0A251L8B2 Uncharacterized protein MANES_03G082600 A0A251L8B2_MANES Manihot esculenta (Cassava) (Jatropha manihot) root meristem growth [GO:0010449] root meristem growth [GO:0010449] GALVDMYSKCR 0.95939 0 14.1543 0 0 0 0 14.1543 0 A0A2C9VV40 "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial (Coenzyme Q biosynthesis protein 4 homolog)" MANES_05G109300 A0A2C9VV40_MANES Manihot esculenta (Cassava) (Jatropha manihot) ubiquinone biosynthetic process [GO:0006744] extrinsic component of mitochondrial inner membrane [GO:0031314] extrinsic component of mitochondrial inner membrane [GO:0031314];ubiquinone biosynthetic process [GO:0006744] NFSPDDRPPVR 0.96016 0 14.1543 0 0 0 0 14.1543 0 A0A2C9UI27 Uncharacterized protein MANES_15G178600 A0A2C9UI27_MANES Manihot esculenta (Cassava) (Jatropha manihot) LNENYCHEGNQTVIIHKRHNEYGYGK 1.037 0 14.1565 0 0 0 0 0 14.1565 A0A251J7K4 Histone acetyltransferase (EC 2.3.1.48) MANES_14G000600 A0A251J7K4_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin organization [GO:0006325];histone acetylation [GO:0016573];positive regulation of transcription by RNA polymerase II [GO:0045944] histone acetyltransferase complex [GO:0000123];transcription regulator complex [GO:0005667] histone acetyltransferase complex [GO:0000123];transcription regulator complex [GO:0005667];chromatin DNA binding [GO:0031490];histone acetyltransferase activity [GO:0004402];transcription coactivator activity [GO:0003713];zinc ion binding [GO:0008270];chromatin organization [GO:0006325];histone acetylation [GO:0016573];positive regulation of transcription by RNA polymerase II [GO:0045944] chromatin DNA binding [GO:0031490];histone acetyltransferase activity [GO:0004402];transcription coactivator activity [GO:0003713];zinc ion binding [GO:0008270] QPQPVSEPQK 0.98438 0 14.158 0 0 0 14.158 0 0 A0A2C9W2M2 Uncharacterized protein MANES_04G146200 A0A2C9W2M2_MANES Manihot esculenta (Cassava) (Jatropha manihot) cation transport [GO:0006812] integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];cation transmembrane transporter activity [GO:0008324];cation transport [GO:0006812] cation transmembrane transporter activity [GO:0008324] NVFDSFYCIKNPKFR 0.97222 0 14.159 0 0 0 0 0 14.159 A0A2C9UTM1 F-box domain-containing protein MANES_12G041900 A0A2C9UTM1_MANES Manihot esculenta (Cassava) (Jatropha manihot) SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ubiquitin-protein transferase activity [GO:0004842];SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146] ubiquitin-protein transferase activity [GO:0004842] IDEKNMEFSEIAIMPQDLLYGLVDNEEDDK 0.95683 0 14.1873 0 0 0 14.1873 0 0 A0A2C9VJJ1 Uncharacterized protein MANES_07G012100 A0A2C9VJJ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] EDLGHQYFDDLLSR 0.9693 0 14.2076 0 0 0 0 12.6297 14.2076 A0A2C9VK20 Uncharacterized protein MANES_07G101600 A0A2C9VK20_MANES Manihot esculenta (Cassava) (Jatropha manihot) "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]" cytoplasm [GO:0005737];exon-exon junction complex [GO:0035145];polysome [GO:0005844] "cytoplasm [GO:0005737];exon-exon junction complex [GO:0035145];polysome [GO:0005844];RNA binding [GO:0003723];nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]" RNA binding [GO:0003723] LNSEKHSDTEK 0.95941 0 14.209 0 0 0 14.209 0 0 A0A2C9UNL9 BHLH domain-containing protein MANES_13G032500 A0A2C9UNL9_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];protein dimerization activity [GO:0046983] DNA-binding transcription factor activity [GO:0003700];protein dimerization activity [GO:0046983] EGPNNQLSMFPYLQK 1.0107 0 14.2104 0 0 0 0 14.2104 0 A0A2C9W0S7 Uncharacterized protein MANES_04G084000 A0A2C9W0S7_MANES Manihot esculenta (Cassava) (Jatropha manihot) Cdc73/Paf1 complex [GO:0016593] Cdc73/Paf1 complex [GO:0016593];DNA binding [GO:0003677];metal ion binding [GO:0046872];RNA polymerase II C-terminal domain phosphoserine binding [GO:1990269] DNA binding [GO:0003677];metal ion binding [GO:0046872];RNA polymerase II C-terminal domain phosphoserine binding [GO:1990269] EPLSPGR 0.96035 0 14.2109 0 0 0 0 0 14.2109 A0A2C9UYU1 Uncharacterized protein MANES_11G056100 A0A2C9UYU1_MANES Manihot esculenta (Cassava) (Jatropha manihot) RSDGGDGDGGSEFYGNEKTDAYYQK 0.95315 0 14.2111 0 0 0 0 14.2111 0 A0A251L6V2 cwf21 domain-containing protein MANES_03G046500 A0A251L6V2_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634] NSDKSAK 0.97735 0 14.2209 0 0 0 0 14.2209 0 A0A2C9VXT9 DUF4283 domain-containing protein MANES_05G151000 A0A2C9VXT9_MANES Manihot esculenta (Cassava) (Jatropha manihot) ELQPNENPRSVEVTRLEMWVQLHNLTSDFFSK 1.0652 0 14.2229 0 0 0 0 0 14.2229 A0A2C9WBR7 Uncharacterized protein MANES_02G021900 A0A2C9WBR7_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] ATP binding [GO:0005524];cytoskeletal motor activity [GO:0003774];microtubule binding [GO:0008017];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];cytoskeletal motor activity [GO:0003774];microtubule binding [GO:0008017] PTEKAENTR 0.9598 0 14.2245 0 0 0 14.2245 0 0 A0A2C9VK60 Uncharacterized protein MANES_07G098900 A0A2C9VK60_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872] metal ion binding [GO:0046872] VMADGRTGFIDVGDLYADEERDFLVSINVPAEPSR 0.77358 0 14.2262 0 0 0 14.2262 0 0 A0A2C9V8R7 Uncharacterized protein MANES_09G075600 A0A2C9V8R7_MANES Manihot esculenta (Cassava) (Jatropha manihot) CVPDAYTYCTLMDGLCKEDR 0.96799 0 14.2341 0 0 0 0 0 14.2341 A0A2C9UDF2 STAS domain-containing protein MANES_15G032100 A0A2C9UDF2_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast [GO:0009507];integral component of plasma membrane [GO:0005887] chloroplast [GO:0009507];integral component of plasma membrane [GO:0005887];anion:anion antiporter activity [GO:0015301];secondary active sulfate transmembrane transporter activity [GO:0008271] anion:anion antiporter activity [GO:0015301];secondary active sulfate transmembrane transporter activity [GO:0008271] ERISRWICDEEDR 0.9602 0 14.2458 0 0 0 0 12.846 14.2458 A0A2C9VVQ2 Bromo domain-containing protein MANES_05G123900 A0A2C9VVQ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) ISDACLGSDDMGEK 0.9764 12.8456 14.2479 12.8456 0 0 14.2479 0 0 A0A2C9U515 Protein kinase domain-containing protein MANES_17G046200 A0A2C9U515_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to bacterium [GO:0042742];defense response to oomycetes [GO:0002229] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];carbohydrate binding [GO:0030246];transmembrane receptor protein serine/threonine kinase activity [GO:0004675];defense response to bacterium [GO:0042742];defense response to oomycetes [GO:0002229] ATP binding [GO:0005524];carbohydrate binding [GO:0030246];transmembrane receptor protein serine/threonine kinase activity [GO:0004675] ARARADMEDWELEYWPHR 1.0009 0 14.2487 0 0 0 0 14.2487 0 A0A2C9V760 Phospholipase D (EC 3.1.4.4) MANES_10G123500 A0A2C9V760_MANES Manihot esculenta (Cassava) (Jatropha manihot) phospholipid catabolic process [GO:0009395] plasma membrane [GO:0005886] plasma membrane [GO:0005886];N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290];phospholipase D activity [GO:0004630];phospholipid catabolic process [GO:0009395] N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290];phospholipase D activity [GO:0004630] KVTHWHEDALLRLER 0.9593 0 14.2553 0 0 0 0 0 14.2553 A0A2C9VR84 DNA-directed primase/polymerase protein MANES_06G153300 A0A2C9VR84_MANES Manihot esculenta (Cassava) (Jatropha manihot) error-prone translesion synthesis [GO:0042276];mitochondrial DNA replication [GO:0006264];replication fork processing [GO:0031297];response to UV [GO:0009411];translesion synthesis [GO:0019985] mitochondrial matrix [GO:0005759];nucleus [GO:0005634] mitochondrial matrix [GO:0005759];nucleus [GO:0005634];chromatin binding [GO:0003682];DNA primase activity [GO:0003896];DNA-directed DNA polymerase activity [GO:0003887];error-prone translesion synthesis [GO:0042276];mitochondrial DNA replication [GO:0006264];replication fork processing [GO:0031297];response to UV [GO:0009411];translesion synthesis [GO:0019985] chromatin binding [GO:0003682];DNA-directed DNA polymerase activity [GO:0003887];DNA primase activity [GO:0003896] HHYEVIQEGLPCHLYFDLEFSKKENVER 1.0604 0 14.2571 0 0 0 0 14.2571 0 A0A2C9W1G9 Fe2OG dioxygenase domain-containing protein MANES_04G109700 A0A2C9W1G9_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] PKFWPQNPR 0.95954 0 14.2587 0 0 0 0 14.2587 13.6861 A0A2C9UDI7 INCENP_ARK-bind domain-containing protein MANES_15G059500 A0A2C9UDI7_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737];nucleus [GO:0005634];spindle [GO:0005819] cytoplasm [GO:0005737];nucleus [GO:0005634];spindle [GO:0005819] LPIKEEK 0.96364 0 14.2627 0 0 0 0 0 14.2627 A0A251KZV3 Uncharacterized protein MANES_05G204500 A0A251KZV3_MANES Manihot esculenta (Cassava) (Jatropha manihot) LIVKFGGNSDRNSTEDIASNSTTVSETMASK 0.6 0 14.2633 0 0 0 0 13.58 14.2633 A0A5J6Y408 ATP synthase subunit alpha atp1 A0A5J6Y408_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mitochondrion [GO:0005739];organelle membrane [GO:0031090];proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]" "mitochondrion [GO:0005739];organelle membrane [GO:0031090];proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261];ATP binding [GO:0005524];proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]" "ATP binding [GO:0005524];proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]" AAELTTLLESR 0.97221 0 14.2636 0 0 0 0 14.2636 0 A0A2C9V9X4 Ribosomal_S7 domain-containing protein MANES_09G041000 A0A2C9V9X4_MANES Manihot esculenta (Cassava) (Jatropha manihot) ribosomal small subunit assembly [GO:0000028];translation [GO:0006412] cytosolic small ribosomal subunit [GO:0022627];ribosome [GO:0005840] cytosolic small ribosomal subunit [GO:0022627];ribosome [GO:0005840];mRNA binding [GO:0003729];rRNA binding [GO:0019843];structural constituent of ribosome [GO:0003735];ribosomal small subunit assembly [GO:0000028];translation [GO:0006412] mRNA binding [GO:0003729];rRNA binding [GO:0019843];structural constituent of ribosome [GO:0003735] QAVDISPLR 0.9769 0 14.2767 0 0 0 0 0 14.2767 A0A2C9UE99 Thioredoxin domain-containing protein MANES_15G093000 A0A2C9UE99_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] cytoplasm [GO:0005737] GNVGGAR 0.95632 14.7658 14.2771 0 14.7658 0 0 14.2771 0 A0A2C9VPE5 Fe2OG dioxygenase domain-containing protein MANES_06G045000 A0A2C9VPE5_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] ILHEFAIK 0.97146 0 14.2782 0 0 0 14.2782 0 0 A0A2C9VVL7 R3H-assoc domain-containing protein MANES_05G074400 A0A2C9VVL7_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleic acid binding [GO:0003676] nucleic acid binding [GO:0003676] LLMELVPR 0.96903 13.1175 14.2782 0 13.1175 0 14.2782 0 0 A0A2C9WN28 Pectinesterase (EC 3.1.1.11) MANES_01G221700 A0A2C9WN28_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910];cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910] GITFENSAGPSK 0.3125 0 14.2783 0 0 0 14.2783 0 0 A0A2C9U9R7 AAA domain-containing protein MANES_16G042500 A0A2C9U9R7_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA-dependent DNA replication [GO:0006261];DNA repair [GO:0006281] DNA polymerase III complex [GO:0009360];DNA replication factor C complex [GO:0005663];nucleus [GO:0005634] DNA polymerase III complex [GO:0009360];DNA replication factor C complex [GO:0005663];nucleus [GO:0005634];ATP binding [GO:0005524];DNA binding [GO:0003677];DNA-directed DNA polymerase activity [GO:0003887];DNA repair [GO:0006281];DNA-dependent DNA replication [GO:0006261] ATP binding [GO:0005524];DNA binding [GO:0003677];DNA-directed DNA polymerase activity [GO:0003887] CQKFFFPK 0.96224 0 14.2804 0 0 0 14.2804 0 0 A0A2C9U7B9 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) MANES_17G116800 A0A2C9U7B9_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbon utilization [GO:0015976] carbonate dehydratase activity [GO:0004089];zinc ion binding [GO:0008270];carbon utilization [GO:0015976] carbonate dehydratase activity [GO:0004089];zinc ion binding [GO:0008270] QGFVHFK 0.96067 0 14.2816 0 0 0 0 0 14.2816 A0A2C9UW94 Uncharacterized protein MANES_12G095000 A0A2C9UW94_MANES Manihot esculenta (Cassava) (Jatropha manihot) TLLYSTSWDKTFK 0.97459 0 14.3051 0 0 0 0 0 14.3051 A9XVQ2 Photosystem II CP47 reaction center protein (Fragment) psbB A9XVQ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) photosynthetic electron transport in photosystem II [GO:0009772];protein-chromophore linkage [GO:0018298] chloroplast thylakoid membrane [GO:0009535];integral component of membrane [GO:0016021];photosystem II [GO:0009523] "chloroplast thylakoid membrane [GO:0009535];integral component of membrane [GO:0016021];photosystem II [GO:0009523];chlorophyll binding [GO:0016168];electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity [GO:0045156];photosynthetic electron transport in photosystem II [GO:0009772];protein-chromophore linkage [GO:0018298]" "chlorophyll binding [GO:0016168];electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity [GO:0045156]" AQLGEIFELDR 0.95687 15.9597 14.3058 0 15.9597 0 14.3058 0 0 A0A2C9U4J8 Uncharacterized protein MANES_18G144300 A0A2C9U4J8_MANES Manihot esculenta (Cassava) (Jatropha manihot) MSVGPFAR 0.99256 0 14.3086 0 0 0 0 14.3086 14.0483 A0A2C9W807 Amino_oxidase domain-containing protein MANES_03G161400 A0A2C9W807_MANES Manihot esculenta (Cassava) (Jatropha manihot) methyltransferase activity [GO:0008168];oxidoreductase activity [GO:0016491] methyltransferase activity [GO:0008168];oxidoreductase activity [GO:0016491] ILGAFQYVYSHYLALPDDLTGMHIIYI 0.99671 0 14.3116 0 0 0 0 14.3116 0 A0A2C9W877 START domain-containing protein MANES_03G168700 A0A2C9W877_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];lipid binding [GO:0008289] lipid binding [GO:0008289] AYQNARK 0.95002 0 14.317 0 0 0 0 14.317 0 A0A2C9WB04 Glycosyltransferase (EC 2.4.1.-) MANES_02G050500 A0A2C9WB04_MANES Manihot esculenta (Cassava) (Jatropha manihot) anthocyanin-containing compound biosynthetic process [GO:0009718] anthocyanidin 3-O-glucosyltransferase activity [GO:0047213];anthocyanin-containing compound biosynthetic process [GO:0009718] anthocyanidin 3-O-glucosyltransferase activity [GO:0047213] MSTLFMSFHATIGSK 1.0119 0 14.3178 0 0 0 14.0776 0 14.3178 A0A2C9VXQ4 Uncharacterized protein MANES_05G187400 A0A2C9VXQ4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] EDIIGSLQSRLDIICDEADEDLGPLDVDDRETSR 0.95935 0 14.3291 0 0 0 14.3291 0 0 A0A2C9TZH3 Catalase (EC 1.11.1.6) MANES_18G004400 A0A2C9TZH3_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrogen peroxide catabolic process [GO:0042744];response to hydrogen peroxide [GO:0042542] cytoplasm [GO:0005737];peroxisome [GO:0005777];plasma membrane [GO:0005886] cytoplasm [GO:0005737];peroxisome [GO:0005777];plasma membrane [GO:0005886];catalase activity [GO:0004096];heme binding [GO:0020037];metal ion binding [GO:0046872];hydrogen peroxide catabolic process [GO:0042744];response to hydrogen peroxide [GO:0042542] catalase activity [GO:0004096];heme binding [GO:0020037];metal ion binding [GO:0046872] CAYHNNHHDGFMNFMHR 1.0008 0 14.3295 0 0 0 14.3295 0 0 A0A2C9U2H8 Methyltransf_2 domain-containing protein MANES_18G083900 A0A2C9U2H8_MANES Manihot esculenta (Cassava) (Jatropha manihot) aromatic compound biosynthetic process [GO:0019438];methylation [GO:0032259] O-methyltransferase activity [GO:0008171];S-adenosylmethionine-dependent methyltransferase activity [GO:0008757];aromatic compound biosynthetic process [GO:0019438];methylation [GO:0032259] O-methyltransferase activity [GO:0008171];S-adenosylmethionine-dependent methyltransferase activity [GO:0008757] AHGMTAFEYLETDQRFNR 0.97235 0 14.3314 0 0 0 0 14.3314 0 A0A2C9UJI5 PX domain-containing protein MANES_14G064400 A0A2C9UJI5_MANES Manihot esculenta (Cassava) (Jatropha manihot) endosome [GO:0005768];membrane [GO:0016020] endosome [GO:0005768];membrane [GO:0016020];phosphatidylinositol binding [GO:0035091] phosphatidylinositol binding [GO:0035091] VDDSNIFDNQETGNLK 0.99923 0 14.336 0 0 0 0 0 14.336 A0A2C9U340 Uncharacterized protein MANES_18G123000 A0A2C9U340_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" GILTSNGAFWLHQR 0.95622 0 14.3429 0 0 0 0 0 14.3429 A0A2C9UPG4 Uncharacterized protein MANES_13G073400 A0A2C9UPG4_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA splicing, via spliceosome [GO:0000398]" nuclear speck [GO:0016607];nucleolus [GO:0005730] "nuclear speck [GO:0016607];nucleolus [GO:0005730];RNA binding [GO:0003723];mRNA splicing, via spliceosome [GO:0000398]" RNA binding [GO:0003723] AAFKGLSYK 0.9648 13.6518 14.3429 0 13.6518 0 13.3896 0 14.3429 A0A2C9UQU4 Phosphoenolpyruvate carboxykinase (ATP) (EC 4.1.1.49) MANES_13G105000 A0A2C9UQU4_MANES Manihot esculenta (Cassava) (Jatropha manihot) gluconeogenesis [GO:0006094] cytosol [GO:0005829] cytosol [GO:0005829];ATP binding [GO:0005524];phosphoenolpyruvate carboxykinase (ATP) activity [GO:0004612];gluconeogenesis [GO:0006094] ATP binding [GO:0005524];phosphoenolpyruvate carboxykinase (ATP) activity [GO:0004612] RVVKDDETSEELWWGK 0.97433 0 14.3459 0 0 0 0 0 14.3459 A0A0M4FSG8 NAC transcription factors 54 MANES_08G028000 A0A0M4FSG8_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" "DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] QEFSLCRVYKYSK 0.95441 0 14.3467 0 0 0 14.3467 0 0 A0A2C9USD7 Uncharacterized protein MANES_12G014400 A0A2C9USD7_MANES Manihot esculenta (Cassava) (Jatropha manihot) fatty acid biosynthetic process [GO:0006633];jasmonic acid biosynthetic process [GO:0009695];lipid oxidation [GO:0034440];oxylipin biosynthetic process [GO:0031408];response to wounding [GO:0009611] cytoplasm [GO:0005737] "cytoplasm [GO:0005737];linoleate 13S-lipoxygenase activity [GO:0016165];metal ion binding [GO:0046872];oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702];fatty acid biosynthetic process [GO:0006633];jasmonic acid biosynthetic process [GO:0009695];lipid oxidation [GO:0034440];oxylipin biosynthetic process [GO:0031408];response to wounding [GO:0009611]" "linoleate 13S-lipoxygenase activity [GO:0016165];metal ion binding [GO:0046872];oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]" AVISSDDK 0.9771 0 14.3473 0 0 0 0 14.3473 0 A0A2C9V1V4 Morc6_S5 domain-containing protein MANES_11G096200 A0A2C9V1V4_MANES Manihot esculenta (Cassava) (Jatropha manihot) gene silencing by RNA-directed DNA methylation [GO:0080188];positive regulation of defense response to oomycetes [GO:1902290];regulation of gene silencing by RNA [GO:0060966] nucleus [GO:0005634] nucleus [GO:0005634];ATP hydrolysis activity [GO:0016887];protein homodimerization activity [GO:0042803];gene silencing by RNA-directed DNA methylation [GO:0080188];positive regulation of defense response to oomycetes [GO:1902290];regulation of gene silencing by RNA [GO:0060966] ATP hydrolysis activity [GO:0016887];protein homodimerization activity [GO:0042803] IVVPMVDYEFNSAKGK 0.98037 0 14.3523 0 0 0 0 0 14.3523 A0A2C9UJM1 PWWP domain-containing protein MANES_14G065400 A0A2C9UJM1_MANES Manihot esculenta (Cassava) (Jatropha manihot) SLDRLSDVNVNMATDGLFVK 0.96864 0 14.3528 0 0 0 14.3528 0 0 A0A2C9WB50 Uncharacterized protein MANES_02G051500 A0A2C9WB50_MANES Manihot esculenta (Cassava) (Jatropha manihot) SLGHTHDAYTWNALLNGLYRANR 1.0699 0 14.3554 0 0 0 0 14.3554 0 A0A2C9U545 GB1/RHD3-type G domain-containing protein MANES_17G050000 A0A2C9U545_MANES Manihot esculenta (Cassava) (Jatropha manihot) GTP binding [GO:0005525];GTPase activity [GO:0003924] GTPase activity [GO:0003924];GTP binding [GO:0005525] IENAEQR 0.98073 0 14.3581 0 0 0 0 0 14.3581 A0A2C9UL92 Uncharacterized protein MANES_14G122600 A0A2C9UL92_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA cis splicing, via spliceosome [GO:0045292];mRNA splicing, via spliceosome [GO:0000398];regulation of RNA splicing [GO:0043484]" chloroplast [GO:0009507] "chloroplast [GO:0009507];RNA binding [GO:0003723];mRNA cis splicing, via spliceosome [GO:0045292];mRNA splicing, via spliceosome [GO:0000398];regulation of RNA splicing [GO:0043484]" RNA binding [GO:0003723] MGWKEGPGLGK 0.95071 0 14.3629 0 0 0 0 14.3629 13.5551 A0A2C9U9I6 3'-5' exonuclease domain-containing protein MANES_16G077100 A0A2C9U9I6_MANES Manihot esculenta (Cassava) (Jatropha manihot) 3'-5' exonuclease activity [GO:0008408];nucleic acid binding [GO:0003676] 3'-5' exonuclease activity [GO:0008408];nucleic acid binding [GO:0003676] EEVRVLLR 0.96237 0 14.3706 0 0 0 14.3706 0 0 A0A2C9UXD6 Uncharacterized protein MANES_11G006100 A0A2C9UXD6_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634] DSLMSTR 0.95565 0 14.3811 0 0 0 14.3811 0 0 A0A2C9UR95 Uncharacterized protein MANES_13G125400 A0A2C9UR95_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast accumulation movement [GO:0009904];chloroplast avoidance movement [GO:0009903] cytosol [GO:0005829] cytosol [GO:0005829];chloroplast accumulation movement [GO:0009904];chloroplast avoidance movement [GO:0009903] DMKERAK 0.96121 15.7922 14.3857 0 15.7922 0 0 14.3857 14.3446 A0A2C9V3P3 Uncharacterized protein MANES_10G005500 A0A2C9V3P3_MANES Manihot esculenta (Cassava) (Jatropha manihot) FGGSGSWIPYYKGFEEIDIKK 0.96275 13.4764 14.3866 13.4764 0 0 0 0 14.3866 A0A2C9VFM1 Uncharacterized protein MANES_08G118700 A0A2C9VFM1_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular response to unfolded protein [GO:0034620];chaperone cofactor-dependent protein refolding [GO:0051085];endoplasmic reticulum unfolded protein response [GO:0030968];protein refolding [GO:0042026];ubiquitin-dependent ERAD pathway [GO:0030433] cytoplasm [GO:0005737];endoplasmic reticulum chaperone complex [GO:0034663];endoplasmic reticulum lumen [GO:0005788];membrane [GO:0016020];nucleus [GO:0005634] cytoplasm [GO:0005737];endoplasmic reticulum chaperone complex [GO:0034663];endoplasmic reticulum lumen [GO:0005788];membrane [GO:0016020];nucleus [GO:0005634];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];heat shock protein binding [GO:0031072];misfolded protein binding [GO:0051787];protein folding chaperone [GO:0044183];unfolded protein binding [GO:0051082];cellular response to unfolded protein [GO:0034620];chaperone cofactor-dependent protein refolding [GO:0051085];endoplasmic reticulum unfolded protein response [GO:0030968];protein refolding [GO:0042026];ubiquitin-dependent ERAD pathway [GO:0030433] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];heat shock protein binding [GO:0031072];misfolded protein binding [GO:0051787];protein folding chaperone [GO:0044183];unfolded protein binding [GO:0051082] IDARNKLEAYIYNMR 0.97157 0 14.3869 0 0 0 0 14.3869 0 A0A2C9VA70 Uncharacterized protein MANES_09G121900 A0A2C9VA70_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast membrane [GO:0031969];integral component of membrane [GO:0016021] chloroplast membrane [GO:0031969];integral component of membrane [GO:0016021] LSKPEFSYGGGNGSSGIGR 0.98311 0 14.3869 0 0 0 0 14.3869 0 A0A2C9V883 Uncharacterized protein MANES_09G050100 A0A2C9V883_MANES Manihot esculenta (Cassava) (Jatropha manihot) oxidoreductase activity [GO:0016491] oxidoreductase activity [GO:0016491] VVIADVQDELGLSLCK 0.99012 0 14.3914 0 0 0 0 14.3914 0 A0A2C9W7J2 40S ribosomal protein S4 MANES_03G095200 A0A2C9W7J2_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] cytosolic small ribosomal subunit [GO:0022627] cytosolic small ribosomal subunit [GO:0022627];RNA binding [GO:0003723];rRNA binding [GO:0019843];structural constituent of ribosome [GO:0003735];translation [GO:0006412] RNA binding [GO:0003723];rRNA binding [GO:0019843];structural constituent of ribosome [GO:0003735] TDKTYPAGFMDVVSIPKTNENFR 1.0028 10.8373 14.3955 10.8373 0 0 14.3955 0 0 A0A2C9VB17 Uncharacterized protein MANES_09G151500 A0A2C9VB17_MANES Manihot esculenta (Cassava) (Jatropha manihot) QGHAVTAK 1 0 14.4163 0 0 0 14.4163 0 0 A0A2C9UDX1 Uncharacterized protein MANES_15G047900 A0A2C9UDX1_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin filament organization [GO:0007015];vesicle transport along actin filament [GO:0030050] actin cytoskeleton [GO:0015629];cytoplasm [GO:0005737];myosin complex [GO:0016459];vesicle [GO:0031982] actin cytoskeleton [GO:0015629];cytoplasm [GO:0005737];myosin complex [GO:0016459];vesicle [GO:0031982];actin filament binding [GO:0051015];ATP binding [GO:0005524];calmodulin binding [GO:0005516];microfilament motor activity [GO:0000146];actin filament organization [GO:0007015];vesicle transport along actin filament [GO:0030050] actin filament binding [GO:0051015];ATP binding [GO:0005524];calmodulin binding [GO:0005516];microfilament motor activity [GO:0000146] SLIGILDIYGFESFK 0.97751 0 14.4196 0 0 0 0 14.4196 0 A0A2C9V3R3 Lipoyl-binding domain-containing protein MANES_10G007300 A0A2C9V3R3_MANES Manihot esculenta (Cassava) (Jatropha manihot) NISFGKSSK 0.95901 12.8548 14.434 0 12.8548 0 0 14.434 0 A0A251J1W1 Uncharacterized protein MANES_16G131000 A0A251J1W1_MANES Manihot esculenta (Cassava) (Jatropha manihot) mRNA processing [GO:0006397] nucleus [GO:0005634] nucleus [GO:0005634];RNA binding [GO:0003723];mRNA processing [GO:0006397] RNA binding [GO:0003723] EHTYYVWRLYSFAQGDTLQRWR 0.97319 15.4782 14.4389 15.4782 0 0 0 14.4389 14.2932 A0A2C9VYV3 F-box domain-containing protein MANES_04G017200 A0A2C9VYV3_MANES Manihot esculenta (Cassava) (Jatropha manihot) NREYNIHNREPYR 0.95754 0 14.4462 0 0 0 0 14.4462 13.8481 A0A2C9UER1 Uncharacterized protein MANES_15G072500 A0A2C9UER1_MANES Manihot esculenta (Cassava) (Jatropha manihot) TGKMTELLQK 0.95179 0 14.447 0 0 0 14.447 0 0 A0A2C9VT69 KRR1 small subunit processome component (KRR-R motif-containing protein 1) MANES_06G172500 A0A2C9VT69_MANES Manihot esculenta (Cassava) (Jatropha manihot) rRNA processing [GO:0006364] nucleolus [GO:0005730] nucleolus [GO:0005730];RNA binding [GO:0003723];rRNA processing [GO:0006364] RNA binding [GO:0003723] QAKKWQEK 0.96881 0 14.4508 0 0 0 11.7078 0 14.4508 A0A2C9U330 Uncharacterized protein MANES_18G099600 A0A2C9U330_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565];regulation of transcription, DNA-templated [GO:0006355]" DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] RKGVVEDGK 1.0222 15.6693 14.4576 0 15.6693 0 0 14.4576 0 A0A2C9UUL9 CCHC-type domain-containing protein (Fragment) MANES_12G043300 A0A2C9UUL9_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleic acid binding [GO:0003676];zinc ion binding [GO:0008270] nucleic acid binding [GO:0003676];zinc ion binding [GO:0008270] ELFSHFENLNPDQLMVTEQKR 0.40909 0 14.4593 0 0 0 0 14.4593 0 A0A2C9VLF1 Homeobox domain-containing protein MANES_06G000300 A0A2C9VLF1_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];sequence-specific DNA binding [GO:0043565]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];sequence-specific DNA binding [GO:0043565]" LGMTHYVPK 0.96156 0 14.4693 0 0 0 14.4693 0 0 A0A2C9WA72 Uncharacterized protein MANES_02G018500 A0A2C9WA72_MANES Manihot esculenta (Cassava) (Jatropha manihot) IGAACDGEK 1.0244 14.8691 14.4708 0 14.8691 0 0 14.4708 0 A0A2C9WLN1 TPX2 domain-containing protein MANES_01G097800 A0A2C9WLN1_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitotic spindle assembly [GO:0090307];regulation of mitotic spindle organization [GO:0060236] cytoplasm [GO:0005737];mitotic spindle [GO:0072686];nuclear microtubule [GO:0005880] cytoplasm [GO:0005737];mitotic spindle [GO:0072686];nuclear microtubule [GO:0005880];microtubule binding [GO:0008017];protein kinase activator activity [GO:0030295];mitotic spindle assembly [GO:0090307];regulation of mitotic spindle organization [GO:0060236] microtubule binding [GO:0008017];protein kinase activator activity [GO:0030295] MEEEEEVRRLR 0.95354 0 14.4726 0 0 0 0 0 14.4726 A0A2C9V415 "(1->3)-beta-glucan endohydrolase (EC 3.2.1.39) (Beta-1,3-endoglucanase)" MANES_10G030200 A0A2C9V415_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] anchored component of plasma membrane [GO:0046658] "anchored component of plasma membrane [GO:0046658];glucan endo-1,3-beta-D-glucosidase activity [GO:0042973];carbohydrate metabolic process [GO:0005975]" "glucan endo-1,3-beta-D-glucosidase activity [GO:0042973]" TGLLTPFDPSR 0.95868 0 14.4802 0 0 0 0 0 14.4802 A0A2C9WKC6 Uncharacterized protein MANES_01G086300 A0A2C9WKC6_MANES Manihot esculenta (Cassava) (Jatropha manihot) EEGRQLKW 0.96957 0 14.4849 0 0 0 0 14.4849 0 A0A2C9WBQ0 Uncharacterized protein MANES_02G059900 A0A2C9WBQ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) auxin polar transport [GO:0009926] zinc ion binding [GO:0008270];auxin polar transport [GO:0009926] zinc ion binding [GO:0008270] LGAGENTGGWMVEEFTAQMRAVSK 0 0 14.491 0 0 0 14.3014 14.491 0 A0A2C9U5H4 Uncharacterized protein MANES_17G062200 A0A2C9U5H4_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid metabolic process [GO:0006629] lipase activity [GO:0016298];lipid metabolic process [GO:0006629] lipase activity [GO:0016298] CLYYVGLGSNDYLNNYFLPQR 0.95287 0 14.491 0 0 0 0 14.491 0 A0A2C9U4M0 DYW_deaminase domain-containing protein MANES_17G045300 A0A2C9U4M0_MANES Manihot esculenta (Cassava) (Jatropha manihot) zinc ion binding [GO:0008270] zinc ion binding [GO:0008270] EPAAAIWTAMLGACK 0.98138 12.2447 14.491 12.2447 0 0 0 14.491 0 A0A2C9VKC6 Hydrolase_4 domain-containing protein MANES_07G109000 A0A2C9VKC6_MANES Manihot esculenta (Cassava) (Jatropha manihot) membrane [GO:0016020] membrane [GO:0016020];lipase activity [GO:0016298] lipase activity [GO:0016298] KPEFWDGAIFAAPMCKIADDMR 0.974 0 14.491 0 0 0 14.491 0 0 A0A251JZH8 Uncharacterized protein MANES_10G093200 A0A251JZH8_MANES Manihot esculenta (Cassava) (Jatropha manihot) ASAVLANRNEQNWTQPQPRGGAK 1.0579 0 14.5008 0 0 0 0 14.5008 12.4948 A0A2C9WB13 Uncharacterized protein MANES_02G051300 A0A2C9WB13_MANES Manihot esculenta (Cassava) (Jatropha manihot) KGAQLHPTEVCPYCK 0.97399 0 14.5098 0 0 0 0 14.5098 0 A0A2C9V5Y3 Uncharacterized protein MANES_10G134100 A0A2C9V5Y3_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] LHNCPKLAGK 0.95389 0 14.5196 0 0 0 0 0 14.5196 A0A2C9U5Y4 Uncharacterized protein MANES_17G075800 A0A2C9U5Y4_MANES Manihot esculenta (Cassava) (Jatropha manihot) SPVTAGVTGTR 0.95717 0 14.5241 0 0 0 0 14.5241 0 A0A2C9W8Y6 Uncharacterized protein MANES_03G187400 A0A2C9W8Y6_MANES Manihot esculenta (Cassava) (Jatropha manihot) EDVLALVIHKLPNLGWEAR 0.95621 0 14.5291 0 0 0 14.5291 0 0 A0A2C9UFN0 Galectin domain-containing protein MANES_15G125500 A0A2C9UFN0_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein glycosylation [GO:0006486] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021];carbohydrate binding [GO:0030246];galactosyltransferase activity [GO:0008378];glycosyltransferase activity [GO:0016757];protein glycosylation [GO:0006486] carbohydrate binding [GO:0030246];galactosyltransferase activity [GO:0008378];glycosyltransferase activity [GO:0016757] ITGEIMRR 0.96827 0 14.5328 0 0 0 0 0 14.5328 A0A2C9VVU2 Uncharacterized protein (Fragment) MANES_05G131600 A0A2C9VVU2_MANES Manihot esculenta (Cassava) (Jatropha manihot) ribosomal large subunit assembly [GO:0000027];translation [GO:0006412] cytosolic large ribosomal subunit [GO:0022625] cytosolic large ribosomal subunit [GO:0022625];5S rRNA binding [GO:0008097];structural constituent of ribosome [GO:0003735];ribosomal large subunit assembly [GO:0000027];translation [GO:0006412] 5S rRNA binding [GO:0008097];structural constituent of ribosome [GO:0003735] ARIRLINQDK 0.96539 15.9623 14.5341 15.9532 0 15.9623 0 0 14.5341 A0A2C9VW85 TFIIS N-terminal domain-containing protein MANES_05G145700 A0A2C9VW85_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634] DDSDFSKPERHTR 0.95814 0 14.5345 0 0 0 0 0 14.5345 A0A2C9VD05 Uncharacterized protein MANES_09G160800 A0A2C9VD05_MANES Manihot esculenta (Cassava) (Jatropha manihot) flower development [GO:0009908] flower development [GO:0009908] RSCILLLEQLMKISPEIR 0.96676 0 14.5381 0 0 0 0 0 14.5381 A0A2C9WBC6 Uncharacterized protein MANES_02G057900 A0A2C9WBC6_MANES Manihot esculenta (Cassava) (Jatropha manihot) methylation [GO:0032259] cytoplasm [GO:0005737];intracellular membrane-bounded organelle [GO:0043231];membrane [GO:0016020] cytoplasm [GO:0005737];intracellular membrane-bounded organelle [GO:0043231];membrane [GO:0016020];methyltransferase activity [GO:0008168];methylation [GO:0032259] methyltransferase activity [GO:0008168] GLLWVDRFFCK 0.97653 0 14.5384 0 0 0 0 14.5384 0 A0A2C9W7H0 Uncharacterized protein MANES_03G144600 A0A2C9W7H0_MANES Manihot esculenta (Cassava) (Jatropha manihot) SEFNSGEIFIQKGKER 0.97398 0 14.5476 0 0 0 0 0 14.5476 A0A251L789 Pectinesterase (EC 3.1.1.11) MANES_03G044200 A0A251L789_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910];cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910] MAIIFKNSSSPSKDSTR 0.97422 0 14.5476 0 0 0 0 0 14.5476 A0A2C9VA93 Protein kinase domain-containing protein MANES_09G119200 A0A2C9VA93_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] TQCPGGQKLSPQR 0.9745 0 14.5515 0 0 0 0 0 14.5515 A0A2C9UAZ9 VARLMGL domain-containing protein MANES_16G114300 A0A2C9UAZ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) EGSPMTR 0.96709 13.6367 14.5795 13.6367 0 0 13.5812 0 14.5795 A0A2C9UM86 HP domain-containing protein MANES_14G159100 A0A2C9UM86_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin filament capping [GO:0051693];actin filament organization [GO:0007015] actin filament binding [GO:0051015];actin filament capping [GO:0051693];actin filament organization [GO:0007015] actin filament binding [GO:0051015] VIEGFETVMFRSK 0.97493 0 14.5846 0 0 0 14.5846 0 0 A0A2C9UTV8 Uncharacterized protein MANES_12G052600 A0A2C9UTV8_MANES Manihot esculenta (Cassava) (Jatropha manihot) catalytic step 2 spliceosome [GO:0071013] catalytic step 2 spliceosome [GO:0071013] TPSAVNR 0.98064 0 14.5846 0 0 0 0 0 14.5846 A0A2C9W634 Uncharacterized protein MANES_03G013200 A0A2C9W634_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid transport [GO:0006869] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021] endoplasmic reticulum [GO:0005783];integral component of membrane [GO:0016021];lipid binding [GO:0008289];metal ion binding [GO:0046872];lipid transport [GO:0006869] lipid binding [GO:0008289];metal ion binding [GO:0046872] YQNLRSSRR 0.96483 0 14.5912 0 0 0 0 14.5912 0 A0A2C9VU04 Uncharacterized protein MANES_05G069100 A0A2C9VU04_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737];nucleus [GO:0005634];ribonucleoprotein complex [GO:1990904] cytoplasm [GO:0005737];nucleus [GO:0005634];ribonucleoprotein complex [GO:1990904];mRNA binding [GO:0003729];RNA binding [GO:0003723] mRNA binding [GO:0003729];RNA binding [GO:0003723] HMTEPQLLAMFK 0.95589 0 14.597 0 0 0 14.597 0 0 A0A2C9UDD5 COR domain-containing protein MANES_15G064000 A0A2C9UDD5_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleotide binding [GO:0000166] nucleotide binding [GO:0000166] SLERNASLR 0.95934 15.1424 14.6187 0 15.1424 0 0 14.6187 0 A0A2C9U8M7 HTH myb-type domain-containing protein MANES_16G040600 A0A2C9U8M7_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] QSLFNSHDSIR 1 0 14.6229 0 0 0 14.6229 0 0 A0A251L4Z0 FACT complex subunit MANES_04G151900 A0A251L4Z0_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA repair [GO:0006281];DNA replication [GO:0006260];DNA replication-independent chromatin organization [GO:0034724];positive regulation of transcription elongation from RNA polymerase II promoter [GO:0032968];transcription elongation from RNA polymerase II promoter [GO:0006368] FACT complex [GO:0035101] FACT complex [GO:0035101];nucleosome binding [GO:0031491];DNA repair [GO:0006281];DNA replication [GO:0006260];DNA replication-independent chromatin organization [GO:0034724];positive regulation of transcription elongation from RNA polymerase II promoter [GO:0032968];transcription elongation from RNA polymerase II promoter [GO:0006368] nucleosome binding [GO:0031491] DAEEILNVK 0.96273 16.0957 14.6254 15.8162 16.0957 0 14.6254 0 0 A0A2C9VIA6 Uncharacterized protein MANES_07G035900 A0A2C9VIA6_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] AAIPETPFPDQER 0.95956 0 14.6266 0 0 0 0 14.5762 14.6266 A0A2C9VY26 Glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.-) MANES_05G125200 A0A2C9VY26_MANES Manihot esculenta (Cassava) (Jatropha manihot) glucose metabolic process [GO:0006006] chloroplast [GO:0009507] chloroplast [GO:0009507];glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity [GO:0004365];NAD binding [GO:0051287];NADP binding [GO:0050661];glucose metabolic process [GO:0006006] glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity [GO:0004365];NAD binding [GO:0051287];NADP binding [GO:0050661] GITAEDVNSAFR 0.95571 0 14.6418 0 0 0 0 14.6418 14.6268 A0A2C9VDB2 U6 snRNA-associated Sm-like protein LSm4 LSM4 MANES_09G170300 A0A2C9VDB2_MANES Manihot esculenta (Cassava) (Jatropha manihot) nuclear-transcribed mRNA catabolic process [GO:0000956];P-body assembly [GO:0033962];spliceosomal snRNP assembly [GO:0000387] P-body [GO:0000932];spliceosomal complex [GO:0005681];spliceosomal tri-snRNP complex [GO:0097526];U6 snRNP [GO:0005688] P-body [GO:0000932];spliceosomal complex [GO:0005681];spliceosomal tri-snRNP complex [GO:0097526];U6 snRNP [GO:0005688];RNA binding [GO:0003723];U6 snRNA binding [GO:0017070];nuclear-transcribed mRNA catabolic process [GO:0000956];P-body assembly [GO:0033962];spliceosomal snRNP assembly [GO:0000387] RNA binding [GO:0003723];U6 snRNA binding [GO:0017070] EVICTSKDGDR 0.95973 0 14.6418 0 0 0 0 14.6418 0 A0A2C9UKE3 GUB_WAK_bind domain-containing protein MANES_14G064100 A0A2C9UKE3_MANES Manihot esculenta (Cassava) (Jatropha manihot) polysaccharide binding [GO:0030247] polysaccharide binding [GO:0030247] ACEATGGTCGYGTDGIR 0.98126 0 14.6507 0 0 0 14.6507 0 0 A0A2C9VXP6 SUN domain-containing protein MANES_05G191000 A0A2C9VXP6_MANES Manihot esculenta (Cassava) (Jatropha manihot) nuclear envelope organization [GO:0006998] integral component of nuclear inner membrane [GO:0005639];nuclear envelope [GO:0005635] integral component of nuclear inner membrane [GO:0005639];nuclear envelope [GO:0005635];protein self-association [GO:0043621];protein-membrane adaptor activity [GO:0043495];nuclear envelope organization [GO:0006998] protein-membrane adaptor activity [GO:0043495];protein self-association [GO:0043621] SVAYDRSSAPKDCR 0.96084 0 14.6535 0 0 0 0 14.6535 0 A0A2C9UPJ0 Uncharacterized protein MANES_13G067000 A0A2C9UPJ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to nitrate [GO:0010167] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];nitrate transmembrane transporter activity [GO:0015112];response to nitrate [GO:0010167] nitrate transmembrane transporter activity [GO:0015112] AMIFFFNR 0.96844 0 14.6553 0 0 0 0 0 14.6553 A0A2C9VS81 Uncharacterized protein MANES_06G120500 A0A2C9VS81_MANES Manihot esculenta (Cassava) (Jatropha manihot) phospholipid catabolic process [GO:0009395] "hydrolase activity, acting on ester bonds [GO:0016788];phospholipid catabolic process [GO:0009395]" "hydrolase activity, acting on ester bonds [GO:0016788]" KTVNPAINGVTGR 0.95968 15.9625 14.6613 15.9625 0 0 14.6613 0 0 A0A2C9W452 Uncharacterized protein MANES_04G149600 A0A2C9W452_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid metabolic process [GO:0006629] lipase activity [GO:0016298];lipid metabolic process [GO:0006629] lipase activity [GO:0016298] YGFKVGK 0.97669 15.6381 14.6684 0 15.6381 0 0 14.5461 14.6684 A0A2C9V0D8 GUN4 domain-containing protein MANES_11G120400 A0A2C9V0D8_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast-nucleus signaling pathway [GO:0010019] chloroplast [GO:0009507] chloroplast [GO:0009507];tetrapyrrole binding [GO:0046906];chloroplast-nucleus signaling pathway [GO:0010019] tetrapyrrole binding [GO:0046906] DFTKFFIK 0.96437 0 14.6716 0 0 0 0 14.6716 0 A0A2C9VUN5 Protein kinase domain-containing protein MANES_05G043100 A0A2C9VUN5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] SPNHHQQQQQCRRFSYSLLR 1.008 0 14.6805 0 0 0 0 0 14.6805 A0A2C9W5N6 Methyltranfer_dom domain-containing protein MANES_03G082700 A0A2C9W5N6_MANES Manihot esculenta (Cassava) (Jatropha manihot) TDDNSTLELGLDTSSCNGIMR 0.95969 0 14.695 0 0 0 14.695 0 0 A0A2C9WKD0 NAB domain-containing protein MANES_01G045900 A0A2C9WKD0_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin binding [GO:0003779] actin binding [GO:0003779] QVESWFQESK 0.98499 12.4125 14.7133 0 12.4125 0 0 0 14.7133 A0A2C9UXY8 Protein kinase domain-containing protein MANES_12G151900 A0A2C9UXY8_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular signal transduction [GO:0035556];protein phosphorylation [GO:0006468] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];intracellular signal transduction [GO:0035556];protein phosphorylation [GO:0006468] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] IDEVLQSPEDLER 0.96182 16.6941 14.7157 0 0 16.6941 0 14.7157 0 A0A2C9VJP6 Uncharacterized protein MANES_07G087000 A0A2C9VJP6_MANES Manihot esculenta (Cassava) (Jatropha manihot) INGVDSDGAYNGRSGILHSSSHR 1.0152 0 14.7169 0 0 0 0 14.7169 0 A0A2C9USZ2 Uncharacterized protein MANES_12G024700 A0A2C9USZ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] defense response [GO:0006952] ELCLFEVDEQYFVAK 1.0158 11.021 14.7174 11.021 0 0 14.7174 0 0 A0A2C9WDN1 DNA-directed RNA polymerase (EC 2.7.7.6) MANES_02G061300 A0A2C9WDN1_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial transcription [GO:0006390] mitochondrial DNA-directed RNA polymerase complex [GO:0034245] mitochondrial DNA-directed RNA polymerase complex [GO:0034245];DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899];mitochondrial transcription [GO:0006390] DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899] AYPMHPYLNHLGSDLCR 0.96656 16.0626 14.7318 16.0626 0 0 0 0 14.7318 A0A2C9UEX5 Peroxidase (EC 1.11.1.7) MANES_15G104300 A0A2C9UEX5_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrogen peroxide catabolic process [GO:0042744];response to oxidative stress [GO:0006979] extracellular region [GO:0005576] extracellular region [GO:0005576];heme binding [GO:0020037];metal ion binding [GO:0046872];peroxidase activity [GO:0004601];hydrogen peroxide catabolic process [GO:0042744];response to oxidative stress [GO:0006979] heme binding [GO:0020037];metal ion binding [GO:0046872];peroxidase activity [GO:0004601] EALGNNNSAR 0.96044 0 14.7354 0 0 0 0 14.7354 0 A0A2C9VJ38 Pectinesterase (EC 3.1.1.11) MANES_07G013400 A0A2C9VJ38_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910];cell wall modification [GO:0042545];pectin catabolic process [GO:0045490] aspartyl esterase activity [GO:0045330];pectinesterase activity [GO:0030599];pectinesterase inhibitor activity [GO:0046910] ATIVAASDAVK 1.0186 0 14.7406 0 0 0 14.7406 14.3985 0 A0A251LFK0 Uncharacterized protein MANES_04G025500 A0A251LFK0_MANES Manihot esculenta (Cassava) (Jatropha manihot) phospholipid transporter activity [GO:0005548] phospholipid transporter activity [GO:0005548] LPLENEDAQGKR 0.95592 0 14.7414 0 0 0 14.7414 0 0 A0A2C9VWH0 Uncharacterized protein MANES_05G154000 A0A2C9VWH0_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate binding [GO:0030246] carbohydrate binding [GO:0030246] KGTPIWSEK 0.9641 0 14.7512 0 0 0 0 14.7512 0 V9K755 Glucan water dikinase 1 GWD1 V9K755_MANES Manihot esculenta (Cassava) (Jatropha manihot) cold acclimation [GO:0009631];response to symbiotic fungus [GO:0009610];starch catabolic process [GO:0005983] "alpha-glucan, water dikinase activity [GO:0050521];ATP binding [GO:0005524];mRNA binding [GO:0003729];cold acclimation [GO:0009631];response to symbiotic fungus [GO:0009610];starch catabolic process [GO:0005983]" "alpha-glucan, water dikinase activity [GO:0050521];ATP binding [GO:0005524];mRNA binding [GO:0003729]" RWEKSTTSNER 0.9545 0 14.7567 0 0 0 14.7567 0 0 A0A2C9VNK2 Acyl-[acyl-carrier-protein] hydrolase (EC 3.1.2.-) MANES_06G063300 A0A2C9VNK2_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast [GO:0009507] chloroplast [GO:0009507];acyl carrier activity [GO:0000036];acyl-[acyl-carrier-protein] hydrolase activity [GO:0016297] acyl-[acyl-carrier-protein] hydrolase activity [GO:0016297];acyl carrier activity [GO:0000036] MPEEVRTEISPWFIEKQAIK 0.97524 0 14.7594 0 0 0 0 14.7594 0 A0A2C9U8X1 Uncharacterized protein MANES_16G017800 A0A2C9U8X1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] VVTPSCNLR 0.96127 0 14.7642 0 0 0 0 0 14.7642 A0A2C9WK04 Retrotran_gag_3 domain-containing protein (Fragment) MANES_01G039900 A0A2C9WK04_MANES Manihot esculenta (Cassava) (Jatropha manihot) DKLGFINGKCK 0.96065 0 14.7651 0 0 0 0 14.7651 0 A0A2C9VX21 RNA helicase (EC 3.6.4.13) MANES_05G123500 A0A2C9VX21_MANES Manihot esculenta (Cassava) (Jatropha manihot) spliceosomal complex disassembly [GO:0000390] catalytic step 2 spliceosome [GO:0071013];integral component of membrane [GO:0016021] catalytic step 2 spliceosome [GO:0071013];integral component of membrane [GO:0016021];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];RNA binding [GO:0003723];RNA helicase activity [GO:0003724];spliceosomal complex disassembly [GO:0000390] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];RNA binding [GO:0003723];RNA helicase activity [GO:0003724] DRDRDWR 0.96898 0 14.7682 0 0 0 14.7682 0 14.4306 A0A2C9VBG6 Importin N-terminal domain-containing protein MANES_09G124600 A0A2C9VBG6_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein export from nucleus [GO:0006611];ribosomal large subunit export from nucleus [GO:0000055];ribosomal small subunit export from nucleus [GO:0000056] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];nuclear export signal receptor activity [GO:0005049];small GTPase binding [GO:0031267];protein export from nucleus [GO:0006611];ribosomal large subunit export from nucleus [GO:0000055];ribosomal small subunit export from nucleus [GO:0000056] nuclear export signal receptor activity [GO:0005049];small GTPase binding [GO:0031267] TSETICENCMFILKLLSEEVFDFSRGEMTQQK 0.95876 0 14.7697 0 0 0 0 0 14.7697 A0A2C9UHD0 Uncharacterized protein MANES_15G188200 A0A2C9UHD0_MANES Manihot esculenta (Cassava) (Jatropha manihot) NLGNWILR 0.96901 0 14.7742 0 0 0 0 14.7742 0 A0A2C9V7Q6 Uncharacterized protein MANES_09G040300 A0A2C9V7Q6_MANES Manihot esculenta (Cassava) (Jatropha manihot) embryo sac development [GO:0009553];mRNA processing [GO:0006397];rRNA processing [GO:0006364] nucleolus [GO:0005730];small-subunit processome [GO:0032040] nucleolus [GO:0005730];small-subunit processome [GO:0032040];RNA binding [GO:0003723];embryo sac development [GO:0009553];mRNA processing [GO:0006397];rRNA processing [GO:0006364] RNA binding [GO:0003723] ALLCLPR 0.96726 17.4165 14.7897 0 17.4165 0 0 0 14.7897 A0A251L1J4 UBC core domain-containing protein MANES_04G071900 A0A251L1J4_MANES Manihot esculenta (Cassava) (Jatropha manihot) ubiquitin conjugating enzyme activity [GO:0061631] ubiquitin conjugating enzyme activity [GO:0061631] ERTACVR 0.96762 12.9782 14.7939 12.9782 0 0 14.7939 0 0 A0A2C9UP42 Uncharacterized protein MANES_13G047100 A0A2C9UP42_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin organization [GO:0006325] NuA4 histone acetyltransferase complex [GO:0035267] NuA4 histone acetyltransferase complex [GO:0035267];chromatin organization [GO:0006325] LGCHLPYGFCTTGSQPNTSMGKR 0.98112 0 14.7949 0 0 0 0 0 14.7949 A0A2C9V6F9 Uncharacterized protein MANES_09G003300 A0A2C9V6F9_MANES Manihot esculenta (Cassava) (Jatropha manihot) system development [GO:0048731] system development [GO:0048731] SASASASDHHHHHLSLENSNGVFK 0.9951 0 14.7949 0 0 0 0 0 14.7949 A0A2C9UZ80 Protein kinase domain-containing protein MANES_11G070400 A0A2C9UZ80_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell surface receptor signaling pathway [GO:0007166] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];polysaccharide binding [GO:0030247];protein serine/threonine kinase activity [GO:0004674];cell surface receptor signaling pathway [GO:0007166] ATP binding [GO:0005524];polysaccharide binding [GO:0030247];protein serine/threonine kinase activity [GO:0004674] SHLTTHVKGTFGYVDPEYFQSR 1.0448 0 14.7949 0 0 0 0 0 14.7949 A0A2C9UUZ3 Uncharacterized protein MANES_12G102800 A0A2C9UUZ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) IKEEEEIR 0.96409 0 14.7964 0 0 0 0 0 14.7964 A0A2C9WC79 AAA domain-containing protein MANES_02G089700 A0A2C9WC79_MANES Manihot esculenta (Cassava) (Jatropha manihot) proteolysis [GO:0006508] chloroplast thylakoid [GO:0009534];integral component of membrane [GO:0016021] chloroplast thylakoid [GO:0009534];integral component of membrane [GO:0016021];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];ATP-dependent peptidase activity [GO:0004176];metalloendopeptidase activity [GO:0004222];proteolysis [GO:0006508] ATP binding [GO:0005524];ATP-dependent peptidase activity [GO:0004176];ATP hydrolysis activity [GO:0016887];metalloendopeptidase activity [GO:0004222] QVTVDVPDIR 0.96103 0 14.7982 0 0 0 0 14.7982 0 A0A2C9VJC6 Protein kinase domain-containing protein MANES_07G073900 A0A2C9VJC6_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] MGIALSSCYGSLDEWLR 0.9992 0 14.7984 0 0 0 14.7984 0 0 A0A2C9UD70 DRIM domain-containing protein MANES_15G056200 A0A2C9UD70_MANES Manihot esculenta (Cassava) (Jatropha manihot) QLAHEVCGSVR 0.95685 0 14.7985 0 0 0 0 0 14.7985 A0A2C9U0J0 Fmp27_GFWDK domain-containing protein MANES_18G056500 A0A2C9U0J0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] LLLDDIR 0.96653 15.993 14.8041 0 15.993 0 14.8041 0 0 A0A2C9WKT8 Fructose-bisphosphate aldolase (EC 4.1.2.13) MANES_01G143100 A0A2C9WKT8_MANES Manihot esculenta (Cassava) (Jatropha manihot) "fructose 1,6-bisphosphate metabolic process [GO:0030388];glycolytic process [GO:0006096]" cytosol [GO:0005829] "cytosol [GO:0005829];fructose-bisphosphate aldolase activity [GO:0004332];fructose 1,6-bisphosphate metabolic process [GO:0030388];glycolytic process [GO:0006096]" fructose-bisphosphate aldolase activity [GO:0004332] ATPEQVADYTLK 0.99908 0 14.8073 0 0 0 0 14.8073 0 A0A2C9WIT7 Transaldolase (EC 2.2.1.2) MANES_01G076600 A0A2C9WIT7_MANES Manihot esculenta (Cassava) (Jatropha manihot) "carbohydrate metabolic process [GO:0005975];pentose-phosphate shunt, non-oxidative branch [GO:0009052]" cytoplasm [GO:0005737] "cytoplasm [GO:0005737];transaldolase activity [GO:0004801];carbohydrate metabolic process [GO:0005975];pentose-phosphate shunt, non-oxidative branch [GO:0009052]" transaldolase activity [GO:0004801] SSLQGERLR 0.9593 0 14.808 0 0 0 14.194 0 14.808 A0A2C9VPL7 Clu domain-containing protein MANES_06G032200 A0A2C9VPL7_MANES Manihot esculenta (Cassava) (Jatropha manihot) organelle organization [GO:0006996] cytoplasm [GO:0005737] cytoplasm [GO:0005737];organelle organization [GO:0006996] LNTNFMNVSQLPR 0.95994 18.686 14.8172 18.686 13.0524 18.1736 14.8172 0 0 A0A2C9WC71 PsbP domain-containing protein MANES_02G089900 A0A2C9WC71_MANES Manihot esculenta (Cassava) (Jatropha manihot) photosynthesis [GO:0015979] chloroplast [GO:0009507];extrinsic component of membrane [GO:0019898];photosystem II oxygen evolving complex [GO:0009654] chloroplast [GO:0009507];extrinsic component of membrane [GO:0019898];photosystem II oxygen evolving complex [GO:0009654];calcium ion binding [GO:0005509];photosynthesis [GO:0015979] calcium ion binding [GO:0005509] EFPGQVLR 0.95629 16.7255 14.8205 15.0705 16.7255 0 0 14.8205 0 A0A2C9UUJ3 Glutamate receptor MANES_12G075200 A0A2C9UUJ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ligand-gated ion channel activity [GO:0015276];signaling receptor activity [GO:0038023] ligand-gated ion channel activity [GO:0015276];signaling receptor activity [GO:0038023] FLSRWNNLK 0.95969 0 14.825 0 0 0 0 14.825 0 A0A2C9VYX4 SWIRM domain-containing protein MANES_05G151700 A0A2C9VYX4_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin organization [GO:0006325];histone modification [GO:0016570];polyamine catabolic process [GO:0006598] oxidoreductase activity [GO:0016491];polyamine oxidase activity [GO:0046592];chromatin organization [GO:0006325];histone modification [GO:0016570];polyamine catabolic process [GO:0006598] oxidoreductase activity [GO:0016491];polyamine oxidase activity [GO:0046592] PIENCLFFAGEATCK 0.9742 0 14.8295 0 0 0 0 14.8295 0 A0A2C9UQ90 CRM domain-containing protein MANES_13G055400 A0A2C9UQ90_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] ILYKLKK 0.96198 17.3082 14.8333 14.3523 0 17.3082 14.8333 0 0 A0A2C9UCL0 Cryptochrome DASH MANES_16G136800 A0A2C9UCL0_MANES Manihot esculenta (Cassava) (Jatropha manihot) photoreactive repair [GO:0000719];protein-chromophore linkage [GO:0018298] DNA binding [GO:0003677];DNA photolyase activity [GO:0003913];FAD binding [GO:0071949];photoreactive repair [GO:0000719];protein-chromophore linkage [GO:0018298] DNA binding [GO:0003677];DNA photolyase activity [GO:0003913];FAD binding [GO:0071949] GMKFLGGETAALSR 1.0054 0 14.8403 0 0 0 0 14.8403 0 A0A2C9VUB8 IPPc domain-containing protein MANES_05G078800 A0A2C9VUB8_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphatidylinositol dephosphorylation [GO:0046856] "phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity [GO:0034485];phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity [GO:0004439];phosphatidylinositol dephosphorylation [GO:0046856]" "phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity [GO:0034485];phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity [GO:0004439]" FSICDRVIFGHRPSDYDPNFK 0.98084 0 14.8431 0 0 0 0 14.8431 0 A0A2C9V3R8 Uncharacterized protein MANES_10G056600 A0A2C9V3R8_MANES Manihot esculenta (Cassava) (Jatropha manihot) phototropism [GO:0009638] phototropism [GO:0009638] PPITLPNPIKTFHTTVNAK 0.98313 0 14.8472 0 0 0 0 0 14.8472 Q9TLH3 Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) Q9TLH3_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbon fixation [GO:0015977];photorespiration [GO:0009853];photosynthesis [GO:0015979] chloroplast [GO:0009507] chloroplast [GO:0009507];carbon fixation [GO:0015977];photorespiration [GO:0009853];photosynthesis [GO:0015979] ELDELIK 0.96931 16.8882 14.8587 11.9057 16.8882 0 0 14.8587 13.6827 A0A2C9WNZ0 zinc_ribbon_12 domain-containing protein MANES_01G248100 A0A2C9WNZ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of defense response to fungus [GO:1900150] regulation of defense response to fungus [GO:1900150] DRAELLR 0.97356 0 14.8655 0 0 0 13.3712 14.8655 0 A0A2C9USQ8 Uncharacterized protein MANES_13G136000 A0A2C9USQ8_MANES Manihot esculenta (Cassava) (Jatropha manihot) AWLFFNWASGLK 0.95602 13.2823 14.8671 0 13.2823 0 0 14.8671 14.5352 A0A2C9W819 Uncharacterized protein MANES_03G093000 A0A2C9W819_MANES Manihot esculenta (Cassava) (Jatropha manihot) EGLIDEAYKIFR 0.96272 14.8356 14.8706 14.8356 0 0 0 14.8706 0 A0A2C9VPU1 Cysteinyl-tRNA synthetase (EC 6.1.1.16) MANES_06G066100 A0A2C9VPU1_MANES Manihot esculenta (Cassava) (Jatropha manihot) cysteinyl-tRNA aminoacylation [GO:0006423] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ATP binding [GO:0005524];cysteine-tRNA ligase activity [GO:0004817];metal ion binding [GO:0046872];cysteinyl-tRNA aminoacylation [GO:0006423] ATP binding [GO:0005524];cysteine-tRNA ligase activity [GO:0004817];metal ion binding [GO:0046872] CINKLREEFESK 0.96042 0 14.8716 0 0 0 0 11.8241 14.8716 A0A2C9UGK9 Uncharacterized protein MANES_15G133300 A0A2C9UGK9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] VSTNSTTSDLQEK 1.0085 0 14.8764 0 0 0 14.8764 0 0 A0A2C9WL80 Uncharacterized protein MANES_01G116700 A0A2C9WL80_MANES Manihot esculenta (Cassava) (Jatropha manihot) calcium ion binding [GO:0005509] calcium ion binding [GO:0005509] MIGLKCTLGDCTKMIR 0.9856 0 14.8817 0 0 0 0 0 14.8817 A0A2C9WEN3 HP domain-containing protein MANES_02G120200 A0A2C9WEN3_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin filament capping [GO:0051693];actin filament organization [GO:0007015];actin filament severing [GO:0051014] actin cytoskeleton [GO:0015629] actin cytoskeleton [GO:0015629];actin filament binding [GO:0051015];actin filament capping [GO:0051693];actin filament organization [GO:0007015];actin filament severing [GO:0051014] actin filament binding [GO:0051015] SFFESWPQVEPNLYEEGRGK 0.98123 0 14.8995 0 0 0 0 0 14.8995 A0A2C9VWK0 Cytokinin dehydrogenase (EC 1.5.99.12) MANES_05G154200 A0A2C9VWK0_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytokinin metabolic process [GO:0009690] cytokinin dehydrogenase activity [GO:0019139];FAD binding [GO:0071949];oxidoreductase activity [GO:0016491];cytokinin metabolic process [GO:0009690] cytokinin dehydrogenase activity [GO:0019139];FAD binding [GO:0071949];oxidoreductase activity [GO:0016491] MEFDPRRILATGQR 0.96277 0 14.9091 0 0 0 0 0 14.9091 A0A199UB96 Uncharacterized protein MANES_S035800 A0A199UB96_MANES Manihot esculenta (Cassava) (Jatropha manihot) GFDMGIGWEANMER 0.97878 0 14.912 0 0 0 0 14.912 0 A0A2C9V207 Uncharacterized protein MANES_11G100700 A0A2C9V207_MANES Manihot esculenta (Cassava) (Jatropha manihot) ENQSTGK 0.95992 14.7869 14.9136 14.7869 0 0 0 14.9136 0 A0A2C9WIY2 Uncharacterized protein MANES_01G000300 A0A2C9WIY2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] EFHNLSCTSPHAGR 0.98483 0 14.9166 0 0 0 0 0 14.9166 A0A251JIL4 NAB domain-containing protein MANES_15G031600 A0A251JIL4_MANES Manihot esculenta (Cassava) (Jatropha manihot) plasma membrane [GO:0005886] plasma membrane [GO:0005886];actin filament binding [GO:0051015] actin filament binding [GO:0051015] KANDAELER 0.96413 0 14.918 0 0 0 0 0 14.918 A0A2C9WE01 Uncharacterized protein MANES_02G098500 A0A2C9WE01_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] ribosome [GO:0005840] ribosome [GO:0005840];structural constituent of ribosome [GO:0003735];translation [GO:0006412] structural constituent of ribosome [GO:0003735] GGAGAAAKGEEK 0.96699 0 14.918 0 0 0 13.8926 14.682 14.918 A0A251K1B9 Protein kinase domain-containing protein MANES_10G123000 A0A251K1B9_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular signal transduction [GO:0035556];protein phosphorylation [GO:0006468] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];intracellular signal transduction [GO:0035556];protein phosphorylation [GO:0006468] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] YFFQQLISGVSYCHSLQICHR 0.95204 0 14.9189 0 0 0 0 0 14.9189 A0A2C9U3C3 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase (EC 3.2.2.6) MANES_18G111500 A0A2C9U3C3_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953];defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953] LNSIDLSHSR 0.95927 0 14.9191 0 0 0 0 0 14.9191 A0A2C9VER9 Myb-like domain-containing protein MANES_08G092900 A0A2C9VER9_MANES Manihot esculenta (Cassava) (Jatropha manihot) EAFDARENDRR 0.96093 0 14.9204 0 0 0 14.9204 0 0 A0A251JD02 MBD domain-containing protein MANES_14G133700 A0A251JD02_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677] DNA binding [GO:0003677] SEEAEEGKGNVDDDKVQGEDEQPQVEASEGQK 1.0618 0 14.9241 0 0 0 0 14.9241 0 A0A2C9W0C4 Uncharacterized protein MANES_05G203600 A0A2C9W0C4_MANES Manihot esculenta (Cassava) (Jatropha manihot) "meristem initiation [GO:0010014];regulation of transcription, DNA-templated [GO:0006355];secondary shoot formation [GO:0010223]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565];meristem initiation [GO:0010014];regulation of transcription, DNA-templated [GO:0006355];secondary shoot formation [GO:0010223]" DNA-binding transcription factor activity [GO:0003700];sequence-specific DNA binding [GO:0043565] EIMNIVAADGEDR 0.95903 0 14.9296 0 0 0 0 14.9296 0 A0A2C9V0Z7 DUF1995 domain-containing protein MANES_11G065200 A0A2C9V0Z7_MANES Manihot esculenta (Cassava) (Jatropha manihot) IRLEIDFPPLPSNISSYK 0.97182 0 14.93 0 0 0 0 14.93 0 A0A199U960 Uncharacterized protein MANES_S112700 A0A199U960_MANES Manihot esculenta (Cassava) (Jatropha manihot) electron transport chain [GO:0022900] "cytochrome-b5 reductase activity, acting on NAD(P)H [GO:0004128];molybdenum ion binding [GO:0030151];molybdopterin cofactor binding [GO:0043546];electron transport chain [GO:0022900]" "cytochrome-b5 reductase activity, acting on NAD(P)H [GO:0004128];molybdenum ion binding [GO:0030151];molybdopterin cofactor binding [GO:0043546]" DNRVLPSHVDAELANAEGWWYK 1.0449 0 14.9557 0 0 0 14.9557 0 0 A0A2C9VPX7 Uncharacterized protein MANES_06G114100 A0A2C9VPX7_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin remodeling [GO:0006338];regulation of macromolecule metabolic process [GO:0060255] nucleus [GO:0005634] nucleus [GO:0005634];histone demethylase activity [GO:0032452];histone H3-tri/di/monomethyl-lysine-4 demethylase activity [GO:0034647];chromatin remodeling [GO:0006338];regulation of macromolecule metabolic process [GO:0060255] histone demethylase activity [GO:0032452];histone H3-tri/di/monomethyl-lysine-4 demethylase activity [GO:0034647] DEEAEYQCDIEGCTMSFGSKQELAVHKR 0.95704 17.3408 14.9669 0 17.3408 13.2517 12.0407 13.229 14.9669 B1NWD0 Photosystem II protein D1 (PSII D1 protein) (EC 1.10.3.9) (Photosystem II Q(B) protein) psbA PSBA_MANES Manihot esculenta (Cassava) (Jatropha manihot) photosynthetic electron transport in photosystem II [GO:0009772];protein-chromophore linkage [GO:0018298];response to herbicide [GO:0009635] chloroplast thylakoid membrane [GO:0009535];integral component of membrane [GO:0016021];photosystem II [GO:0009523] "chloroplast thylakoid membrane [GO:0009535];integral component of membrane [GO:0016021];photosystem II [GO:0009523];chlorophyll binding [GO:0016168];electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity [GO:0045156];iron ion binding [GO:0005506];oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor [GO:0016682];oxygen evolving activity [GO:0010242];photosynthetic electron transport in photosystem II [GO:0009772];protein-chromophore linkage [GO:0018298];response to herbicide [GO:0009635]" "chlorophyll binding [GO:0016168];electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity [GO:0045156];iron ion binding [GO:0005506];oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor [GO:0016682];oxygen evolving activity [GO:0010242]" LIFQYASFNNSR 0.96308 17.8786 14.9743 0 17.8786 0 0 0 14.9743 A0A251JEV4 Metallophos domain-containing protein MANES_14G173500 A0A251JEV4_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrolase activity [GO:0016787] hydrolase activity [GO:0016787] ASKSSVLGNHDYR 0.97523 0 14.9751 0 0 0 14.9751 0 0 A0A2C9VYH0 Ribulose bisphosphate carboxylase small subunit (RuBisCO small subunit) MANES_05G137400 A0A2C9VYH0_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbon fixation [GO:0015977];photorespiration [GO:0009853];photosynthesis [GO:0015979] plastid [GO:0009536] plastid [GO:0009536];carbon fixation [GO:0015977];photorespiration [GO:0009853];photosynthesis [GO:0015979] ELDELIK 0.97414 0 14.9792 0 0 0 0 0 14.9792 A0A2C9ULQ3 ATP:AMP phosphotransferase (EC 2.7.4.3) MANES_14G139700 A0A2C9ULQ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleoside diphosphate phosphorylation [GO:0006165];nucleoside triphosphate biosynthetic process [GO:0009142] cytoplasm [GO:0005737] cytoplasm [GO:0005737];adenylate kinase activity [GO:0004017];ATP binding [GO:0005524];cytidylate kinase activity [GO:0004127];nucleoside diphosphate kinase activity [GO:0004550];nucleoside diphosphate phosphorylation [GO:0006165];nucleoside triphosphate biosynthetic process [GO:0009142] adenylate kinase activity [GO:0004017];ATP binding [GO:0005524];cytidylate kinase activity [GO:0004127];nucleoside diphosphate kinase activity [GO:0004550] VDQPSGAEKYEILETFSEKPSSDDVNNAFLGK 1.0657 0 14.982 0 0 0 14.982 0 0 A0A2C9UZC4 PRA-CH domain-containing protein MANES_11G075000 A0A2C9UZC4_MANES Manihot esculenta (Cassava) (Jatropha manihot) histidine biosynthetic process [GO:0000105] ATP binding [GO:0005524];phosphoribosyl-AMP cyclohydrolase activity [GO:0004635];phosphoribosyl-ATP diphosphatase activity [GO:0004636];histidine biosynthetic process [GO:0000105] ATP binding [GO:0005524];phosphoribosyl-AMP cyclohydrolase activity [GO:0004635];phosphoribosyl-ATP diphosphatase activity [GO:0004636] CRFTQSGIEEK 0.96011 0 14.9833 0 0 0 0 14.9833 0 A0A2C9VT53 Fe2OG dioxygenase domain-containing protein MANES_06G173300 A0A2C9VT53_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] metal ion binding [GO:0046872];oxidoreductase activity [GO:0016491] ETAHNFFGQPPEK 0.95991 13.2293 14.9905 0 13.2293 0 0 0 14.9905 A0A2C9WEK3 Foie-gras_1 domain-containing protein MANES_02G116600 A0A2C9WEK3_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi to endosome transport [GO:0006895] cytosol [GO:0005829] cytosol [GO:0005829];Golgi to endosome transport [GO:0006895] RSYESYTNLKAQR 0.96305 0 14.9919 0 0 0 0 14.9919 0 A0A2C9UPE0 Protein ZIP4 homolog MANES_13G056300 A0A2C9UPE0_MANES Manihot esculenta (Cassava) (Jatropha manihot) female meiotic nuclear division [GO:0007143];male meiotic nuclear division [GO:0007140];resolution of meiotic recombination intermediates [GO:0000712] chromosome [GO:0005694] chromosome [GO:0005694];female meiotic nuclear division [GO:0007143];male meiotic nuclear division [GO:0007140];resolution of meiotic recombination intermediates [GO:0000712] ARTAWEVSDR 0.95919 0 14.997 0 0 0 0 0 14.997 A0A2C9VZ03 Uncharacterized protein MANES_04G027700 A0A2C9VZ03_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];acetylglucosaminyltransferase activity [GO:0008375] acetylglucosaminyltransferase activity [GO:0008375] TSTLYLWVGKCRR 0.95785 0 15.0159 0 0 0 15.0159 0 0 A0A2C9VZH0 Aa_trans domain-containing protein MANES_05G169100 A0A2C9VZH0_MANES Manihot esculenta (Cassava) (Jatropha manihot) amino acid transport [GO:0006865];auxin-activated signaling pathway [GO:0009734] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];symporter activity [GO:0015293];amino acid transport [GO:0006865];auxin-activated signaling pathway [GO:0009734] symporter activity [GO:0015293] LKFFKPPN 0.965 14.76 15.0159 14.76 0 0 15.0159 0 0 A0A2C9WPA4 Non-specific serine/threonine protein kinase (EC 2.7.11.1) MANES_01G261000 A0A2C9WPA4_MANES Manihot esculenta (Cassava) (Jatropha manihot) signal transduction [GO:0007165] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];signal transduction [GO:0007165] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] LIPEHARKEDC 0.96038 0 15.0232 0 0 0 15.0232 0 0 A0A251JWM8 Uncharacterized protein MANES_11G159700 A0A251JWM8_MANES Manihot esculenta (Cassava) (Jatropha manihot) VSQLESEITSLDR 0.95993 0 15.0248 0 0 0 0 0 15.0248 A0A2C9VB22 Uncharacterized protein MANES_09G104600 A0A2C9VB22_MANES Manihot esculenta (Cassava) (Jatropha manihot) PRNLQSK 0.9645 0 15.0304 0 0 0 0 0 15.0304 A0A2C9UST6 BZIP domain-containing protein MANES_13G139500 A0A2C9UST6_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA-binding transcription factor activity [GO:0003700] DNA-binding transcription factor activity [GO:0003700] EQLLLQV 0.95476 0 15.0354 0 0 0 0 0 15.0354 A0A2C9UD08 Methyltransferase (EC 2.1.1.-) MANES_15G041600 A0A2C9UD08_MANES Manihot esculenta (Cassava) (Jatropha manihot) methylation [GO:0032259] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];intracellular membrane-bounded organelle [GO:0043231];methyltransferase activity [GO:0008168];methylation [GO:0032259] methyltransferase activity [GO:0008168] LDLSVMEHYERHCPPPER 0.96683 0 15.0422 0 0 0 0 0 15.0422 A0A2C9V1C9 Shugoshin_C domain-containing protein MANES_11G151800 A0A2C9V1C9_MANES Manihot esculenta (Cassava) (Jatropha manihot) maintenance of meiotic sister chromatid cohesion [GO:0034090] "chromosome, centromeric region [GO:0000775];nucleus [GO:0005634]" "chromosome, centromeric region [GO:0000775];nucleus [GO:0005634];maintenance of meiotic sister chromatid cohesion [GO:0034090]" NLRMHYQK 0.96257 0 15.0444 0 0 0 0 15.0444 0 A0A2C9VEZ1 Uncharacterized protein MANES_08G018000 A0A2C9VEZ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) AADQMTGQTFNDVER 1.0397 0 15.0546 0 0 0 15.0546 0 0 A0A2C9U623 Uncharacterized protein MANES_17G030600 A0A2C9U623_MANES Manihot esculenta (Cassava) (Jatropha manihot) FCHERYSNIVRR 0.95827 0 15.0601 0 0 0 15.0601 0 0 A0A2C9WIP6 LEA_2 domain-containing protein MANES_02G226500 A0A2C9WIP6_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] ATTHAPPSR 0.96128 0 15.0601 0 0 0 15.0601 0 0 A0A2C9WHF8 EF-hand domain-containing protein MANES_01G034200 A0A2C9WHF8_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];calcium ion binding [GO:0005509];nuclear receptor coactivator activity [GO:0030374];regulation of transcription, DNA-templated [GO:0006355]" calcium ion binding [GO:0005509];nuclear receptor coactivator activity [GO:0030374] DDKAGYLR 0.96495 0 15.0601 0 0 0 15.0601 0 0 A0A2C9WLE1 Asparagine--tRNA ligase (EC 6.1.1.22) MANES_01G080800 A0A2C9WLE1_MANES Manihot esculenta (Cassava) (Jatropha manihot) asparaginyl-tRNA aminoacylation [GO:0006421] mitochondrion [GO:0005739] mitochondrion [GO:0005739];asparagine-tRNA ligase activity [GO:0004816];ATP binding [GO:0005524];DNA binding [GO:0003677];asparaginyl-tRNA aminoacylation [GO:0006421] asparagine-tRNA ligase activity [GO:0004816];ATP binding [GO:0005524];DNA binding [GO:0003677] LEYLEDR 0.96693 0 15.0601 0 0 0 15.0601 0 0 A0A2C9WJK2 Uncharacterized protein MANES_01G061000 A0A2C9WJK2_MANES Manihot esculenta (Cassava) (Jatropha manihot) RKDFTDR 0.96796 0 15.0601 0 0 0 15.0601 0 0 A0A2C9VB84 BES1_N domain-containing protein MANES_09G111000 A0A2C9VB84_MANES Manihot esculenta (Cassava) (Jatropha manihot) "brassinosteroid mediated signaling pathway [GO:0009742];transcription, DNA-templated [GO:0006351]" "DNA-binding transcription factor activity [GO:0003700];brassinosteroid mediated signaling pathway [GO:0009742];transcription, DNA-templated [GO:0006351]" DNA-binding transcription factor activity [GO:0003700] QHGNYKLPRHALCEEAGWHVEVDGTVYR 0.97972 0 15.0628 0 0 0 0 0 15.0628 A0A2C9WB20 HECT-type E3 ubiquitin transferase (EC 2.3.2.26) MANES_03G208600 A0A2C9WB20_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein polyubiquitination [GO:0000209];ubiquitin-dependent protein catabolic process [GO:0006511] ubiquitin protein ligase activity [GO:0061630];protein polyubiquitination [GO:0000209];ubiquitin-dependent protein catabolic process [GO:0006511] ubiquitin protein ligase activity [GO:0061630] LREQFHGTYGK 0.96013 0 15.065 0 0 0 0 15.065 0 A0A2C9WM69 Vacuolar protein sorting-associated protein 35 MANES_01G148800 A0A2C9WM69_MANES Manihot esculenta (Cassava) (Jatropha manihot) "intracellular protein transport [GO:0006886];retrograde transport, endosome to Golgi [GO:0042147]" "cytosol [GO:0005829];late endosome [GO:0005770];retromer, cargo-selective complex [GO:0030906];retromer complex [GO:0030904]" "cytosol [GO:0005829];late endosome [GO:0005770];retromer complex [GO:0030904];retromer, cargo-selective complex [GO:0030906];intracellular protein transport [GO:0006886];retrograde transport, endosome to Golgi [GO:0042147]" YLYFFER 0.9549 14.4582 15.066 14.0351 0 14.4582 15.066 0 0 A0A2C9WDE1 Protein kinase domain-containing protein MANES_02G129400 A0A2C9WDE1_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to bacterium [GO:0042742];defense response to oomycetes [GO:0002229] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];carbohydrate binding [GO:0030246];transmembrane receptor protein serine/threonine kinase activity [GO:0004675];defense response to bacterium [GO:0042742];defense response to oomycetes [GO:0002229] ATP binding [GO:0005524];carbohydrate binding [GO:0030246];transmembrane receptor protein serine/threonine kinase activity [GO:0004675] KYEEIREDWELQYGPQR 0.96563 0 15.0677 0 0 0 0 15.0677 0 A0A2C9U6B3 Non-specific serine/threonine protein kinase (EC 2.7.11.1) MANES_17G057200 A0A2C9U6B3_MANES Manihot esculenta (Cassava) (Jatropha manihot) signal transduction [GO:0007165] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];signal transduction [GO:0007165] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] RITSLPR 0.96647 0 15.0699 0 0 0 0 15.0699 0 A0A2C9WKK1 Uncharacterized protein MANES_01G090000 A0A2C9WKK1_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of macromolecule metabolic process [GO:0060255];regulation of nitrogen compound metabolic process [GO:0051171];regulation of primary metabolic process [GO:0080090] DNA binding [GO:0003677];metal ion binding [GO:0046872];RNA binding [GO:0003723];regulation of macromolecule metabolic process [GO:0060255];regulation of nitrogen compound metabolic process [GO:0051171];regulation of primary metabolic process [GO:0080090] DNA binding [GO:0003677];metal ion binding [GO:0046872];RNA binding [GO:0003723] EMADWLTPSENAK 0.95965 0 15.0841 0 0 0 15.0841 0 0 A0A2C9WK17 Uncharacterized protein MANES_01G104900 A0A2C9WK17_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell morphogenesis [GO:0000902] cell morphogenesis [GO:0000902] VLDKCALGR 0.98305 0 15.0868 0 0 0 15.0868 0 0 A0A2C9U749 Glyco_trans_2-like domain-containing protein MANES_17G124500 A0A2C9U749_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];glycosyltransferase activity [GO:0016757] glycosyltransferase activity [GO:0016757] EVYAQSISAACQLDWPRDR 0.96982 0 15.0911 0 0 0 0 15.0911 0 A0A2C9WJG0 Hexosyltransferase (EC 2.4.1.-) MANES_01G105500 A0A2C9WJG0_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall organization [GO:0071555];pectin biosynthetic process [GO:0045489] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021];polygalacturonate 4-alpha-galacturonosyltransferase activity [GO:0047262];cell wall organization [GO:0071555];pectin biosynthetic process [GO:0045489] polygalacturonate 4-alpha-galacturonosyltransferase activity [GO:0047262] HVFHVVTDR 0.96052 14.4855 15.0966 0 14.4855 0 0 15.0966 0 A0A2C9UFK6 Uncharacterized protein MANES_15G101400 A0A2C9UFK6_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] ATP binding [GO:0005524];cytoskeletal motor activity [GO:0003774];microtubule binding [GO:0008017];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];cytoskeletal motor activity [GO:0003774];microtubule binding [GO:0008017] LLIKPEKEEK 0.96569 15.9532 15.0985 15.9532 0 0 13.9905 15.0985 0 A0A2C9UXX5 Uncharacterized protein MANES_11G026100 A0A2C9UXX5_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein folding [GO:0006457];protein refolding [GO:0042026] mitochondrion [GO:0005739] mitochondrion [GO:0005739];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];protein folding [GO:0006457];protein refolding [GO:0042026] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] APGFGDNR 1.0017 0 15.1019 0 0 0 0 0 15.1019 A0A2C9V7H2 F-box domain-containing protein (Fragment) MANES_09G032300 A0A2C9V7H2_MANES Manihot esculenta (Cassava) (Jatropha manihot) SAINLSINPSCPWYER 0.97322 12.4591 15.1042 12.4591 0 0 13.0598 15.1042 0 A0A2C9WP57 Uncharacterized protein MANES_01G255300 A0A2C9WP57_MANES Manihot esculenta (Cassava) (Jatropha manihot) "anatomical structure development [GO:0048856];positive regulation of transcription by RNA polymerase II [GO:0045944];regulation of gene expression, epigenetic [GO:0040029]" nucleus [GO:0005634] "nucleus [GO:0005634];ATP binding [GO:0005524];ATP-dependent activity, acting on DNA [GO:0008094];DNA binding [GO:0003677];helicase activity [GO:0004386];anatomical structure development [GO:0048856];positive regulation of transcription by RNA polymerase II [GO:0045944];regulation of gene expression, epigenetic [GO:0040029]" "ATP binding [GO:0005524];ATP-dependent activity, acting on DNA [GO:0008094];DNA binding [GO:0003677];helicase activity [GO:0004386]" DGSSVSK 0.95347 0 15.1054 0 0 0 0 15.1054 0 A0A2C9VRZ0 Uncharacterized protein MANES_05G002600 A0A2C9VRZ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) PASLSSEQAR 0.95956 0 15.1124 0 0 0 0 15.1124 0 A0A2C9WGI6 Ribonucleoside-diphosphate reductase (EC 1.17.4.1) MANES_02G181900 A0A2C9WGI6_MANES Manihot esculenta (Cassava) (Jatropha manihot) deoxyribonucleotide biosynthetic process [GO:0009263];DNA replication [GO:0006260] ribonucleoside-diphosphate reductase complex [GO:0005971] "ribonucleoside-diphosphate reductase complex [GO:0005971];ATP binding [GO:0005524];ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor [GO:0004748];deoxyribonucleotide biosynthetic process [GO:0009263];DNA replication [GO:0006260]" "ATP binding [GO:0005524];ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor [GO:0004748]" IMYNYVDK 0.96702 0 15.1335 0 0 0 15.1335 0 0 A0A2C9WPG6 Uncharacterized protein MANES_01G271800 A0A2C9WPG6_MANES Manihot esculenta (Cassava) (Jatropha manihot) "chloroplast organization [GO:0009658];developmental process [GO:0032502];DNA-templated transcription, termination [GO:0006353];mitochondrion organization [GO:0007005];regulation of transcription, DNA-templated [GO:0006355]" chloroplast [GO:0009507];mitochondrion [GO:0005739] "chloroplast [GO:0009507];mitochondrion [GO:0005739];double-stranded DNA binding [GO:0003690];chloroplast organization [GO:0009658];developmental process [GO:0032502];DNA-templated transcription, termination [GO:0006353];mitochondrion organization [GO:0007005];regulation of transcription, DNA-templated [GO:0006355]" double-stranded DNA binding [GO:0003690] FHMWLTDRGAQK 0.95099 0 15.1336 0 0 0 0 15.1336 0 A0A2C9V752 Uncharacterized protein MANES_10G105500 A0A2C9V752_MANES Manihot esculenta (Cassava) (Jatropha manihot) cysteine-type endopeptidase activity [GO:0004197] cysteine-type endopeptidase activity [GO:0004197] MCAQFDKEYAQGKWK 0.9959 0 15.1515 0 0 0 0 0 15.1515 A0A2C9U1L0 Ubiquitinyl hydrolase 1 (EC 3.4.19.12) MANES_18G079200 A0A2C9U1L0_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein deubiquitination [GO:0016579];seed development [GO:0048316];ubiquitin-dependent protein catabolic process [GO:0006511] cytosol [GO:0005829];nucleus [GO:0005634] cytosol [GO:0005829];nucleus [GO:0005634];cysteine-type endopeptidase activity [GO:0004197];thiol-dependent deubiquitinase [GO:0004843];protein deubiquitination [GO:0016579];seed development [GO:0048316];ubiquitin-dependent protein catabolic process [GO:0006511] cysteine-type endopeptidase activity [GO:0004197];thiol-dependent deubiquitinase [GO:0004843] LDGTYYVSK 0.96191 0 15.1531 0 0 0 14.7406 15.1531 0 A0A2C9UHT0 Uncharacterized protein MANES_14G005100 A0A2C9UHT0_MANES Manihot esculenta (Cassava) (Jatropha manihot) NHVGRETENILLNEMESKLNLASAIR 1.0347 0 15.1672 0 0 0 0 0 15.1672 A0A2C9VHJ2 G-patch domain-containing protein MANES_08G107500 A0A2C9VHJ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872];nucleic acid binding [GO:0003676] metal ion binding [GO:0046872];nucleic acid binding [GO:0003676] KREVLAER 0.96954 16.0947 15.1717 0 16.0947 0 0 15.1717 15.1347 A0A2C9WHZ1 TIR domain-containing protein MANES_02G202100 A0A2C9WHZ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953];defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953] PTNGFDVCLPGSEIPEWFK 1.0019 0 15.1766 0 0 0 15.1766 0 0 A0A2C9VNZ6 Uncharacterized protein MANES_06G031800 A0A2C9VNZ6_MANES Manihot esculenta (Cassava) (Jatropha manihot) HFEKLIQCDMR 0.96666 0 15.1834 0 0 0 15.1834 13.0191 0 A0A251IVJ3 "Chlorophyll a-b binding protein, chloroplastic" MANES_17G066800 MANES_17G066900 A0A251IVJ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) "photosynthesis, light harvesting in photosystem I [GO:0009768];protein-chromophore linkage [GO:0018298];response to light stimulus [GO:0009416]" chloroplast thylakoid membrane [GO:0009535];photosystem I [GO:0009522];photosystem II [GO:0009523] "chloroplast thylakoid membrane [GO:0009535];photosystem I [GO:0009522];photosystem II [GO:0009523];chlorophyll binding [GO:0016168];metal ion binding [GO:0046872];photosynthesis, light harvesting in photosystem I [GO:0009768];protein-chromophore linkage [GO:0018298];response to light stimulus [GO:0009416]" chlorophyll binding [GO:0016168];metal ion binding [GO:0046872] AVSSGSPWYGPDR 0.95792 0 15.1979 0 0 0 13.7655 15.1979 14.622 A0A2C9W918 Uncharacterized protein MANES_03G197100 A0A2C9W918_MANES Manihot esculenta (Cassava) (Jatropha manihot) RCYAAAPQGAVLGR 1.0139 0 15.2077 0 0 0 0 0 15.2077 A0A2C9UHK3 Uncharacterized protein MANES_14G005200 A0A2C9UHK3_MANES Manihot esculenta (Cassava) (Jatropha manihot) ECPKRAQHHQPR 0.98174 0 15.2187 0 0 0 0 0 15.2187 A0A2C9V722 NB-ARC domain-containing protein (Fragment) MANES_09G022900 A0A2C9V722_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] FQYLRMLDLADSK 0.97413 0 15.2293 0 0 0 0 15.2293 0 A0A346TFN3 "Alpha,alpha-trehalose-phosphate synthase (UDP-forming) (EC 2.4.1.15)" A0A346TFN3_MANES Manihot esculenta (Cassava) (Jatropha manihot) trehalose biosynthetic process [GO:0005992] "alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity [GO:0003825];trehalose biosynthetic process [GO:0005992]" "alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity [GO:0003825]" SSHSNEATDNHRGIEPCEHDLR 0.98057 0 15.2325 0 0 0 0 0 15.2325 A0A2C9VLH9 Uncharacterized protein MANES_07G095600 A0A2C9VLH9_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723] RNA binding [GO:0003723] RTNNPFVQ 0.96833 0 15.2362 0 0 0 0 0 15.2362 A0A2C9VKT2 TPT domain-containing protein MANES_07G124100 A0A2C9VKT2_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];antiporter activity [GO:0015297] antiporter activity [GO:0015297] MVPMQTIR 0.96978 0 15.2362 0 0 0 0 0 15.2362 A0A0M5J8Q6 NAC transcription factors 22 MANES_03G114200 A0A0M5J8Q6_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" "DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] TTQPLEEK 0.96781 0 15.2396 0 0 0 15.2396 0 0 A0A2C9U4V5 AAA domain-containing protein MANES_17G016400 A0A2C9U4V5_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein catabolic process [GO:0030163];proteolysis [GO:0006508] mitochondrial matrix [GO:0005759] mitochondrial matrix [GO:0005759];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];protein catabolic process [GO:0030163];proteolysis [GO:0006508] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] IYHASVQK 0.96935 0 15.2396 0 0 0 15.2396 0 0 A0A2C9UEH9 DNA topoisomerase I (EC 5.6.2.1) (DNA topoisomerase 1) MANES_15G065000 A0A2C9UEH9_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin remodeling [GO:0006338];chromosome segregation [GO:0007059];DNA replication [GO:0006260];DNA topological change [GO:0006265] chromosome [GO:0005694];nucleolus [GO:0005730] "chromosome [GO:0005694];nucleolus [GO:0005730];DNA binding [GO:0003677];DNA topoisomerase type I (single strand cut, ATP-independent) activity [GO:0003917];chromatin remodeling [GO:0006338];chromosome segregation [GO:0007059];DNA replication [GO:0006260];DNA topological change [GO:0006265]" "DNA binding [GO:0003677];DNA topoisomerase type I (single strand cut, ATP-independent) activity [GO:0003917]" LEDCDFTPIYEWHQR 0.96961 0 15.2427 0 0 0 15.2427 0 0 A0A2C9UFY5 Rieske domain-containing protein MANES_15G107400 A0A2C9UFY5_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast [GO:0009507];organelle envelope [GO:0031967] "chloroplast [GO:0009507];organelle envelope [GO:0031967];2 iron, 2 sulfur cluster binding [GO:0051537];chlorophyllide a oxygenase [overall] activity [GO:0010277];metal ion binding [GO:0046872]" "2 iron, 2 sulfur cluster binding [GO:0051537];chlorophyllide a oxygenase [overall] activity [GO:0010277];metal ion binding [GO:0046872]" PQVKVDR 0.96344 13.0089 15.262 13.0089 0 0 0 15.262 0 A0A251J945 Uncharacterized protein MANES_14G036100 A0A251J945_MANES Manihot esculenta (Cassava) (Jatropha manihot) mRNA splice site selection [GO:0006376] U1 snRNP [GO:0005685];U2-type prespliceosome [GO:0071004] U1 snRNP [GO:0005685];U2-type prespliceosome [GO:0071004];mRNA binding [GO:0003729];mRNA splice site selection [GO:0006376] mRNA binding [GO:0003729] KMALCEICGSFLVANDAVER 0.97653 18.9949 15.2622 18.9949 18.1333 0 0 15.2622 13.1924 A0A2C9ULD6 Protein kinase domain-containing protein MANES_14G093800 A0A2C9ULD6_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] MLEGDGLAEKWEASQR 0.9587 0 15.2792 0 0 0 15.2792 0 0 A0A2C9WGY9 Retrotrans_gag domain-containing protein MANES_02G197500 A0A2C9WGY9_MANES Manihot esculenta (Cassava) (Jatropha manihot) aspartic-type endopeptidase activity [GO:0004190] aspartic-type endopeptidase activity [GO:0004190] TLQEEEKGNEEEEQK 0.96383 0 15.2792 0 0 0 15.2792 0 0 A0A2C9VPA3 UDP-glucose 6-dehydrogenase (EC 1.1.1.22) MANES_06G086900 A0A2C9VPA3_MANES Manihot esculenta (Cassava) (Jatropha manihot) glycosaminoglycan biosynthetic process [GO:0006024];UDP-glucuronate biosynthetic process [GO:0006065] cytosol [GO:0005829];nucleus [GO:0005634] cytosol [GO:0005829];nucleus [GO:0005634];NAD binding [GO:0051287];UDP-glucose 6-dehydrogenase activity [GO:0003979];glycosaminoglycan biosynthetic process [GO:0006024];UDP-glucuronate biosynthetic process [GO:0006065] NAD binding [GO:0051287];UDP-glucose 6-dehydrogenase activity [GO:0003979] DAHGVCILTEWDEFK 0.9738 0 15.2792 0 0 0 15.2792 0 0 A0A2C9V062 AP2/ERF domain-containing protein MANES_11G064100 A0A2C9V062_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700] WVGEESEVGNSQQQDK 0.97495 0 15.2792 0 0 0 15.2792 0 0 A0A199UB33 Uncharacterized protein MANES_S051500 A0A199UB33_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] ILQTEANTR 0.96227 0 15.2987 0 0 0 15.2987 0 0 A0A251JSL4 Adenine phosphoribosyltransferase (EC 2.4.2.7) MANES_11G057500 A0A251JSL4_MANES Manihot esculenta (Cassava) (Jatropha manihot) adenine salvage [GO:0006168];AMP salvage [GO:0044209];purine ribonucleoside salvage [GO:0006166] cytosol [GO:0005829] cytosol [GO:0005829];adenine phosphoribosyltransferase activity [GO:0003999];adenine salvage [GO:0006168];AMP salvage [GO:0044209];purine ribonucleoside salvage [GO:0006166] adenine phosphoribosyltransferase activity [GO:0003999] GQCRLNGK 0.96211 0 15.3083 0 0 0 0 15.3083 0 A0A2C9VN67 Uncharacterized protein MANES_06G055000 A0A2C9VN67_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell differentiation [GO:0030154] nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700];lipid binding [GO:0008289];cell differentiation [GO:0030154] DNA binding [GO:0003677];DNA-binding transcription factor activity [GO:0003700];lipid binding [GO:0008289] QRKESSR 0.9688 13.5606 15.3116 13.5606 0 0 0 0 15.3116 A0A2C9V6K9 Uncharacterized protein MANES_10G086000 A0A2C9V6K9_MANES Manihot esculenta (Cassava) (Jatropha manihot) ACSFREDDEEDVEAHLILRSR 0.95236 0 15.3239 0 0 0 0 15.3239 0 A0A2C9UFT7 Uncharacterized protein MANES_15G147100 A0A2C9UFT7_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast fission [GO:0010020] chloroplast fission [GO:0010020] VLVMEGGEAR 0.95898 0 15.324 0 0 0 0 15.324 0 A0A2C9UR65 Uncharacterized protein MANES_13G117200 A0A2C9UR65_MANES Manihot esculenta (Cassava) (Jatropha manihot) "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" NDIILANR 0.96813 11.4938 15.3256 0 0 11.4938 0 15.3256 14.4486 A0A2C9VT18 Clp R domain-containing protein MANES_06G138200 A0A2C9VT18_MANES Manihot esculenta (Cassava) (Jatropha manihot) IPKWSAR 0.96589 16.2901 15.3257 0 16.2901 0 0 0 15.3257 A0A2C9VY20 Uncharacterized protein MANES_05G197100 A0A2C9VY20_MANES Manihot esculenta (Cassava) (Jatropha manihot) asymmetric cell division [GO:0008356] asymmetric cell division [GO:0008356] LLEMDQPK 0.96872 0 15.3366 0 0 0 0 15.3366 0 A0A2C9VV64 Uncharacterized protein (Fragment) MANES_05G111100 A0A2C9VV64_MANES Manihot esculenta (Cassava) (Jatropha manihot) "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" NLFGDGLVTANGEK 0.96725 0 15.343 0 0 0 15.343 0 0 A0A2C9UMY9 BAG domain-containing protein MANES_13G007700 A0A2C9UMY9_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein folding [GO:0006457] chaperone binding [GO:0051087];protein folding [GO:0006457] chaperone binding [GO:0051087] EVDEIEKRISMK 0.95848 0 15.4044 0 0 0 0 15.4044 0 A0A251LEJ6 Histone H4 MANES_01G069400 MANES_02G030600 MANES_04G028700 MANES_04G032600 MANES_06G082200 MANES_07G114600 MANES_10G039100 MANES_11G137100 MANES_14G087900 A0A251LEJ6_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleosome [GO:0000786];nucleus [GO:0005634] nucleosome [GO:0000786];nucleus [GO:0005634];DNA binding [GO:0003677];protein heterodimerization activity [GO:0046982] DNA binding [GO:0003677];protein heterodimerization activity [GO:0046982] TLYGFGG 0.95309 0 15.4047 0 0 0 0 0 15.4047 A0A2C9VCJ7 Ge1_WD40 domain-containing protein MANES_08G015400 A0A2C9VCJ7_MANES Manihot esculenta (Cassava) (Jatropha manihot) deadenylation-independent decapping of nuclear-transcribed mRNA [GO:0031087] P-body [GO:0000932] P-body [GO:0000932];deadenylation-independent decapping of nuclear-transcribed mRNA [GO:0031087] GEGFSAEK 0.99916 0 15.4097 0 0 0 15.4097 0 0 A0A2C9VMF9 Clp R domain-containing protein MANES_07G130100 A0A2C9VMF9_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] AWLRDFFDQVDR 0.96744 0 15.4191 0 0 0 0 15.4191 14.0631 A0A2C9WA15 Uncharacterized protein MANES_03G158800 A0A2C9WA15_MANES Manihot esculenta (Cassava) (Jatropha manihot) KSNSDEEDRPNIR 0.95842 0 15.4359 0 0 0 0 0 15.4359 A0A2C9U9V8 Pectate_lyase_3 domain-containing protein MANES_16G050800 A0A2C9U9V8_MANES Manihot esculenta (Cassava) (Jatropha manihot) polygalacturonase activity [GO:0004650] polygalacturonase activity [GO:0004650] NNVQGMNIR 0.96232 0 15.4365 0 0 0 15.4365 14.3916 0 A0A2C9V6M4 Tubulin-folding cofactor B MANES_09G007200 A0A2C9V6M4_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell division [GO:0051301];embryo development ending in seed dormancy [GO:0009793] cytosol [GO:0005829] cytosol [GO:0005829];cell division [GO:0051301];embryo development ending in seed dormancy [GO:0009793] CEVEPGEK 0.96945 0 15.439 0 0 0 0 15.439 0 A0A251JIY7 Uncharacterized protein MANES_13G134300 A0A251JIY7_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];histone-lysine N-methyltransferase activity [GO:0018024];zinc ion binding [GO:0008270] histone-lysine N-methyltransferase activity [GO:0018024];zinc ion binding [GO:0008270] AAKLCSEYSIRVK 0.96358 0 15.4407 0 0 0 0 0 15.4407 A0A2C9VNY5 Protein kinase domain-containing protein MANES_06G001300 A0A2C9VNY5_MANES Manihot esculenta (Cassava) (Jatropha manihot) peptidyl-serine phosphorylation [GO:0018105];peptidyl-threonine phosphorylation [GO:0018107] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];protein tyrosine kinase activity [GO:0004713];peptidyl-serine phosphorylation [GO:0018105];peptidyl-threonine phosphorylation [GO:0018107] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674];protein tyrosine kinase activity [GO:0004713] FERDGPVVK 0.95947 15.1515 15.4416 15.1515 0 0 15.4416 0 0 B1NWD5 "ATP synthase subunit alpha, chloroplastic (EC 7.1.2.2) (ATP synthase F1 sector subunit alpha) (F-ATPase subunit alpha)" atpA ATPA_MANES Manihot esculenta (Cassava) (Jatropha manihot) "chloroplast thylakoid membrane [GO:0009535];proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]" "chloroplast thylakoid membrane [GO:0009535];proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261];ATP binding [GO:0005524];proton-transporting ATP synthase activity, rotational mechanism [GO:0046933];proton-transporting ATPase activity, rotational mechanism [GO:0046961]" "ATP binding [GO:0005524];proton-transporting ATPase activity, rotational mechanism [GO:0046961];proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]" ADEISNIIR 0.96656 18.3211 15.4483 0 18.3211 12.5908 15.4483 12.504 0 A0A251K7Z2 Uncharacterized protein MANES_09G158100 A0A251K7Z2_MANES Manihot esculenta (Cassava) (Jatropha manihot) double-strand break repair via homologous recombination [GO:0000724];protein deubiquitination [GO:0016579] ubiquitin binding [GO:0043130];double-strand break repair via homologous recombination [GO:0000724];protein deubiquitination [GO:0016579] ubiquitin binding [GO:0043130] VWDPRTGSK 0.9555 0 15.4569 0 0 0 0 15.4569 0 A0A2C9WAG4 Uncharacterized protein MANES_03G188600 A0A2C9WAG4_MANES Manihot esculenta (Cassava) (Jatropha manihot) NFHGNSYTNPKYYDYNTKFNR 0.95278 0 15.471 0 0 0 0 15.471 0 A0A2C9U8L4 Uncharacterized protein MANES_16G047800 A0A2C9U8L4_MANES Manihot esculenta (Cassava) (Jatropha manihot) diterpenoid biosynthetic process [GO:0016102];gibberellin biosynthetic process [GO:0009686];hydrocarbon biosynthetic process [GO:0120251] chloroplast [GO:0009507];chloroplast stroma [GO:0009570] chloroplast [GO:0009507];chloroplast stroma [GO:0009570];ent-kaurene synthase activity [GO:0009899];magnesium ion binding [GO:0000287];terpene synthase activity [GO:0010333];diterpenoid biosynthetic process [GO:0016102];gibberellin biosynthetic process [GO:0009686];hydrocarbon biosynthetic process [GO:0120251] ent-kaurene synthase activity [GO:0009899];magnesium ion binding [GO:0000287];terpene synthase activity [GO:0010333] WVVDNGLDK 0.96162 0 15.4764 0 0 0 15.4764 0 15.0322 A0A2C9W1H5 PlsC domain-containing protein MANES_04G065100 A0A2C9W1H5_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];acyltransferase activity [GO:0016746] acyltransferase activity [GO:0016746] KVPWDGYLKYSR 0.9685 0 15.4812 0 0 0 0 15.4812 12.8598 A0A2C9UQR6 FRIGIDA-like protein MANES_13G115800 A0A2C9UQR6_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell differentiation [GO:0030154];flower development [GO:0009908] cell differentiation [GO:0030154];flower development [GO:0009908] DKLSVALESANEPAR 0.96386 0 15.4861 0 0 0 0 15.4861 14.2042 A0A2C9UXF0 Lipase_3 domain-containing protein MANES_11G011100 A0A2C9UXF0_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid metabolic process [GO:0006629] triglyceride lipase activity [GO:0004806];lipid metabolic process [GO:0006629] triglyceride lipase activity [GO:0004806] MDEQPNPNFFGMR 0.45 0 15.4888 0 0 0 0 15.4888 0 A0A2C9VTP2 MI domain-containing protein MANES_05G057500 A0A2C9VTP2_MANES Manihot esculenta (Cassava) (Jatropha manihot) eukaryotic translation initiation factor 4F complex [GO:0016281] eukaryotic translation initiation factor 4F complex [GO:0016281];mRNA binding [GO:0003729];translation initiation factor activity [GO:0003743] mRNA binding [GO:0003729];translation initiation factor activity [GO:0003743] FSEHFTDLPDNFEITSDIAEVFSLSHFVDR 0.82432 0 15.4888 0 0 0 0 15.4888 0 A0A251K680 Uncharacterized protein MANES_09G111900 A0A251K680_MANES Manihot esculenta (Cassava) (Jatropha manihot) intercellular transport [GO:0010496] endosome [GO:0005768] endosome [GO:0005768];intercellular transport [GO:0010496] WGQMLIAANQEDKRDWSNTVFMQLCSMVR 1.0015 0 15.4888 0 0 0 0 15.4888 0 A0A2C9V755 Protein FAR1-RELATED SEQUENCE MANES_09G021300 A0A2C9V755_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];zinc ion binding [GO:0008270];regulation of transcription, DNA-templated [GO:0006355]" zinc ion binding [GO:0008270] QTSFREFFDMYELVLQKK 0.97507 0 15.4892 0 0 0 0 15.4892 0 A0A2C9VS38 Uncharacterized protein MANES_06G107800 A0A2C9VS38_MANES Manihot esculenta (Cassava) (Jatropha manihot) "autophagosome maturation [GO:0097352];ER-associated misfolded protein catabolic process [GO:0071712];mitotic spindle disassembly [GO:0051228];retrograde protein transport, ER to cytosol [GO:0030970];ubiquitin-dependent ERAD pathway [GO:0030433]" cytosol [GO:0005829];nucleus [GO:0005634];VCP-NPL4-UFD1 AAA ATPase complex [GO:0034098] "cytosol [GO:0005829];nucleus [GO:0005634];VCP-NPL4-UFD1 AAA ATPase complex [GO:0034098];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];polyubiquitin modification-dependent protein binding [GO:0031593];autophagosome maturation [GO:0097352];ER-associated misfolded protein catabolic process [GO:0071712];mitotic spindle disassembly [GO:0051228];retrograde protein transport, ER to cytosol [GO:0030970];ubiquitin-dependent ERAD pathway [GO:0030433]" ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];polyubiquitin modification-dependent protein binding [GO:0031593] LAGESEGNLR 0.96129 0 15.4898 0 0 0 15.4898 0 14.2067 A0A251IP37 PhoD domain-containing protein MANES_18G000500 A0A251IP37_MANES Manihot esculenta (Cassava) (Jatropha manihot) ERTIGPWKNVPR 0.95901 0 15.5037 0 0 0 0 15.5037 15.4276 A0A2C9UXZ5 Eukaryotic translation initiation factor 3 subunit D (eIF3d) (Eukaryotic translation initiation factor 3 subunit 7) (eIF-3-zeta) MANES_11G028400 A0A2C9UXZ5_MANES Manihot esculenta (Cassava) (Jatropha manihot) cap-dependent translational initiation [GO:0002191];formation of cytoplasmic translation initiation complex [GO:0001732];translational initiation [GO:0006413] eukaryotic 43S preinitiation complex [GO:0016282];eukaryotic 48S preinitiation complex [GO:0033290];eukaryotic translation initiation factor 3 complex [GO:0005852] eukaryotic 43S preinitiation complex [GO:0016282];eukaryotic 48S preinitiation complex [GO:0033290];eukaryotic translation initiation factor 3 complex [GO:0005852];mRNA cap binding [GO:0098808];translation initiation factor activity [GO:0003743];cap-dependent translational initiation [GO:0002191];formation of cytoplasmic translation initiation complex [GO:0001732];translational initiation [GO:0006413] mRNA cap binding [GO:0098808];translation initiation factor activity [GO:0003743] DEEVEARK 0.96404 0 15.5058 0 0 0 0 15.5058 0 A0A2C9VIE8 ANAPC4_WD40 domain-containing protein MANES_08G164600 A0A2C9VIE8_MANES Manihot esculenta (Cassava) (Jatropha manihot) anaphase-promoting complex-dependent catabolic process [GO:0031145];positive regulation of anaphase-promoting complex-dependent catabolic process [GO:1905786];protein ubiquitination [GO:0016567] anaphase-promoting complex [GO:0005680] anaphase-promoting complex [GO:0005680];anaphase-promoting complex binding [GO:0010997];ubiquitin ligase activator activity [GO:1990757];anaphase-promoting complex-dependent catabolic process [GO:0031145];positive regulation of anaphase-promoting complex-dependent catabolic process [GO:1905786];protein ubiquitination [GO:0016567] anaphase-promoting complex binding [GO:0010997];ubiquitin ligase activator activity [GO:1990757] NSKENLDR 0.96582 0 15.5058 0 0 0 0 15.5058 0 A0A2C9VPQ4 ATP synthase subunit beta (EC 7.1.2.2) MANES_06G062900 A0A2C9VPQ4_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial ATP synthesis coupled proton transport [GO:0042776] "mitochondrial proton-transporting ATP synthase complex [GO:0005753];mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1) [GO:0000275];proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]" "mitochondrial proton-transporting ATP synthase complex [GO:0005753];mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1) [GO:0000275];proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];proton-transporting ATP synthase activity, rotational mechanism [GO:0046933];proton-transporting ATPase activity, rotational mechanism [GO:0046961];mitochondrial ATP synthesis coupled proton transport [GO:0042776]" "ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];proton-transporting ATPase activity, rotational mechanism [GO:0046961];proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]" EGNDLYREMIESGVIKLGDK 0.96962 14.1419 15.5068 14.1419 0 0 0 0 15.5068 A0A2C9WEI6 DUF4057 domain-containing protein MANES_02G153300 A0A2C9WEI6_MANES Manihot esculenta (Cassava) (Jatropha manihot) ALALKESIQLGEPAPRDVR 0.95982 0 15.5202 0 0 0 0 15.4629 15.5202 A0A2C9VHR7 Uncharacterized protein MANES_08G139400 A0A2C9VHR7_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin remodeling [GO:0006338];regulation of gene expression [GO:0010468] nucleus [GO:0005634] nucleus [GO:0005634];histone demethylase activity [GO:0032452];histone H3-tri/di/monomethyl-lysine-4 demethylase activity [GO:0034647];chromatin remodeling [GO:0006338];regulation of gene expression [GO:0010468] histone demethylase activity [GO:0032452];histone H3-tri/di/monomethyl-lysine-4 demethylase activity [GO:0034647] AHWELNLLKKNTMDNLR 0.97513 0 15.5222 0 0 0 15.5222 0 11.1347 A0A2C9UVT8 Methyltransf_11 domain-containing protein MANES_12G078700 A0A2C9UVT8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];methyltransferase activity [GO:0008168] methyltransferase activity [GO:0008168] GGVCVIVVEECGNEEVSDIVGLFR 0.97499 0 15.5236 0 0 0 0 0 15.5236 A0A2C9UHX3 Casein kinase II subunit beta (CK II beta) MANES_15G174600 A0A2C9UHX3_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein kinase CK2 complex [GO:0005956] protein kinase CK2 complex [GO:0005956];protein kinase regulator activity [GO:0019887] protein kinase regulator activity [GO:0019887] YILTSKGMAAMMDK 0.97754 0 15.5241 0 0 0 15.5241 0 0 A0A2C9WIM3 Flavin-containing monooxygenase (EC 1.-.-.-) MANES_01G077000 A0A2C9WIM3_MANES Manihot esculenta (Cassava) (Jatropha manihot) "flavin adenine dinucleotide binding [GO:0050660];N,N-dimethylaniline monooxygenase activity [GO:0004499];NADP binding [GO:0050661]" "flavin adenine dinucleotide binding [GO:0050660];N,N-dimethylaniline monooxygenase activity [GO:0004499];NADP binding [GO:0050661]" ELMGFMDFPFVAR 1.0423 0 15.5241 0 0 0 15.5241 0 0 A0A2C9UYI6 O-fucosyltransferase family protein MANES_11G011700 A0A2C9UYI6_MANES Manihot esculenta (Cassava) (Jatropha manihot) fucose metabolic process [GO:0006004] peptide-O-fucosyltransferase activity [GO:0046922];fucose metabolic process [GO:0006004] peptide-O-fucosyltransferase activity [GO:0046922] RHGFLKFCNVK 0.96094 0 15.5253 0 0 0 15.5253 15.3233 0 A0A2C9W532 Uncharacterized protein MANES_03G062400 A0A2C9W532_MANES Manihot esculenta (Cassava) (Jatropha manihot) IRAWRQPDCMER 0.95904 0 15.5316 0 0 0 0 15.5316 0 A0A2C9UX49 Adenylyl-sulfate kinase (EC 2.7.1.25) MANES_12G113800 A0A2C9UX49_MANES Manihot esculenta (Cassava) (Jatropha manihot) sulfate assimilation [GO:0000103] adenylylsulfate kinase activity [GO:0004020];ATP binding [GO:0005524];sulfate assimilation [GO:0000103] adenylylsulfate kinase activity [GO:0004020];ATP binding [GO:0005524] MLCNGSSTHIMWHKSSVDKFDR 0.96178 0 15.5416 0 0 0 15.5416 0 0 A0A199UC82 Uncharacterized protein MANES_S017600 A0A199UC82_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphoprotein phosphatase activity [GO:0004721] phosphoprotein phosphatase activity [GO:0004721] AYNCEIMLSK 0.96149 16.3163 15.5666 16.3163 11.7528 0 13.672 11.3035 15.5666 A0A2C9VF22 RING-type E3 ubiquitin transferase (EC 2.3.2.27) MANES_08G101100 A0A2C9VF22_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin organization [GO:0006325];maintenance of DNA methylation [GO:0010216];protein ubiquitination [GO:0016567] nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677];metal ion binding [GO:0046872];ubiquitin protein ligase activity [GO:0061630];chromatin organization [GO:0006325];maintenance of DNA methylation [GO:0010216];protein ubiquitination [GO:0016567] DNA binding [GO:0003677];metal ion binding [GO:0046872];ubiquitin protein ligase activity [GO:0061630] AKNFMHQTETDPQQAYKEEASDGNDK 0.97663 0 15.5667 0 0 0 15.5667 0 0 A0A2C9WR35 S-acyltransferase (EC 2.3.1.225) (Palmitoyltransferase) MANES_01G235300 A0A2C9WR35_MANES Manihot esculenta (Cassava) (Jatropha manihot) peptidyl-L-cysteine S-palmitoylation [GO:0018230];protein targeting to membrane [GO:0006612] endoplasmic reticulum [GO:0005783];Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] endoplasmic reticulum [GO:0005783];Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];protein-cysteine S-palmitoyltransferase activity [GO:0019706];peptidyl-L-cysteine S-palmitoylation [GO:0018230];protein targeting to membrane [GO:0006612] protein-cysteine S-palmitoyltransferase activity [GO:0019706] PMVQQDSLK 0.96191 0 15.5986 0 0 0 15.5986 0 0 A0A2C9WK50 Uncharacterized protein MANES_01G080200 A0A2C9WK50_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein-arginine omega-N monomethyltransferase activity [GO:0035241] protein-arginine omega-N monomethyltransferase activity [GO:0035241] KCLTLQDTNQKK 0.95873 0 15.5988 0 0 0 0 0 15.5988 A0A2C9VT98 Uncharacterized protein MANES_05G043300 A0A2C9VT98_MANES Manihot esculenta (Cassava) (Jatropha manihot) DANAIQMLLDGCR 0.96737 14.2976 15.5988 0 0 14.2976 0 14.3141 15.5988 A0A251L050 Ferredoxin MANES_04G003400 A0A251L050_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast [GO:0009507] "chloroplast [GO:0009507];2 iron, 2 sulfur cluster binding [GO:0051537];electron transfer activity [GO:0009055];metal ion binding [GO:0046872]" "2 iron, 2 sulfur cluster binding [GO:0051537];electron transfer activity [GO:0009055];metal ion binding [GO:0046872]" MATVTVPTQCMVK 0.95766 0 15.6019 0 0 0 15.6019 0 0 A0A2C9W600 RING-type E3 ubiquitin transferase (EC 2.3.2.27) MANES_03G090300 A0A2C9W600_MANES Manihot esculenta (Cassava) (Jatropha manihot) ubiquitin-protein transferase activity [GO:0004842] ubiquitin-protein transferase activity [GO:0004842] IDGKSRTETWER 0.96375 13.8206 15.6019 0 0 13.8206 15.6019 0 0 A0A2C9UT21 Uncharacterized protein MANES_12G027800 A0A2C9UT21_MANES Manihot esculenta (Cassava) (Jatropha manihot) EQEEAAR 0.96695 16.8636 15.6021 0 16.8636 0 0 0 15.6021 A0A2C9VEY7 Uncharacterized protein MANES_08G099100 A0A2C9VEY7_MANES Manihot esculenta (Cassava) (Jatropha manihot) SPSGCLRIR 0.95981 0 15.6031 0 0 0 14.8478 15.6031 0 A0A2C9W9J6 INCENP_ARK-bind domain-containing protein MANES_03G141700 A0A2C9W9J6_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737];nucleus [GO:0005634];spindle [GO:0005819] cytoplasm [GO:0005737];nucleus [GO:0005634];spindle [GO:0005819] VDLSSNVIKDGDSK 0.97719 0 15.6039 0 0 0 0 15.6039 0 A0A2C9WAA9 Uncharacterized protein MANES_02G027900 A0A2C9WAA9_MANES Manihot esculenta (Cassava) (Jatropha manihot) DVAREKK 0.96769 0 15.6235 0 0 0 0 15.6235 0 A0A2C9VFG6 Peptidylprolyl isomerase (EC 5.2.1.8) MANES_08G063600 A0A2C9VFG6_MANES Manihot esculenta (Cassava) (Jatropha manihot) chaperone-mediated protein folding [GO:0061077];protein peptidyl-prolyl isomerization [GO:0000413] cytoplasm [GO:0005737] cytoplasm [GO:0005737];peptidyl-prolyl cis-trans isomerase activity [GO:0003755];chaperone-mediated protein folding [GO:0061077];protein peptidyl-prolyl isomerization [GO:0000413] peptidyl-prolyl cis-trans isomerase activity [GO:0003755] GLDDGVATMKKGER 0.96147 0 15.6265 0 0 0 0 15.6265 0 O49169 Elongation factor 1-alpha (EF-1-alpha) EF1 EF1A_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] cytoplasm [GO:0005737];GTP binding [GO:0005525];GTPase activity [GO:0003924];translation elongation factor activity [GO:0003746] GTPase activity [GO:0003924];GTP binding [GO:0005525];translation elongation factor activity [GO:0003746] NMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR 0.97401 0 15.6372 0 0 0 15.6372 0 0 A0A2C9U8W3 Uncharacterized protein MANES_17G115400 A0A2C9U8W3_MANES Manihot esculenta (Cassava) (Jatropha manihot) plant-type cell wall organization [GO:0009664] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021];glycosyltransferase activity [GO:0016757];plant-type cell wall organization [GO:0009664] glycosyltransferase activity [GO:0016757] DPTRRGWHPVTYK 0.95783 0 15.6423 0 0 0 0 15.6423 0 A0A2C9VBI8 Protein kinase domain-containing protein MANES_09G094700 A0A2C9VBI8_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to bacterium [GO:0042742];defense response to oomycetes [GO:0002229] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];carbohydrate binding [GO:0030246];transmembrane receptor protein serine/threonine kinase activity [GO:0004675];defense response to bacterium [GO:0042742];defense response to oomycetes [GO:0002229] ATP binding [GO:0005524];carbohydrate binding [GO:0030246];transmembrane receptor protein serine/threonine kinase activity [GO:0004675] VTLNWEQR 0.9687 13.9564 15.6494 0 0 13.9564 0 15.6494 0 A0A2C9UG22 Uncharacterized protein MANES_15G116100 A0A2C9UG22_MANES Manihot esculenta (Cassava) (Jatropha manihot) AAEEFQESDIIFSDHDR 0.97285 16.2838 15.6535 16.1293 0 16.2838 0 15.6535 0 A0A2C9WEH1 AB hydrolase-1 domain-containing protein MANES_02G152000 A0A2C9WEH1_MANES Manihot esculenta (Cassava) (Jatropha manihot) MTRCFSFSEAMNWYHR 0.95826 0 15.6678 0 0 0 0 15.6678 0 A0A2C9VUF8 Uncharacterized protein MANES_05G081600 A0A2C9VUF8_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];phosphatase activity [GO:0016791];protein kinase activity [GO:0004672] ATP binding [GO:0005524];phosphatase activity [GO:0016791];protein kinase activity [GO:0004672] DIKPENMVICFEDQATGR 0.97126 15.1784 15.6678 15.1784 0 0 0 15.6678 0 A0A199UBY6 Cupin type-1 domain-containing protein MANES_S025500 A0A199UBY6_MANES Manihot esculenta (Cassava) (Jatropha manihot) GKLSWAEDGRELK 0.95784 0 15.6769 0 0 0 0 15.6769 0 A0A2C9UM35 Uncharacterized protein MANES_14G158300 A0A2C9UM35_MANES Manihot esculenta (Cassava) (Jatropha manihot) "chromatin organization [GO:0006325];regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];chromatin binding [GO:0003682];DNA binding [GO:0003677];metal ion binding [GO:0046872];chromatin organization [GO:0006325];regulation of transcription, DNA-templated [GO:0006355]" chromatin binding [GO:0003682];DNA binding [GO:0003677];metal ion binding [GO:0046872] DAPAHEQVSEDEDWGPGKR 0.96013 0 15.6825 0 0 0 0 0 15.6825 A0A2C9U3V7 ThiF domain-containing protein MANES_17G002000 A0A2C9U3V7_MANES Manihot esculenta (Cassava) (Jatropha manihot) cyclic threonylcarbamoyladenosine biosynthetic process [GO:0061504] tRNA threonylcarbamoyladenosine dehydratase [GO:0061503];ubiquitin-like modifier activating enzyme activity [GO:0008641];cyclic threonylcarbamoyladenosine biosynthetic process [GO:0061504] tRNA threonylcarbamoyladenosine dehydratase [GO:0061503];ubiquitin-like modifier activating enzyme activity [GO:0008641] AKLLPFK 0.96454 0 15.6876 0 0 0 15.6876 0 0 A0ZQS3 Ribulose bisphosphate carboxylase large chain (EC 4.1.1.39) (Fragment) rbcL A0ZQS3_MANES Manihot esculenta (Cassava) (Jatropha manihot) photorespiration [GO:0009853];reductive pentose-phosphate cycle [GO:0019253] chloroplast [GO:0009507] chloroplast [GO:0009507];magnesium ion binding [GO:0000287];monooxygenase activity [GO:0004497];ribulose-bisphosphate carboxylase activity [GO:0016984];photorespiration [GO:0009853];reductive pentose-phosphate cycle [GO:0019253] magnesium ion binding [GO:0000287];monooxygenase activity [GO:0004497];ribulose-bisphosphate carboxylase activity [GO:0016984] DITLGFVDLLR 0.96891 16.8938 15.6895 0 16.8938 0 0 0 15.6895 A0A2C9UAT5 Uncharacterized protein MANES_16G119100 A0A2C9UAT5_MANES Manihot esculenta (Cassava) (Jatropha manihot) TRLMFYSTFYTMR 0.96149 0 15.7047 0 0 0 15.0629 15.7047 0 A0A2C9VEW0 Uncharacterized protein MANES_08G095700 A0A2C9VEW0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor [GO:0016671]" "oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor [GO:0016671]" HFSFIYCMESLALQNRLNEWVNCFETARFGK 0.89333 0 15.7102 0 0 0 15.7102 0 0 A0A2C9VCA9 Uncharacterized protein MANES_08G009400 A0A2C9VCA9_MANES Manihot esculenta (Cassava) (Jatropha manihot) negative regulation of cell population proliferation [GO:0008285];shoot system development [GO:0048367] plasma membrane [GO:0005886] plasma membrane [GO:0005886];negative regulation of cell population proliferation [GO:0008285];shoot system development [GO:0048367] CIAMLICWHER 0.97404 0 15.7217 0 0 0 0 15.7217 0 A0A2C9URE7 Uncharacterized protein MANES_13G065500 A0A2C9URE7_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA binding [GO:0003677];metal ion binding [GO:0046872];mRNA binding [GO:0003729] DNA binding [GO:0003677];metal ion binding [GO:0046872];mRNA binding [GO:0003729] IHDNQEQGGMAPSSPYPDRPGEPDCIYYLR 0.95586 0 15.7373 0 0 0 0 15.7373 0 A0A2C9WBS1 C2 NT-type domain-containing protein MANES_02G023900 A0A2C9WBS1_MANES Manihot esculenta (Cassava) (Jatropha manihot) LEKGIIREGGCR 0.96918 14.3999 15.7376 14.1176 14.3999 0 15.7376 0 0 A0A2C9UQH4 Homeobox domain-containing protein MANES_13G107400 A0A2C9UQH4_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];sequence-specific DNA binding [GO:0043565]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];sequence-specific DNA binding [GO:0043565]" VSDEDEDAINTRK 0.96163 0 15.7524 0 0 0 0 15.7524 0 A0A2C9VQZ7 Galectin domain-containing protein MANES_06G098200 A0A2C9VQZ7_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein glycosylation [GO:0006486] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021];carbohydrate binding [GO:0030246];galactosyltransferase activity [GO:0008378];glycosyltransferase activity [GO:0016757];protein glycosylation [GO:0006486] carbohydrate binding [GO:0030246];galactosyltransferase activity [GO:0008378];glycosyltransferase activity [GO:0016757] FFVALHAR 0.95309 0 15.7601 0 0 0 15.7601 0 0 A0A2C9V2E7 ABC1 domain-containing protein MANES_10G013300 A0A2C9V2E7_MANES Manihot esculenta (Cassava) (Jatropha manihot) LCTTVPVR 0.96757 0 15.7945 0 0 0 0 0 15.7945 A0A2C9WNL6 Uncharacterized protein MANES_01G151700 A0A2C9WNL6_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] EETEELRNALEK 0.96837 14.5173 15.8183 0 14.5173 0 0 15.8183 0 A0A2C9V5J1 Uncharacterized protein MANES_10G069300 A0A2C9V5J1_MANES Manihot esculenta (Cassava) (Jatropha manihot) NAD+ ADP-ribosyltransferase activity [GO:0003950] NAD+ ADP-ribosyltransferase activity [GO:0003950] SKLVGCGCHFRR 0.95875 14.2973 15.8246 0 0 14.2973 0 15.4044 15.8246 A0A2C9UK51 DNA-directed RNA polymerase (EC 2.7.7.6) MANES_14G091700 A0A2C9UK51_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitochondrial transcription [GO:0006390] mitochondrial DNA-directed RNA polymerase complex [GO:0034245] mitochondrial DNA-directed RNA polymerase complex [GO:0034245];DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899];mitochondrial transcription [GO:0006390] DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899] LLINQVDR 0.97027 15.5911 15.834 15.5911 0 0 0 15.834 0 A0A199UBL1 Cellulase domain-containing protein MANES_S037800 A0A199UBL1_MANES Manihot esculenta (Cassava) (Jatropha manihot) organic substance metabolic process [GO:0071704] extracellular region [GO:0005576] "extracellular region [GO:0005576];mannan endo-1,4-beta-mannosidase activity [GO:0016985];organic substance metabolic process [GO:0071704]" "mannan endo-1,4-beta-mannosidase activity [GO:0016985]" LVYEAHWYPWSWDDKK 0.97583 0 15.8424 0 0 0 15.8424 0 0 A0A2C9WLL9 PWI domain-containing protein MANES_01G169300 A0A2C9WLL9_MANES Manihot esculenta (Cassava) (Jatropha manihot) mRNA processing [GO:0006397] mRNA processing [GO:0006397] LASLSPSPER 0.96095 0 15.8476 0 0 0 0 0 15.8476 A0A2C9U473 Uncharacterized protein MANES_17G026700 A0A2C9U473_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021] Golgi apparatus [GO:0005794];integral component of membrane [GO:0016021];cation transmembrane transporter activity [GO:0008324] cation transmembrane transporter activity [GO:0008324] QPDFGFGASDRRYTYWR 0.97489 0 15.8477 0 0 0 15.8477 0 0 A0A251KDI2 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) MANES_08G137600 A0A251KDI2_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein folding [GO:0006457];protein peptidyl-prolyl isomerization [GO:0000413] cytoplasm [GO:0005737] cytoplasm [GO:0005737];cyclosporin A binding [GO:0016018];peptidyl-prolyl cis-trans isomerase activity [GO:0003755];protein folding [GO:0006457];protein peptidyl-prolyl isomerization [GO:0000413] cyclosporin A binding [GO:0016018];peptidyl-prolyl cis-trans isomerase activity [GO:0003755] GNGTGGESIYGMKFADENFK 0.9806 0 15.8477 0 0 0 15.8477 0 0 A0A251M2B5 DNA-directed RNA polymerase subunit (EC 2.7.7.6) MANES_01G151000 A0A251M2B5_MANES Manihot esculenta (Cassava) (Jatropha manihot) transcription by RNA polymerase II [GO:0006366] "RNA polymerase II, core complex [GO:0005665]" "RNA polymerase II, core complex [GO:0005665];DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899];metal ion binding [GO:0046872];transcription by RNA polymerase II [GO:0006366]" DNA binding [GO:0003677];DNA-directed 5'-3' RNA polymerase activity [GO:0003899];metal ion binding [GO:0046872] DDAGSSAQKSLSESNNLK 0.99818 0 15.8614 0 0 0 0 15.8614 0 A0A199U9T1 Uncharacterized protein MANES_S092700 A0A199U9T1_MANES Manihot esculenta (Cassava) (Jatropha manihot) NPAAVYK 0.95396 16.4117 15.8648 16.4117 0 0 0 0 15.8648 A0A2C9UPE4 Receptor-like serine/threonine-protein kinase (EC 2.7.11.1) MANES_13G071300 A0A2C9UPE4_MANES Manihot esculenta (Cassava) (Jatropha manihot) recognition of pollen [GO:0048544] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];recognition of pollen [GO:0048544] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] LEGVASQGER 0.96073 0 15.8678 0 0 0 15.8678 0 15.0282 A0A2C9VSS3 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) MANES_05G029300 A0A2C9VSS3_MANES Manihot esculenta (Cassava) (Jatropha manihot) pantothenate biosynthetic process [GO:0015940] mitochondrion [GO:0005739] mitochondrion [GO:0005739];3-methyl-2-oxobutanoate hydroxymethyltransferase activity [GO:0003864];magnesium ion binding [GO:0000287];pantothenate biosynthetic process [GO:0015940] 3-methyl-2-oxobutanoate hydroxymethyltransferase activity [GO:0003864];magnesium ion binding [GO:0000287] VTPKFCKQYACVGDVVNK 1.0077 0 15.8769 0 0 0 15.8769 0 0 A0A2C9VGN9 Uncharacterized protein MANES_08G157300 A0A2C9VGN9_MANES Manihot esculenta (Cassava) (Jatropha manihot) spindle assembly [GO:0051225] HAUS complex [GO:0070652] HAUS complex [GO:0070652];microtubule minus-end binding [GO:0051011];spindle assembly [GO:0051225] microtubule minus-end binding [GO:0051011] YALLEWLFFK 0.96063 0 15.885 0 0 0 0 0 15.885 A0A2C9UYJ2 Uncharacterized protein MANES_11G002400 A0A2C9UYJ2_MANES Manihot esculenta (Cassava) (Jatropha manihot) VFTAHQDSRIR 0.9592 16.7993 15.885 0 16.7993 0 0 0 15.885 A0A2C9V810 Ricin B-type lectin domain-containing protein MANES_10G135700 A0A2C9V810_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] ADP binding [GO:0043531];defense response [GO:0006952] ADP binding [GO:0043531] LASPDLLK 0.96891 16.1861 15.8867 0 16.1861 0 15.8867 0 0 A0A2C9V1Z6 RBR-type E3 ubiquitin transferase (EC 2.3.2.31) MANES_11G099900 A0A2C9V1Z6_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436];protein polyubiquitination [GO:0000209];ubiquitin-dependent protein catabolic process [GO:0006511] cytoplasm [GO:0005737];ubiquitin ligase complex [GO:0000151] cytoplasm [GO:0005737];ubiquitin ligase complex [GO:0000151];metal ion binding [GO:0046872];ubiquitin conjugating enzyme binding [GO:0031624];ubiquitin protein ligase activity [GO:0061630];positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436];protein polyubiquitination [GO:0000209];ubiquitin-dependent protein catabolic process [GO:0006511] metal ion binding [GO:0046872];ubiquitin conjugating enzyme binding [GO:0031624];ubiquitin protein ligase activity [GO:0061630] IVVCSCEVKNFTCPICYER 0.97018 0 15.9064 0 0 0 15.9064 0 0 A0A251L1V2 Uncharacterized protein MANES_06G020400 A0A251L1V2_MANES Manihot esculenta (Cassava) (Jatropha manihot) serine-type endopeptidase activity [GO:0004252] serine-type endopeptidase activity [GO:0004252] SLERDWK 0.97726 0 15.9116 0 0 0 15.9116 0 0 A0A2C9V6Q9 Protein kinase domain-containing protein MANES_10G115500 A0A2C9V6Q9_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphorylation of RNA polymerase II C-terminal domain [GO:0070816];positive regulation of transcription elongation from RNA polymerase II promoter [GO:0032968];protein phosphorylation [GO:0006468] cyclin-dependent protein kinase holoenzyme complex [GO:0000307];nucleus [GO:0005634] cyclin-dependent protein kinase holoenzyme complex [GO:0000307];nucleus [GO:0005634];ATP binding [GO:0005524];cyclin-dependent protein serine/threonine kinase activity [GO:0004693];RNA polymerase II CTD heptapeptide repeat kinase activity [GO:0008353];phosphorylation of RNA polymerase II C-terminal domain [GO:0070816];positive regulation of transcription elongation from RNA polymerase II promoter [GO:0032968];protein phosphorylation [GO:0006468] ATP binding [GO:0005524];cyclin-dependent protein serine/threonine kinase activity [GO:0004693];RNA polymerase II CTD heptapeptide repeat kinase activity [GO:0008353] GSRANDYVENNAPR 0.98103 0 15.9138 0 0 0 15.9138 0 0 A0A2C9U971 Uncharacterized protein MANES_16G028500 A0A2C9U971_MANES Manihot esculenta (Cassava) (Jatropha manihot) ILCSAAK 0.95685 0 15.9417 0 0 0 0 0 15.9417 A0A2C9URF8 Uncharacterized protein MANES_13G093800 A0A2C9URF8_MANES Manihot esculenta (Cassava) (Jatropha manihot) IIYCLGGENYYSFLVHYK 0.99651 16.5093 15.9448 16.5093 0 0 0 0 15.9448 A0A2C9W498 Uncharacterized protein MANES_03G035300 A0A2C9W498_MANES Manihot esculenta (Cassava) (Jatropha manihot) double-strand break repair via homologous recombination [GO:0000724];nucleosome assembly [GO:0006334];somatic cell DNA recombination [GO:0016444] chromatin [GO:0000785];nucleus [GO:0005634] chromatin [GO:0000785];nucleus [GO:0005634];chromatin binding [GO:0003682];histone binding [GO:0042393];double-strand break repair via homologous recombination [GO:0000724];nucleosome assembly [GO:0006334];somatic cell DNA recombination [GO:0016444] chromatin binding [GO:0003682];histone binding [GO:0042393] LEFFFDPNPYFK 1.0583 0 15.9532 0 0 0 14.2206 14.9593 15.9532 A0A2C9VXG4 RRM domain-containing protein MANES_05G181200 A0A2C9VXG4_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular anatomical entity [GO:0110165] cellular anatomical entity [GO:0110165];RNA binding [GO:0003723];ubiquitin binding [GO:0043130] RNA binding [GO:0003723];ubiquitin binding [GO:0043130] FSDEDISSTVK 0.95864 15.9841 15.9568 15.9841 0 0 0 15.9568 0 A0A2C9VRB8 Uncharacterized protein MANES_06G111200 A0A2C9VRB8_MANES Manihot esculenta (Cassava) (Jatropha manihot) MKFHERGR 0.96865 0 15.9625 0 0 0 0 0 15.9625 A0A2C9VTH6 E3 ubiquitin protein ligase (EC 2.3.2.27) MANES_05G051900 A0A2C9VTH6_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin organization [GO:0006325];histone monoubiquitination [GO:0010390] nucleus [GO:0005634] nucleus [GO:0005634];metal ion binding [GO:0046872];ubiquitin-protein transferase activity [GO:0004842];chromatin organization [GO:0006325];histone monoubiquitination [GO:0010390] metal ion binding [GO:0046872];ubiquitin-protein transferase activity [GO:0004842] EMESALKELLDEASSR 0.96099 13.5747 15.9625 13.5747 0 0 0 0 15.9625 A0A2C9VAD0 Utp13 domain-containing protein MANES_09G127900 A0A2C9VAD0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "cell division [GO:0051301];embryo development ending in seed dormancy [GO:0009793];embryonic pattern specification [GO:0009880];endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000480];endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000472]" 90S preribosome [GO:0030686];nucleolus [GO:0005730];small-subunit processome [GO:0032040] "90S preribosome [GO:0030686];nucleolus [GO:0005730];small-subunit processome [GO:0032040];U3 snoRNA binding [GO:0034511];cell division [GO:0051301];embryo development ending in seed dormancy [GO:0009793];embryonic pattern specification [GO:0009880];endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000480];endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000472]" U3 snoRNA binding [GO:0034511] IVDSANASIR 0.95904 0 15.9641 0 0 0 14.3009 15.9641 14.8831 A0A251LA49 FHA domain-containing protein MANES_03G127500 A0A251LA49_MANES Manihot esculenta (Cassava) (Jatropha manihot) DGNRRER 0.9613 0 15.9657 0 0 0 15.9657 0 0 A0A2C9U8S2 Protein kinase domain-containing protein MANES_16G044700 A0A2C9U8S2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] PTMSEVVKMLEGR 0.97527 0 15.9657 0 0 0 15.9657 0 0 A0A2C9UPX3 Non-specific serine/threonine protein kinase (EC 2.7.11.1) MANES_13G073600 A0A2C9UPX3_MANES Manihot esculenta (Cassava) (Jatropha manihot) recognition of pollen [GO:0048544] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];recognition of pollen [GO:0048544] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] HEISTMWTTSLGGG 0.9744 13.9382 15.9657 0 13.9382 0 15.9657 0 0 A0A2C9V457 Uncharacterized protein MANES_10G006500 A0A2C9V457_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];protein dimerization activity [GO:0046983];sequence-specific DNA binding [GO:0043565];regulation of transcription, DNA-templated [GO:0006355]" DNA-binding transcription factor activity [GO:0003700];protein dimerization activity [GO:0046983];sequence-specific DNA binding [GO:0043565] LNQDIESSQASSQR 0.96754 0 15.9694 0 0 0 0 15.9694 0 A0A2C9WDG2 Aamy domain-containing protein MANES_02G054500 A0A2C9WDG2_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] catalytic activity [GO:0003824];carbohydrate metabolic process [GO:0005975] catalytic activity [GO:0003824] GNPSSGM 0.96972 15.9676 15.9743 0 15.9676 0 15.9743 0 0 A0A2C9UQ61 Uncharacterized protein (Fragment) MANES_13G081300 A0A2C9UQ61_MANES Manihot esculenta (Cassava) (Jatropha manihot) AKQFNTGAWWLR 0.96728 0 15.9822 0 0 0 15.9822 0 0 A0A2C9U864 Uncharacterized protein MANES_16G021600 A0A2C9U864_MANES Manihot esculenta (Cassava) (Jatropha manihot) "generation of catalytic spliceosome for first transesterification step [GO:0000349];mRNA splicing, via spliceosome [GO:0000398]" post-mRNA release spliceosomal complex [GO:0071014];Prp19 complex [GO:0000974];U2-type catalytic step 2 spliceosome [GO:0071007] "post-mRNA release spliceosomal complex [GO:0071014];Prp19 complex [GO:0000974];U2-type catalytic step 2 spliceosome [GO:0071007];generation of catalytic spliceosome for first transesterification step [GO:0000349];mRNA splicing, via spliceosome [GO:0000398]" HTLWLELCDLLTR 0.96331 14.9253 15.9842 14.2869 14.9253 14.5075 14.4228 0 15.9842 A0A199U9Z2 AAA domain-containing protein MANES_S087000 A0A199U9Z2_MANES Manihot esculenta (Cassava) (Jatropha manihot) ADP binding [GO:0043531] ADP binding [GO:0043531] ETEDLCLDEVR 1 15.4025 15.9921 15.4025 0 13.1913 0 0 15.9921 A0A2C9UBI4 Bromo domain-containing protein MANES_15G005300 A0A2C9UBI4_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoskeleton organization [GO:0007010];regulation of cell shape [GO:0008360];regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] nucleus [GO:0005634];cytoskeleton organization [GO:0007010];regulation of cell shape [GO:0008360];regulation of transcription by RNA polymerase II [GO:0006357] MYNVVYK 0.96666 0 16.0121 0 0 0 16.0121 0 0 A0A2C9VBY7 Uncharacterized protein MANES_09G183600 A0A2C9VBY7_MANES Manihot esculenta (Cassava) (Jatropha manihot) xanthophyll biosynthetic process [GO:0016123] "carotene beta-ring hydroxylase activity [GO:0010291];heme binding [GO:0020037];iron ion binding [GO:0005506];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705];xanthophyll biosynthetic process [GO:0016123]" "carotene beta-ring hydroxylase activity [GO:0010291];heme binding [GO:0020037];iron ion binding [GO:0005506];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" IKPPIIPK 0.95329 20.4187 16.0148 17.3273 20.4187 18.473 16.0148 0 0 A0A2C9U4V9 Uncharacterized protein MANES_17G043700 A0A2C9U4V9_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] NKSALDWDSERR 0.95844 0 16.0538 0 0 0 0 16.0538 0 A0A2C9V8M8 Uncharacterized protein MANES_09G071700 A0A2C9V8M8_MANES Manihot esculenta (Cassava) (Jatropha manihot) LYKEMVEFSGFK 0.96849 0 16.0604 0 0 0 0 0 16.0604 A0A2C9UTX5 DYW_deaminase domain-containing protein MANES_12G065700 A0A2C9UTX5_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA modification [GO:0009451] zinc ion binding [GO:0008270];RNA modification [GO:0009451] zinc ion binding [GO:0008270] DAGYVPETKFALYDLEPENK 0.95725 10.192 16.0659 0 0 10.192 15.138 0 16.0659 A0A2C9USU2 TPX2 domain-containing protein MANES_12G017400 A0A2C9USU2_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737];microtubule [GO:0005874] cytoplasm [GO:0005737];microtubule [GO:0005874] WSIFSHNRYLEEVEQFSK 0.96783 17.9471 16.0659 17.9471 15.7232 17.4148 0 12.7278 16.0659 A0A2C9W0Z2 Cyclic nucleotide-binding domain-containing protein MANES_04G019100 A0A2C9W0Z2_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ion channel activity [GO:0005216] ion channel activity [GO:0005216] TPLFDEMDETMLDAICER 0.99392 0 16.1004 0 0 0 0 0 16.1004 A0A2C9WBZ6 Uncharacterized protein MANES_02G082600 A0A2C9WBZ6_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] YEEFDGEDVDEADDVSPKK 0.96404 0 16.1125 0 0 0 0 16.1125 0 A0A251KLG8 CBFD_NFYB_HMF domain-containing protein MANES_09G080600 A0A251KLG8_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of transcription by RNA polymerase II [GO:0006357] CCAAT-binding factor complex [GO:0016602] "CCAAT-binding factor complex [GO:0016602];DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein heterodimerization activity [GO:0046982];sequence-specific DNA binding [GO:0043565];regulation of transcription by RNA polymerase II [GO:0006357]" "DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein heterodimerization activity [GO:0046982];sequence-specific DNA binding [GO:0043565]" SNSNSNVREQDR 0.95425 0 16.1148 0 0 0 16.1148 0 0 A0A2C9UBJ8 BEACH domain-containing protein MANES_15G004000 A0A2C9UBJ8_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response to bacterium [GO:0042742];protein targeting to vacuole [GO:0006623] ATP binding [GO:0005524];protein kinase activity [GO:0004672];defense response to bacterium [GO:0042742];protein targeting to vacuole [GO:0006623] ATP binding [GO:0005524];protein kinase activity [GO:0004672] CYSTNISAVNECQSNGVER 1.0019 0 16.1334 0 0 0 15.6874 0 16.1334 A0A2C9WG55 DCD domain-containing protein MANES_02G131800 A0A2C9WG55_MANES Manihot esculenta (Cassava) (Jatropha manihot) EFDKIVGCEEDK 0.96774 0 16.1498 0 0 0 0 14.9295 16.1498 A0A2C9UMT7 Uncharacterized protein MANES_14G148500 A0A2C9UMT7_MANES Manihot esculenta (Cassava) (Jatropha manihot) metal ion binding [GO:0046872] metal ion binding [GO:0046872] SLSCQKFPYMK 0.95463 0 16.1527 0 0 0 0 0 16.1527 A0A2C9V3V4 Uncharacterized protein MANES_10G063100 A0A2C9V3V4_MANES Manihot esculenta (Cassava) (Jatropha manihot) ECIPDENNINSSEARWSHR 1.0088 16.4162 16.1582 0 0 16.4162 0 15.7647 16.1582 A0A2C9U930 "Formate dehydrogenase, mitochondrial (FDH) (EC 1.17.1.9) (NAD-dependent formate dehydrogenase)" MANES_17G122100 A0A2C9U930_MANES Manihot esculenta (Cassava) (Jatropha manihot) formate catabolic process [GO:0042183] chloroplast [GO:0009507];formate dehydrogenase complex [GO:0009326];mitochondrion [GO:0005739] "chloroplast [GO:0009507];formate dehydrogenase complex [GO:0009326];mitochondrion [GO:0005739];formate dehydrogenase (NAD+) activity [GO:0008863];NAD binding [GO:0051287];oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616];formate catabolic process [GO:0042183]" "formate dehydrogenase (NAD+) activity [GO:0008863];NAD binding [GO:0051287];oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]" EWLESKGHRYIVTDDK 0.96286 0 16.172 0 0 0 16.172 0 0 A0A2C9VGX3 Protein kinase domain-containing protein MANES_08G166400 A0A2C9VGX3_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] LIGYCCEDDHRLLVYEFMFR 0.96797 0 16.1743 0 0 0 0 16.1743 0 A0A251K4D1 Uncharacterized protein MANES_12G081700 A0A251K4D1_MANES Manihot esculenta (Cassava) (Jatropha manihot) meiotic sister chromatid cohesion [GO:0051177];reciprocal meiotic recombination [GO:0007131] meiotic sister chromatid cohesion [GO:0051177];reciprocal meiotic recombination [GO:0007131] NQEQSQVNPVEEMFNELMKWR 0.97254 0 16.1743 0 0 0 0 16.1743 0 A0A251KC44 Uncharacterized protein MANES_11G148600 A0A251KC44_MANES Manihot esculenta (Cassava) (Jatropha manihot) KSHLVNDFDNCK 0.96959 0 16.1789 0 0 0 16.1789 0 0 A0A251IW83 Uncharacterized protein MANES_17G084000 A0A251IW83_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634] IIDSPRR 0.96945 14.2979 16.1827 0 0 14.2979 0 0 16.1827 A0A2C9VDL9 RING-type E3 ubiquitin transferase (EC 2.3.2.27) MANES_09G180200 A0A2C9VDL9_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567];rescue of stalled ribosome [GO:0072344] metal ion binding [GO:0046872];ribosome binding [GO:0043022];ubiquitin protein ligase activity [GO:0061630];protein ubiquitination [GO:0016567];rescue of stalled ribosome [GO:0072344] metal ion binding [GO:0046872];ribosome binding [GO:0043022];ubiquitin protein ligase activity [GO:0061630] ETMNLQLNHKPLLDEEK 0.99424 18.9041 16.2034 18.5559 18.9041 17.8381 0 0 16.2034 A0A251L5X1 Protein kinase domain-containing protein MANES_03G013800 A0A251L5X1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] IGRGPFGDLWLATHHQMTEDYDEYHEVAVK 0.95635 0 16.222 0 0 0 0 0 16.222 A0A2C9VKD4 Uncharacterized protein MANES_07G027100 A0A2C9VKD4_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] beta-glucosidase activity [GO:0008422];carbohydrate metabolic process [GO:0005975] beta-glucosidase activity [GO:0008422] TALDFMFGLWMEPMTYGRYPKTMTDLAGDR 1 0 16.222 0 0 0 0 0 16.222 A0A2C9U3V2 Uncharacterized protein (Fragment) MANES_18G122600 A0A2C9U3V2_MANES Manihot esculenta (Cassava) (Jatropha manihot) "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" DGGIMAYIKVDEGLGSFSADVISRACFGSNYSK 1.0433 0 16.222 0 0 0 0 0 16.222 A0A2C9U1B0 Uncharacterized protein MANES_18G071100 A0A2C9U1B0_MANES Manihot esculenta (Cassava) (Jatropha manihot) ELDESKAEWESISGK 0.97948 15.1051 16.222 0 15.1051 0 0 0 16.222 A0A2C9W2X8 Kinesin-like protein MANES_04G083600 A0A2C9W2X8_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] microtubule [GO:0005874] microtubule [GO:0005874];ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777] RIGETSLNEKSSR 1 0 16.2457 0 0 0 16.2457 0 0 A0A2C9VTX9 Potassium transporter MANES_05G065200 A0A2C9VTX9_MANES Manihot esculenta (Cassava) (Jatropha manihot) potassium ion transport [GO:0006813] integral component of membrane [GO:0016021];membrane [GO:0016020];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];membrane [GO:0016020];plasma membrane [GO:0005886];potassium ion transmembrane transporter activity [GO:0015079];potassium ion transport [GO:0006813] potassium ion transmembrane transporter activity [GO:0015079] KHNDLVPDTFYK 0.95773 0 16.2483 0 0 0 0 16.2483 0 A0A251J8W0 Uncharacterized protein MANES_14G011800 A0A251J8W0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "cell cycle [GO:0007049];cell division [GO:0051301];positive regulation of DNA-templated transcription, elongation [GO:0032786];regulation of transcription by RNA polymerase II [GO:0006357]" cyclin/CDK positive transcription elongation factor complex [GO:0008024];nucleus [GO:0005634] "cyclin/CDK positive transcription elongation factor complex [GO:0008024];nucleus [GO:0005634];cyclin-dependent protein serine/threonine kinase activator activity [GO:0061575];cyclin-dependent protein serine/threonine kinase regulator activity [GO:0016538];cell cycle [GO:0007049];cell division [GO:0051301];positive regulation of DNA-templated transcription, elongation [GO:0032786];regulation of transcription by RNA polymerase II [GO:0006357]" cyclin-dependent protein serine/threonine kinase activator activity [GO:0061575];cyclin-dependent protein serine/threonine kinase regulator activity [GO:0016538] KSWSPSDKMPEGK 0.9581 0 16.2483 0 0 0 0 16.2483 0 A0A2C9V3G1 Uncharacterized protein MANES_10G051200 A0A2C9V3G1_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA binding [GO:0003723];zinc ion binding [GO:0008270] RNA binding [GO:0003723];zinc ion binding [GO:0008270] CGRLGHWAR 0.96053 0 16.2483 0 0 0 0 16.2483 0 A0A2C9V7E8 Uncharacterized protein MANES_10G140300 A0A2C9V7E8_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634] KRSDHDVDSFDR 0.95598 12.2153 16.2483 0 0 12.2153 0 16.2483 0 A9YME8 Catalase (EC 1.11.1.6) (Fragment) CAT2 A9YME8_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrogen peroxide catabolic process [GO:0042744];response to oxidative stress [GO:0006979] peroxisome [GO:0005777] peroxisome [GO:0005777];catalase activity [GO:0004096];heme binding [GO:0020037];metal ion binding [GO:0046872];hydrogen peroxide catabolic process [GO:0042744];response to oxidative stress [GO:0006979] catalase activity [GO:0004096];heme binding [GO:0020037];metal ion binding [GO:0046872] YRSWTPDRQER 0.96096 0 16.2494 0 0 0 16.2494 0 0 A0A2C9WM37 ZF-HD dimerization-type domain-containing protein MANES_01G185600 A0A2C9WM37_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];transcription cis-regulatory region binding [GO:0000976];regulation of transcription, DNA-templated [GO:0006355]" DNA-binding transcription factor activity [GO:0003700];transcription cis-regulatory region binding [GO:0000976] MDLTPSK 0.95358 16.2747 16.2554 16.2747 0 0 0 16.2554 0 A0A2C9U748 Uncharacterized protein MANES_17G113000 A0A2C9U748_MANES Manihot esculenta (Cassava) (Jatropha manihot) alkane biosynthetic process [GO:0043447];cuticle hydrocarbon biosynthetic process [GO:0006723];embryo development ending in seed dormancy [GO:0009793];negative regulation of RNA interference [GO:1900369] cytoplasm [GO:0005737];integral component of membrane [GO:0016021] cytoplasm [GO:0005737];integral component of membrane [GO:0016021];alkane biosynthetic process [GO:0043447];cuticle hydrocarbon biosynthetic process [GO:0006723];embryo development ending in seed dormancy [GO:0009793];negative regulation of RNA interference [GO:1900369] WKSENGFVDRTK 0.95236 0 16.2719 0 0 0 16.2719 0 0 A0A2C9VRU1 Protein kinase domain-containing protein MANES_06G176000 A0A2C9VRU1_MANES Manihot esculenta (Cassava) (Jatropha manihot) signal transduction [GO:0007165] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674];signal transduction [GO:0007165] ATP binding [GO:0005524];protein kinase activity [GO:0004672];protein serine/threonine kinase activity [GO:0004674] SDYGSVHSVPQTSSEHDIQQFLHGFTSDSSSTKMK 0.99319 0 16.2867 0 0 0 0 0 16.2867 A0A2C9VLR9 Non-specific serine/threonine protein kinase (EC 2.7.11.1) MANES_06G011500 A0A2C9VLR9_MANES Manihot esculenta (Cassava) (Jatropha manihot) recognition of pollen [GO:0048544] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];protein serine kinase activity [GO:0106310];protein serine/threonine kinase activity [GO:0004674];protein serine/threonine/tyrosine kinase activity [GO:0004712];recognition of pollen [GO:0048544] ATP binding [GO:0005524];protein serine/threonine/tyrosine kinase activity [GO:0004712];protein serine/threonine kinase activity [GO:0004674];protein serine kinase activity [GO:0106310] LLGCCIQGEEPMLVYEYMPNKSLDSFLFDETR 1.0168 0 16.2867 0 0 0 0 0 16.2867 A0A2C9VAL1 RING-type E3 ubiquitin transferase (EC 2.3.2.27) MANES_09G090000 A0A2C9VAL1_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];protein ubiquitination [GO:0016567] LSVCKHSFHASCINMWLNSHSNCPVCRASVPAK 1.0388 0 16.2867 0 0 0 13.7802 0 16.2867 A0A2C9WG36 PUM-HD domain-containing protein MANES_02G129900 A0A2C9WG36_MANES Manihot esculenta (Cassava) (Jatropha manihot) posttranscriptional regulation of gene expression [GO:0010608];regulation of translation [GO:0006417] cytoplasm [GO:0005737] cytoplasm [GO:0005737];mRNA binding [GO:0003729];posttranscriptional regulation of gene expression [GO:0010608];regulation of translation [GO:0006417] mRNA binding [GO:0003729] RQEADDLER 1.006 0 16.2903 0 0 0 0 16.2903 0 A0A2C9W7J4 Uncharacterized protein MANES_03G148900 A0A2C9W7J4_MANES Manihot esculenta (Cassava) (Jatropha manihot) xylem development [GO:0010089] apoplast [GO:0048046] apoplast [GO:0048046];receptor serine/threonine kinase binding [GO:0033612];xylem development [GO:0010089] receptor serine/threonine kinase binding [GO:0033612] AAAHEVPSGPNPESN 0.97381 0 16.295 0 0 0 16.295 0 0 A0A2C9UKK6 Uncharacterized protein MANES_14G105400 A0A2C9UKK6_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];glycosyltransferase activity [GO:0016757] glycosyltransferase activity [GO:0016757] KFLPTALDRLMR 1.0158 0 16.3103 0 0 0 13.7802 0 16.3103 A0A2C9U0N8 Uncharacterized protein MANES_18G047800 A0A2C9U0N8_MANES Manihot esculenta (Cassava) (Jatropha manihot) secondary metabolic process [GO:0019748] integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747];serine-type carboxypeptidase activity [GO:0004185];secondary metabolic process [GO:0019748]" "acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747];serine-type carboxypeptidase activity [GO:0004185]" TYSNQMTYATVK 0.95631 0 16.3288 0 0 0 0 0 16.3288 A0A2C9UX82 Uncharacterized protein MANES_12G127000 A0A2C9UX82_MANES Manihot esculenta (Cassava) (Jatropha manihot) DFFVGCD 0.96746 14.2155 16.3563 14.2155 0 0 0 16.3563 0 A0A2C9W5Z5 Kinesin-like protein MANES_03G044500 A0A2C9W5Z5_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] microtubule [GO:0005874] microtubule [GO:0005874];ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777] LVGFCETSEHFSKEMFELNFVNPCDKR 0.97664 0 16.3605 0 0 0 16.3605 0 0 A0A0A1G3W1 Phosphate transporter PT4;7 A0A0A1G3W1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] VSSDDSRFGSLGDDSESQAPRFVEFITSER 0.98445 0 16.3605 0 0 0 16.3605 0 0 A0A2C9VPK3 BZIP domain-containing protein MANES_06G019400 A0A2C9VPK3_MANES Manihot esculenta (Cassava) (Jatropha manihot) "anther dehiscence [GO:0009901];cellular response to glucose stimulus [GO:0071333];cellular response to starvation [GO:0009267];positive regulation of transcription, DNA-templated [GO:0045893];regulation of cellular amino acid metabolic process [GO:0006521];response to bacterium [GO:0009617];response to salt stress [GO:0009651];sugar mediated signaling pathway [GO:0010182]" nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];protein heterodimerization activity [GO:0046982];transcription cis-regulatory region binding [GO:0000976];anther dehiscence [GO:0009901];cellular response to glucose stimulus [GO:0071333];cellular response to starvation [GO:0009267];positive regulation of transcription, DNA-templated [GO:0045893];regulation of cellular amino acid metabolic process [GO:0006521];response to bacterium [GO:0009617];response to salt stress [GO:0009651];sugar mediated signaling pathway [GO:0010182]" DNA-binding transcription factor activity [GO:0003700];protein heterodimerization activity [GO:0046982];transcription cis-regulatory region binding [GO:0000976] ETEDSNHVHGPAQQVKACEMSKF 0.98255 0 16.3872 0 0 0 0 15.9436 16.3872 A0A2C9VUQ0 NAC domain-containing protein (Fragment) MANES_05G091800 A0A2C9VUQ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" "DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] QLQDACYDESLWLEHFTSKMK 0.99903 0 16.3872 0 0 0 0 0 16.3872 A0A2C9UA52 Uncharacterized protein MANES_16G058300 A0A2C9UA52_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein dimerization activity [GO:0046983] protein dimerization activity [GO:0046983] ILLEEGLPFR 0.96285 15.3557 16.4163 15.3557 0 0 16.4163 0 0 A0A2C9VKY6 Uncharacterized protein MANES_07G075700 A0A2C9VKY6_MANES Manihot esculenta (Cassava) (Jatropha manihot) methylation [GO:0032259] O-methyltransferase activity [GO:0008171];S-adenosylmethionine-dependent methyltransferase activity [GO:0008757];methylation [GO:0032259] O-methyltransferase activity [GO:0008171];S-adenosylmethionine-dependent methyltransferase activity [GO:0008757] YYRDFVMELNK 0.95979 0 16.4233 0 0 0 0 16.4233 0 A0A2C9U4W2 Protein kinase domain-containing protein MANES_17G018300 A0A2C9U4W2_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] PSMKECAEVLWK 0.96826 0 16.4233 0 0 0 0 16.4233 0 A0A2C9UJ75 Uncharacterized protein MANES_14G058000 A0A2C9UJ75_MANES Manihot esculenta (Cassava) (Jatropha manihot) "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" "heme binding [GO:0020037];iron ion binding [GO:0005506];monooxygenase activity [GO:0004497];oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]" TQHEDFVDVLLR 0.9637 18.7283 16.4375 0 0 18.7283 16.4375 12.3373 0 A0A2C9W0A6 Phosphoinositide phospholipase C (EC 3.1.4.11) MANES_04G025600 A0A2C9W0A6_MANES Manihot esculenta (Cassava) (Jatropha manihot) lipid catabolic process [GO:0016042];phosphatidylinositol-mediated signaling [GO:0048015] plasma membrane [GO:0005886] plasma membrane [GO:0005886];phosphatidylinositol phospholipase C activity [GO:0004435];lipid catabolic process [GO:0016042];phosphatidylinositol-mediated signaling [GO:0048015] phosphatidylinositol phospholipase C activity [GO:0004435] VDPEKVR 0.9659 0 16.4498 0 0 0 0 0 16.4498 A0A2C9UGQ9 MADS-box domain-containing protein MANES_15G161100 A0A2C9UGQ9_MANES Manihot esculenta (Cassava) (Jatropha manihot) regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] "nucleus [GO:0005634];DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];regulation of transcription by RNA polymerase II [GO:0006357]" "DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981];protein dimerization activity [GO:0046983];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]" IINKYKK 0.9619 0 16.4577 0 0 0 0 16.4577 15.8655 A0A2C9W7I4 Uncharacterized protein MANES_03G145900 A0A2C9W7I4_MANES Manihot esculenta (Cassava) (Jatropha manihot) autophagy [GO:0006914];ceramide metabolic process [GO:0006672];defense response to other organism [GO:0098542];response to salt stress [GO:0009651] integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021];hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [GO:0016811];autophagy [GO:0006914];ceramide metabolic process [GO:0006672];defense response to other organism [GO:0098542];response to salt stress [GO:0009651]" "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [GO:0016811]" ADGIPSFWGPVTSADWCEK 0.96445 0 16.4577 0 0 0 0 16.4577 0 A0A2C9WM14 Phytocyanin domain-containing protein MANES_01G100000 A0A2C9WM14_MANES Manihot esculenta (Cassava) (Jatropha manihot) anchored component of plasma membrane [GO:0046658];integral component of membrane [GO:0016021] anchored component of plasma membrane [GO:0046658];integral component of membrane [GO:0016021];electron transfer activity [GO:0009055] electron transfer activity [GO:0009055] DKHFYNGDWLFFVYDR 0.95825 0 16.4603 0 0 0 16.4603 16.0563 0 A0A2C9V3F0 Uncharacterized protein MANES_10G054600 A0A2C9V3F0_MANES Manihot esculenta (Cassava) (Jatropha manihot) SVVKDEAEMAVGGDGEADNTK 0.96302 13.8765 16.4603 0 0 13.8765 16.4603 0 0 A0A2C9WHL9 Uncharacterized protein MANES_02G220100 A0A2C9WHL9_MANES Manihot esculenta (Cassava) (Jatropha manihot) SGAMIAYDYFK 0.95892 0 16.4605 0 0 0 0 16.4605 0 A0A2C9UQJ1 Uncharacterized protein MANES_13G101300 A0A2C9UQJ1_MANES Manihot esculenta (Cassava) (Jatropha manihot) UDP-glycosyltransferase activity [GO:0008194] UDP-glycosyltransferase activity [GO:0008194] KQDNSVELPDGFK 0.96195 0 16.476 0 0 0 0 16.476 0 A0A251JTY2 t-SNARE coiled-coil homology domain-containing protein MANES_11G086000 A0A251JTY2_MANES Manihot esculenta (Cassava) (Jatropha manihot) exocytosis [GO:0006887];intracellular protein transport [GO:0006886];vesicle docking [GO:0048278];vesicle fusion [GO:0006906] endomembrane system [GO:0012505];integral component of membrane [GO:0016021];plasma membrane [GO:0005886];SNARE complex [GO:0031201] endomembrane system [GO:0012505];integral component of membrane [GO:0016021];plasma membrane [GO:0005886];SNARE complex [GO:0031201];SNAP receptor activity [GO:0005484];SNARE binding [GO:0000149];exocytosis [GO:0006887];intracellular protein transport [GO:0006886];vesicle docking [GO:0048278];vesicle fusion [GO:0006906] SNAP receptor activity [GO:0005484];SNARE binding [GO:0000149] EGSPIDRTR 0.9596 0 16.4819 0 0 0 16.4819 0 0 A0A2C9W2D3 Occludin_ELL domain-containing protein MANES_04G137600 A0A2C9W2D3_MANES Manihot esculenta (Cassava) (Jatropha manihot) FIFSDHDAIQER 0.95675 0 16.4903 0 0 0 16.4903 0 0 A0A2C9W8Z1 Zinc-hook domain-containing protein MANES_03G144200 A0A2C9W8Z1_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromosome organization involved in meiotic cell cycle [GO:0070192];DNA duplex unwinding [GO:0032508];double-strand break repair [GO:0006302];nucleic acid phosphodiester bond hydrolysis [GO:0090305];telomere capping [GO:0016233];telomere maintenance via recombination [GO:0000722];telomere maintenance via telomerase [GO:0007004] condensed nuclear chromosome [GO:0000794];cytoplasm [GO:0005737];Mre11 complex [GO:0030870] condensed nuclear chromosome [GO:0000794];cytoplasm [GO:0005737];Mre11 complex [GO:0030870];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];double-stranded telomeric DNA binding [GO:0003691];G-quadruplex DNA binding [GO:0051880];metal ion binding [GO:0046872];single-stranded telomeric DNA binding [GO:0043047];chromosome organization involved in meiotic cell cycle [GO:0070192];DNA duplex unwinding [GO:0032508];double-strand break repair [GO:0006302];nucleic acid phosphodiester bond hydrolysis [GO:0090305];telomere capping [GO:0016233];telomere maintenance via recombination [GO:0000722];telomere maintenance via telomerase [GO:0007004] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];double-stranded telomeric DNA binding [GO:0003691];G-quadruplex DNA binding [GO:0051880];metal ion binding [GO:0046872];single-stranded telomeric DNA binding [GO:0043047] DLDRYYNAVDK 0.96431 14.4061 16.5082 14.4061 0 0 0 16.5082 0 A0A2C9UUG0 Histidine kinase (EC 2.7.13.3) MANES_12G009800 A0A2C9UUG0_MANES Manihot esculenta (Cassava) (Jatropha manihot) anatomical structure development [GO:0048856];cytokinin-activated signaling pathway [GO:0009736] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];phosphorelay sensor kinase activity [GO:0000155];anatomical structure development [GO:0048856];cytokinin-activated signaling pathway [GO:0009736] phosphorelay sensor kinase activity [GO:0000155] EDRENVLR 0.96641 0 16.5141 0 0 0 0 0 16.5141 A0A2C9VUU5 Uncharacterized protein MANES_05G095800 A0A2C9VUU5_MANES Manihot esculenta (Cassava) (Jatropha manihot) EIWNEAEIAGFK 0.95632 0 16.5582 0 0 0 0 16.5582 0 A0A2C9UI91 Uncharacterized protein MANES_15G185700 A0A2C9UI91_MANES Manihot esculenta (Cassava) (Jatropha manihot) MTTLYKSYGGNDK 0.97446 0 16.5601 0 0 0 16.5601 0 0 A0A2C9U4F1 Uncharacterized protein MANES_17G002400 A0A2C9U4F1_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] GSGIIFEDLMMHK 0.95977 0 16.59 0 0 0 16.59 0 0 A0A2C9V432 Uncharacterized protein MANES_10G031300 A0A2C9V432_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA binding [GO:0003677] DNA binding [GO:0003677] FYLYNRACNEK 0.98555 0 16.59 0 0 0 16.59 0 0 A0A199UC15 Uncharacterized protein MANES_S022800 A0A199UC15_MANES Manihot esculenta (Cassava) (Jatropha manihot) NEAAERFETYK 0.96997 14.154 16.6048 14.154 0 0 0 16.6048 0 A0A2C9UR23 Uncharacterized protein MANES_13G054300 A0A2C9UR23_MANES Manihot esculenta (Cassava) (Jatropha manihot) DDLPFTQCFESAREGGLIR 0.98254 0 16.6057 0 0 0 0 0 16.6057 A0A2C9W785 Uncharacterized protein MANES_03G064400 A0A2C9W785_MANES Manihot esculenta (Cassava) (Jatropha manihot) ALTQLQNSSHGPPQ 0.96755 0 16.6119 0 0 0 16.6119 0 0 A0A2C9UKD1 Replication termination factor 2 MANES_14G111500 A0A2C9UKD1_MANES Manihot esculenta (Cassava) (Jatropha manihot) mitotic DNA replication termination [GO:1902979] nucleus [GO:0005634] nucleus [GO:0005634];mitotic DNA replication termination [GO:1902979] ETFSCRSLPLGR 0.96567 0 16.6197 0 0 0 16.6197 0 0 A0A251J556 HECT-type E3 ubiquitin transferase (EC 2.3.2.26) MANES_18G056900 A0A251J556_MANES Manihot esculenta (Cassava) (Jatropha manihot) positive regulation of protein catabolic process [GO:0045732];proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161];protein polyubiquitination [GO:0000209];protein ubiquitination [GO:0016567] cytoplasm [GO:0005737] cytoplasm [GO:0005737];ubiquitin protein ligase activity [GO:0061630];positive regulation of protein catabolic process [GO:0045732];proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161];protein polyubiquitination [GO:0000209];protein ubiquitination [GO:0016567] ubiquitin protein ligase activity [GO:0061630] AAQSVCQVEMVGER 0.96722 0 16.624 0 0 0 16.624 0 0 A0A2C9WH45 Uncharacterized protein MANES_01G011700 A0A2C9WH45_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] ATP binding [GO:0005524];cytoskeletal motor activity [GO:0003774];microtubule binding [GO:0008017];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];cytoskeletal motor activity [GO:0003774];microtubule binding [GO:0008017] CLQMETEANDAKADLEKR 0.96716 0 16.625 0 0 0 16.625 0 0 A0A251J538 Uncharacterized protein MANES_15G113700 A0A251J538_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast organization [GO:0009658];Group II intron splicing [GO:0000373] RNA binding [GO:0003723];chloroplast organization [GO:0009658];Group II intron splicing [GO:0000373] RNA binding [GO:0003723] RSYYYNNNNADNSHSFR 0.97911 0 16.625 0 0 0 16.625 0 0 A0A2C9V2L1 ATPase_AAA_core domain-containing protein MANES_10G027600 A0A2C9V2L1_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887] LVDTFPGQSIDFFGAVR 0.96119 14.08 16.6379 0 14.08 0 0 16.6379 16.4347 A0A2C9WJ12 VQ domain-containing protein MANES_01G010900 A0A2C9WJ12_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952] nucleus [GO:0005634] nucleus [GO:0005634];defense response [GO:0006952] VSHMIKK 0.96729 17.4165 16.641 0 17.4165 0 16.641 0 0 A0A2C9VJX5 Uncharacterized protein MANES_07G091000 A0A2C9VJX5_MANES Manihot esculenta (Cassava) (Jatropha manihot) ribosome biogenesis [GO:0042254] mitochondrion [GO:0005739] mitochondrion [GO:0005739];GTP binding [GO:0005525];GTPase activity [GO:0003924];ribosome biogenesis [GO:0042254] GTPase activity [GO:0003924];GTP binding [GO:0005525] WLCCAKSFCRIDALR 0.97188 0 16.6562 0 0 0 0 16.6562 0 A0A2C9V305 UDP-glucuronate decarboxylase (EC 4.1.1.35) MANES_10G032500 A0A2C9V305_MANES Manihot esculenta (Cassava) (Jatropha manihot) D-xylose metabolic process [GO:0042732];UDP-D-xylose biosynthetic process [GO:0033320] NAD+ binding [GO:0070403];UDP-glucuronate decarboxylase activity [GO:0048040];D-xylose metabolic process [GO:0042732];UDP-D-xylose biosynthetic process [GO:0033320] NAD+ binding [GO:0070403];UDP-glucuronate decarboxylase activity [GO:0048040] ITMVENTPDDPR 0.96632 0 16.6633 0 0 0 0 16.6633 0 A0A0M5JAB4 NAC transcription factors 35 A0A0M5JAB4_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" "DNA binding [GO:0003677];regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] EAKYPNGNRSNR 0.95877 0 16.6756 0 0 0 0 15.3862 16.6756 A0A2C9UC18 RRM domain-containing protein MANES_15G022600 A0A2C9UC18_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA splicing, via spliceosome [GO:0000398]" precatalytic spliceosome [GO:0071011];U2 snRNP [GO:0005686] "precatalytic spliceosome [GO:0071011];U2 snRNP [GO:0005686];RNA binding [GO:0003723];mRNA splicing, via spliceosome [GO:0000398]" RNA binding [GO:0003723] LLSSLKR 0.96706 14.089 16.6817 14.089 0 0 0 0 16.6817 A0A2C9UMW2 2OG-FeII_Oxy_2 domain-containing protein MANES_13G011800 A0A2C9UMW2_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA repair [GO:0006281] dioxygenase activity [GO:0051213];DNA repair [GO:0006281] dioxygenase activity [GO:0051213] SGDVVLMAGEARECFHGKC 0.99538 0 16.6833 0 0 0 16.2246 0 16.6833 A0A2C9VH91 Uncharacterized protein MANES_07G004000 A0A2C9VH91_MANES Manihot esculenta (Cassava) (Jatropha manihot) MMYNGSVWGLYR 0.95558 0 16.6906 0 0 0 0 16.6906 16.4442 A0A2C9W1N8 Protein FAR1-RELATED SEQUENCE MANES_04G111100 A0A2C9W1N8_MANES Manihot esculenta (Cassava) (Jatropha manihot) "regulation of transcription, DNA-templated [GO:0006355]" nucleus [GO:0005634] "nucleus [GO:0005634];zinc ion binding [GO:0008270];regulation of transcription, DNA-templated [GO:0006355]" zinc ion binding [GO:0008270] YGAVLCCSSQGFK 0.96147 0 16.7058 0 0 0 0 16.7058 0 A0A2C9W2V5 Uncharacterized protein MANES_04G156000 A0A2C9W2V5_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA damage checkpoint signaling [GO:0000077];positive regulation of transcription by RNA polymerase II [GO:0045944] nucleus [GO:0005634] nucleus [GO:0005634];histone binding [GO:0042393];DNA damage checkpoint signaling [GO:0000077];positive regulation of transcription by RNA polymerase II [GO:0045944] histone binding [GO:0042393] NSHANCFASRANK 0.97527 0 16.7058 0 0 0 0 16.7058 0 A0A2C9VCJ3 Hexosyltransferase (EC 2.4.1.-) MANES_08G015300 A0A2C9VCJ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell wall organization [GO:0071555];pectin biosynthetic process [GO:0045489] Golgi membrane [GO:0000139] Golgi membrane [GO:0000139];polygalacturonate 4-alpha-galacturonosyltransferase activity [GO:0047262];cell wall organization [GO:0071555];pectin biosynthetic process [GO:0045489] polygalacturonate 4-alpha-galacturonosyltransferase activity [GO:0047262] RQNLTELYHR 0.96251 0 16.7201 0 0 0 16.7201 0 0 A0A2C9V9V6 Uncharacterized protein MANES_09G072300 A0A2C9V9V6_MANES Manihot esculenta (Cassava) (Jatropha manihot) GTP binding [GO:0005525];GTPase activity [GO:0003924] GTPase activity [GO:0003924];GTP binding [GO:0005525] SITRSYYR 0.96205 0 16.7315 0 0 0 0 16.7315 0 A0A2C9V3F4 Peptidase_M28 domain-containing protein MANES_10G046400 A0A2C9V3F4_MANES Manihot esculenta (Cassava) (Jatropha manihot) proteolysis [GO:0006508] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];metalloexopeptidase activity [GO:0008235];proteolysis [GO:0006508] metalloexopeptidase activity [GO:0008235] GISQWAHGFK 0.98118 0 16.7315 0 0 0 16.7315 0 0 A0A2C9WKH4 BTB domain-containing protein MANES_01G058800 A0A2C9WKH4_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567] protein ubiquitination [GO:0016567] DSHPFLDSPSTFK 0.95842 0 16.7533 0 0 0 0 0 16.7533 A0A2C9VDT6 RING-type E3 ubiquitin transferase (EC 2.3.2.27) MANES_08G006400 A0A2C9VDT6_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567] ubiquitin protein ligase activity [GO:0061630];protein ubiquitination [GO:0016567] ubiquitin protein ligase activity [GO:0061630] VNNGPDE 0.96749 15.7701 16.7925 15.7701 0 0 0 16.7925 0 E3VVM4 Cysteine synthase (EC 2.5.1.47) MANES_01G255400 E3VVM4_MANES Manihot esculenta (Cassava) (Jatropha manihot) cyanide metabolic process [GO:0019499];cysteine biosynthetic process [GO:0019344];cysteine biosynthetic process from serine [GO:0006535] cytoplasm [GO:0005737];mitochondrion [GO:0005739] cytoplasm [GO:0005737];mitochondrion [GO:0005739];cysteine synthase activity [GO:0004124];L-3-cyanoalanine synthase activity [GO:0050017];cyanide metabolic process [GO:0019499];cysteine biosynthetic process [GO:0019344];cysteine biosynthetic process from serine [GO:0006535] cysteine synthase activity [GO:0004124];L-3-cyanoalanine synthase activity [GO:0050017] DRPAFAMINDAEK 0.97407 0 16.8012 0 0 0 0 16.8012 0 A0A2C9UCB0 BRCT domain-containing protein MANES_15G018000 A0A2C9UCB0_MANES Manihot esculenta (Cassava) (Jatropha manihot) EIGFNMPVSLAHARQHPLLQAVER 0.96533 0 16.8026 0 0 0 14.1562 16.8026 0 A0A2C9UFZ6 Protein kinase domain-containing protein MANES_15G137200 A0A2C9UFZ6_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] MGSGVVSEK 0.97683 17.5761 16.8163 13.1777 17.5761 0 0 0 16.8163 A0A2C9VQM9 Uncharacterized protein MANES_06G089300 A0A2C9VQM9_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] cytoplasm [GO:0005737];metal ion binding [GO:0046872] metal ion binding [GO:0046872] SHKPERSDEFDCTLCLK 0.97455 0 16.9056 0 0 0 15.3911 0 16.9056 A0A2C9UBR4 Exostosin domain-containing protein MANES_16G111200 A0A2C9UBR4_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein glycosylation [GO:0006486] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021] Golgi membrane [GO:0000139];integral component of membrane [GO:0016021];glycosyltransferase activity [GO:0016757];protein glycosylation [GO:0006486] glycosyltransferase activity [GO:0016757] SYPLEPK 0.95673 18.4714 16.9377 18.4714 0 0 0 16.9377 0 A0A2C9W7K6 GTD-binding domain-containing protein MANES_03G147800 A0A2C9W7K6_MANES Manihot esculenta (Cassava) (Jatropha manihot) myosin XI tail binding [GO:0080115] myosin XI tail binding [GO:0080115] KRSEGGVGSGVMDAK 0.97191 0 16.9379 0 0 0 0 0 16.9379 A0A2C9WEB8 Uncharacterized protein MANES_02G146300 A0A2C9WEB8_MANES Manihot esculenta (Cassava) (Jatropha manihot) GFGLPPPSK 1.02 18.9279 16.9456 18.9279 18.6769 0 0 16.9456 0 A0A2C9VYF9 Uncharacterized protein MANES_05G136400 A0A2C9VYF9_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrotropism [GO:0010274] hydrotropism [GO:0010274] IALECDRQKER 0.9609 17.7634 16.9892 17.7634 17.1668 0 0 0 16.9892 A0A2C9V997 Uncharacterized protein MANES_09G091300 A0A2C9V997_MANES Manihot esculenta (Cassava) (Jatropha manihot) pollen sperm cell differentiation [GO:0048235] pollen sperm cell differentiation [GO:0048235] EALDALDMINMNK 0.96783 0 17.0086 0 0 0 0 17.0086 0 A0A2C9WEW9 Uncharacterized protein MANES_02G175600 A0A2C9WEW9_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular protein transport [GO:0006886];vesicle-mediated transport [GO:0016192] Golgi membrane [GO:0000139] Golgi membrane [GO:0000139];intracellular protein transport [GO:0006886];vesicle-mediated transport [GO:0016192] SNQNIQTVEDMAK 0.95991 0 17.0149 0 0 0 0 17.0149 0 A0A2C9VSD7 PlsC domain-containing protein MANES_05G012900 A0A2C9VSD7_MANES Manihot esculenta (Cassava) (Jatropha manihot) cutin biosynthetic process [GO:0010143] integral component of membrane [GO:0016021];membrane [GO:0016020] integral component of membrane [GO:0016021];membrane [GO:0016020];glycerol-3-phosphate 2-O-acyltransferase activity [GO:0090447];phosphatase activity [GO:0016791];cutin biosynthetic process [GO:0010143] glycerol-3-phosphate 2-O-acyltransferase activity [GO:0090447];phosphatase activity [GO:0016791] GLLYVCNHR 0.96214 0 17.0153 0 0 0 16.8302 16.0986 17.0153 A0A2C9VBN4 Uncharacterized protein MANES_09G173700 A0A2C9VBN4_MANES Manihot esculenta (Cassava) (Jatropha manihot) SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146] SCF ubiquitin ligase complex [GO:0019005] SCF ubiquitin ligase complex [GO:0019005];SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146] CLLLEDLDLTDCSGIDDR 0.95935 0 17.0298 0 0 0 16.2246 16.4577 17.0298 A0A2C9URT2 C2H2-type domain-containing protein MANES_13G137400 A0A2C9URT2_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700] DNA-binding transcription factor activity [GO:0003700] ICGTREYKCDCGTLFSR 0.97455 0 17.0298 0 0 0 16.8998 16.4577 17.0298 A0A2C9UB09 Uncharacterized protein MANES_16G088800 A0A2C9UB09_MANES Manihot esculenta (Cassava) (Jatropha manihot) deoxyribonucleotide catabolic process [GO:0009264] 5'-nucleotidase activity [GO:0008253];deoxyribonucleotide catabolic process [GO:0009264] 5'-nucleotidase activity [GO:0008253] YSSNHSVSEYHVYEFFK 0.9809 0 17.0298 0 0 0 0 0 17.0298 A0A2C9VTN7 Uncharacterized protein MANES_05G010600 A0A2C9VTN7_MANES Manihot esculenta (Cassava) (Jatropha manihot) tRNA methylation [GO:0030488] cytoplasm [GO:0005737] cytoplasm [GO:0005737];tRNA methylation [GO:0030488] FKDFHLHCQQHK 1.0422 0 17.0298 0 0 0 0 0 17.0298 A0A2C9VLJ5 Uncharacterized protein MANES_07G066000 A0A2C9VLJ5_MANES Manihot esculenta (Cassava) (Jatropha manihot) plasma membrane [GO:0005886] plasma membrane [GO:0005886];ATP binding [GO:0005524];protein kinase activity [GO:0004672] ATP binding [GO:0005524];protein kinase activity [GO:0004672] NADRLTDSETRER 0.95877 15.1739 17.0655 15.1739 0 0 15.7329 17.0655 16.6558 A0A2C9UFK2 Uncharacterized protein MANES_15G095600 A0A2C9UFK2_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular protein transport [GO:0006886];vesicle-mediated transport [GO:0016192] CORVET complex [GO:0033263];plant-type vacuole membrane [GO:0009705];vacuole [GO:0005773] CORVET complex [GO:0033263];plant-type vacuole membrane [GO:0009705];vacuole [GO:0005773];intracellular protein transport [GO:0006886];vesicle-mediated transport [GO:0016192] PMEEILK 0.96704 14.3714 17.1017 14.3714 13.7159 0 0 0 17.1017 A0A2C9W3V6 Terpene cyclase/mutase family member (EC 5.4.99.-) MANES_04G106300 A0A2C9W3V6_MANES Manihot esculenta (Cassava) (Jatropha manihot) triterpenoid biosynthetic process [GO:0016104] lipid droplet [GO:0005811] lipid droplet [GO:0005811];beta-amyrin synthase activity [GO:0042300];lanosterol synthase activity [GO:0000250];triterpenoid biosynthetic process [GO:0016104] beta-amyrin synthase activity [GO:0042300];lanosterol synthase activity [GO:0000250] PLCMLACWVEDPNGDAFK 0.95894 0 17.1161 0 0 0 0 17.1161 0 O49893 Alpha-hydroxynitrile lyase HNL24 O49893_MANES Manihot esculenta (Cassava) (Jatropha manihot) lyase activity [GO:0016829] lyase activity [GO:0016829] VYQVQGGDHK 0.98293 0 17.1185 0 0 0 14.346 16.3939 17.1185 A0A251LR74 Uncharacterized protein MANES_01G124900 A0A251LR74_MANES Manihot esculenta (Cassava) (Jatropha manihot) helicase activity [GO:0004386];RNA binding [GO:0003723] helicase activity [GO:0004386];RNA binding [GO:0003723] IEDVDIR 0.96668 0 17.1241 0 0 0 17.1241 0 17.1017 A0A2C9UAL2 HSF_DOMAIN domain-containing protein MANES_16G100700 A0A2C9UAL2_MANES Manihot esculenta (Cassava) (Jatropha manihot) cellular response to heat [GO:0034605];regulation of transcription by RNA polymerase II [GO:0006357] nucleus [GO:0005634] nucleus [GO:0005634];DNA-binding transcription factor activity [GO:0003700];methyltransferase activity [GO:0008168];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978];cellular response to heat [GO:0034605];regulation of transcription by RNA polymerase II [GO:0006357] DNA-binding transcription factor activity [GO:0003700];methyltransferase activity [GO:0008168];RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978] NDQELLK 0.96727 0 17.1241 0 0 0 17.1241 0 0 A0A2C9VBM1 UBC core domain-containing protein MANES_09G122700 A0A2C9VBM1_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein polyubiquitination [GO:0000209];ubiquitin-dependent protein catabolic process [GO:0006511] nucleus [GO:0005634] nucleus [GO:0005634];ATP binding [GO:0005524];ubiquitin conjugating enzyme activity [GO:0061631];protein polyubiquitination [GO:0000209];ubiquitin-dependent protein catabolic process [GO:0006511] ATP binding [GO:0005524];ubiquitin conjugating enzyme activity [GO:0061631] ELNDLQK 0.96744 0 17.1241 0 0 0 17.1241 0 0 A0A2C9UHB4 XPGI domain-containing protein MANES_15G181100 A0A2C9UHB4_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA binding [GO:0003677];nuclease activity [GO:0004518] DNA binding [GO:0003677];nuclease activity [GO:0004518] EIDQVQK 0.96768 0 17.1241 0 0 0 17.1241 0 0 A0A2C9W7P0 Uncharacterized protein MANES_03G151600 A0A2C9W7P0_MANES Manihot esculenta (Cassava) (Jatropha manihot) RRNWWMAELR 0.96568 17.6776 17.162 0 17.6776 0 17.162 0 0 A0A251KQD0 Rab-GAP TBC domain-containing protein MANES_08G001400 A0A251KQD0_MANES Manihot esculenta (Cassava) (Jatropha manihot) EQEAAMLQVLMR 0.96984 0 17.1819 0 0 0 17.1819 0 0 A0A2C9VL88 PMR5N domain-containing protein MANES_07G135000 A0A2C9VL88_MANES Manihot esculenta (Cassava) (Jatropha manihot) Golgi apparatus [GO:0005794] Golgi apparatus [GO:0005794];O-acetyltransferase activity [GO:0016413] O-acetyltransferase activity [GO:0016413] DDLTRPLYDESECPYIQPQLTCQEHGR 0.95505 0 17.1891 0 0 0 0 0 17.1891 A0A2C9VY08 Kinesin-like protein MANES_05G201200 A0A2C9VY08_MANES Manihot esculenta (Cassava) (Jatropha manihot) microtubule-based movement [GO:0007018] microtubule [GO:0005874] microtubule [GO:0005874];ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777];microtubule-based movement [GO:0007018] ATP binding [GO:0005524];microtubule binding [GO:0008017];microtubule motor activity [GO:0003777] FDEVFSETASQK 0.95583 0 17.3213 0 0 0 0 0 17.3213 A0A2C9VNA4 zf-RVT domain-containing protein (Fragment) MANES_07G125500 A0A2C9VNA4_MANES Manihot esculenta (Cassava) (Jatropha manihot) LAVHAWK 0.96761 0 17.338 0 0 0 0 17.338 0 A0A2C9WHZ3 CRAL-TRIO domain-containing protein MANES_01G006200 A0A2C9WHZ3_MANES Manihot esculenta (Cassava) (Jatropha manihot) membrane [GO:0016020] membrane [GO:0016020] EYGTDTILEDFEFEELEEVLQYYPQGYHGVDK 0.47368 0 17.4068 0 0 0 17.4068 0 0 A0A2C9VTB4 S-acyltransferase (EC 2.3.1.225) (Palmitoyltransferase) MANES_05G046100 A0A2C9VTB4_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];protein-cysteine S-palmitoyltransferase activity [GO:0019706] protein-cysteine S-palmitoyltransferase activity [GO:0019706] CHHCSVCGRCVLKMDHHCVWVVNCVGALNYK 1.049 0 17.4068 0 0 0 17.4068 0 0 A0A2C9VUN0 Bet_v_1 domain-containing protein MANES_05G090000 A0A2C9VUN0_MANES Manihot esculenta (Cassava) (Jatropha manihot) abscisic acid-activated signaling pathway [GO:0009738];defense response [GO:0006952] abscisic acid binding [GO:0010427];protein phosphatase inhibitor activity [GO:0004864];signaling receptor activity [GO:0038023];abscisic acid-activated signaling pathway [GO:0009738];defense response [GO:0006952] abscisic acid binding [GO:0010427];protein phosphatase inhibitor activity [GO:0004864];signaling receptor activity [GO:0038023] SIQVLEGDGK 0.96128 0 17.4118 0 0 0 16.0014 0 17.4118 A0A2C9V736 RING-type E3 ubiquitin transferase (EC 2.3.2.27) MANES_10G103400 A0A2C9V736_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein ubiquitination [GO:0016567] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];protein ubiquitination [GO:0016567] RDCSNQGLLKFMGSSSIGR 0.95985 0 17.415 0 0 0 0 0 17.415 A0A251JFS0 Uncharacterized protein MANES_13G027900 A0A251JFS0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] GNYTAPSPGETADRCDWPK 0.98373 16.1091 17.4243 16.1091 0 0 0 17.4243 0 A0A2C9WMI0 Zeta_toxin domain-containing protein MANES_01G200600 A0A2C9WMI0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];ATP binding [GO:0005524];kinase activity [GO:0016301] ATP binding [GO:0005524];kinase activity [GO:0016301] RAIMCRR 0.97569 0 17.43 0 0 0 17.43 0 0 A0A2C9UHY7 AAA domain-containing protein MANES_14G018100 A0A2C9UHY7_MANES Manihot esculenta (Cassava) (Jatropha manihot) proteolysis [GO:0006508] chloroplast thylakoid [GO:0009534];membrane [GO:0016020] chloroplast thylakoid [GO:0009534];membrane [GO:0016020];ATP binding [GO:0005524];ATP hydrolysis activity [GO:0016887];ATP-dependent peptidase activity [GO:0004176];metalloendopeptidase activity [GO:0004222];proteolysis [GO:0006508] ATP binding [GO:0005524];ATP-dependent peptidase activity [GO:0004176];ATP hydrolysis activity [GO:0016887];metalloendopeptidase activity [GO:0004222] VNEFGSGDDTAVSGLEGSRIDELGGESLGTESGEMHSK 0.9878 0 17.43 0 0 0 17.43 0 0 A0A2C9UMD3 Uncharacterized protein MANES_14G126700 A0A2C9UMD3_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast organization [GO:0009658] chloroplast organization [GO:0009658] DVSIRPR 0.96507 0 17.4435 0 0 0 0 17.4435 0 A0A2C9W6B2 Exonuclease domain-containing protein (Fragment) MANES_03G104800 A0A2C9W6B2_MANES Manihot esculenta (Cassava) (Jatropha manihot) "exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000467];post-transcriptional gene silencing by RNA [GO:0035194];regulation of production of siRNA involved in RNA interference [GO:0090065]" "3'-5'-exoribonuclease activity [GO:0000175];endoribonuclease activity, producing 5'-phosphomonoesters [GO:0016891];nucleic acid binding [GO:0003676];exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000467];post-transcriptional gene silencing by RNA [GO:0035194];regulation of production of siRNA involved in RNA interference [GO:0090065]" "3'-5'-exoribonuclease activity [GO:0000175];endoribonuclease activity, producing 5'-phosphomonoesters [GO:0016891];nucleic acid binding [GO:0003676]" AAFVTCGNWDVK 0.95586 0 17.4695 0 0 0 0 17.4695 16.5015 A0A2C9U9X0 Uncharacterized protein MANES_16G090300 A0A2C9U9X0_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021];lipase activity [GO:0016298] lipase activity [GO:0016298] DLKYCNSNFYNWLDDR 0.95821 15.9439 17.4741 14.8473 0 15.9439 17.4741 17.1161 15.6825 A0A2C9W3A9 Uncharacterized protein MANES_03G003300 A0A2C9W3A9_MANES Manihot esculenta (Cassava) (Jatropha manihot) nuclear membrane organization [GO:0071763] nuclear envelope [GO:0005635] nuclear envelope [GO:0005635];nuclear membrane organization [GO:0071763] CTAITEAK 0.95042 0 17.4792 0 0 0 0 17.4792 0 A0A2C9VZN4 Protein kinase domain-containing protein MANES_04G045500 A0A2C9VZN4_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] ATP binding [GO:0005524];protein serine/threonine kinase activity [GO:0004674] GGTEGYMAPELFYK 0.96692 17.9467 17.5013 16.7782 17.0813 17.9467 0 17.5013 15.6892 A0A2C9VVU5 Histone acetyltransferase (EC 2.3.1.48) MANES_05G083800 A0A2C9VVU5_MANES Manihot esculenta (Cassava) (Jatropha manihot) chromatin organization [GO:0006325] nucleus [GO:0005634] nucleus [GO:0005634];histone acetyltransferase activity [GO:0004402];chromatin organization [GO:0006325] histone acetyltransferase activity [GO:0004402] SMHDHVDAWPFKDPVDAR 0.97179 0 17.508 0 0 0 16.4609 15.0501 17.508 A0A2C9WL88 DYW_deaminase domain-containing protein MANES_01G162400 A0A2C9WL88_MANES Manihot esculenta (Cassava) (Jatropha manihot) zinc ion binding [GO:0008270] zinc ion binding [GO:0008270] HMKVSGIK 0.97982 13.6793 17.528 13.6793 0 0 0 0 17.528 A0A2C9UVF2 zf-RVT domain-containing protein MANES_12G101300 A0A2C9UVF2_MANES Manihot esculenta (Cassava) (Jatropha manihot) EVLSQVFNDRDR 0.96698 0 17.5503 0 0 0 17.5503 15.8638 0 A0A2C9U2U3 Uncharacterized protein MANES_18G119600 A0A2C9U2U3_MANES Manihot esculenta (Cassava) (Jatropha manihot) oxidoreductase activity [GO:0016491] oxidoreductase activity [GO:0016491] EVQATGGPVEEYAK 0.96629 0 17.5654 0 0 0 17.5654 16.7074 0 A0A2C9UJ22 Uncharacterized protein MANES_14G053600 A0A2C9UJ22_MANES Manihot esculenta (Cassava) (Jatropha manihot) carbohydrate metabolic process [GO:0005975] "hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553];carbohydrate metabolic process [GO:0005975]" "hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]" DRLPIFTEHEK 0.95377 0 17.5975 0 0 0 0 0 17.5975 A0A2C9VRB4 Formin-like protein MANES_06G089100 A0A2C9VRB4_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphoprotein phosphatase activity [GO:0004721] phosphoprotein phosphatase activity [GO:0004721] PVVRVYGQDHSK 0.96633 0 17.6017 0 0 0 0 17.6017 0 A0A2C9VDW3 SUZ domain-containing protein MANES_08G062500 A0A2C9VDW3_MANES Manihot esculenta (Cassava) (Jatropha manihot) nucleic acid binding [GO:0003676] nucleic acid binding [GO:0003676] YICSRDYAPSR 0.95952 0 17.6316 0 0 0 17.6316 0 0 A0A2C9WNN0 60S acidic ribosomal protein P0 MANES_01G162900 A0A2C9WNN0_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasmic translation [GO:0002181];ribosomal large subunit assembly [GO:0000027] cytosolic large ribosomal subunit [GO:0022625] cytosolic large ribosomal subunit [GO:0022625];large ribosomal subunit rRNA binding [GO:0070180];structural constituent of ribosome [GO:0003735];cytoplasmic translation [GO:0002181];ribosomal large subunit assembly [GO:0000027] large ribosomal subunit rRNA binding [GO:0070180];structural constituent of ribosome [GO:0003735] LTKAQKK 0.96771 0 17.6628 0 0 0 0 17.6628 0 A0A199UBG6 Usp domain-containing protein MANES_S039200 A0A199UBG6_MANES Manihot esculenta (Cassava) (Jatropha manihot) MSSPSPR 0.96884 19.1661 17.6658 15.5814 19.1661 18.0844 17.6658 0 0 A0A2C9UV10 AB hydrolase-1 domain-containing protein MANES_12G095700 A0A2C9UV10_MANES Manihot esculenta (Cassava) (Jatropha manihot) jasmonic acid metabolic process [GO:0009694];salicylic acid metabolic process [GO:0009696] methyl indole-3-acetate esterase activity [GO:0080030];methyl jasmonate esterase activity [GO:0080032];methyl salicylate esterase activity [GO:0080031];jasmonic acid metabolic process [GO:0009694];salicylic acid metabolic process [GO:0009696] methyl indole-3-acetate esterase activity [GO:0080030];methyl jasmonate esterase activity [GO:0080032];methyl salicylate esterase activity [GO:0080031] QLTDLHSFSDYYEPLMEFMKSLPPEER 0.9559 0 17.7039 0 0 0 0 0 17.7039 A0A2C9V5Q3 TIR domain-containing protein (Fragment) MANES_10G125200 A0A2C9V5Q3_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953];defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953] IMDKFDGHYFVDNVREK 0.97421 0 17.7309 0 0 0 0 17.7309 0 A0A2C9U1K7 Uncharacterized protein MANES_18G051200 A0A2C9U1K7_MANES Manihot esculenta (Cassava) (Jatropha manihot) SPTCFMKIINPQFGETDK 0.97071 16.1222 17.7309 0 0 16.1222 0 17.7309 0 A0A2C9W7A8 DUF4408 domain-containing protein MANES_03G067600 A0A2C9W7A8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] GQGKIPSR 0.9635 0 17.7949 0 0 0 17.7949 0 0 A0A2C9VPL9 Uncharacterized protein MANES_06G104900 A0A2C9VPL9_MANES Manihot esculenta (Cassava) (Jatropha manihot) LQHNPHGSR 0.96185 0 17.8845 0 0 0 16.7431 17.0769 17.8845 A0A2C9U1A2 Uncharacterized protein MANES_18G076700 A0A2C9U1A2_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA repair [GO:0006281];mitotic sister chromatid cohesion [GO:0007064] chromatin [GO:0000785];nucleus [GO:0005634] chromatin [GO:0000785];nucleus [GO:0005634];DNA repair [GO:0006281];mitotic sister chromatid cohesion [GO:0007064] ESSELLSAVGGRFLDFDDR 0.98371 17.2137 17.9206 17.1368 0 17.2137 17.9206 17.7309 17.415 A0A2C9U6G1 Uncharacterized protein MANES_17G042100 A0A2C9U6G1_MANES Manihot esculenta (Cassava) (Jatropha manihot) LEKEEEIR 0.96553 15.1424 17.9462 14.7345 15.1424 0 17.6519 17.9462 17.4434 A0A2C9VKF7 F-box domain-containing protein MANES_07G056700 A0A2C9VKF7_MANES Manihot esculenta (Cassava) (Jatropha manihot) EELSSSSLQDSLR 0 0 17.9884 0 0 0 17.9884 17.3551 17.5281 A0A2C9WII3 Protein kinase domain-containing protein MANES_01G068100 A0A2C9WII3_MANES Manihot esculenta (Cassava) (Jatropha manihot) intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] cytoplasm [GO:0005737];nucleus [GO:0005634] cytoplasm [GO:0005737];nucleus [GO:0005634];ATP binding [GO:0005524];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683];intracellular signal transduction [GO:0035556];peptidyl-serine phosphorylation [GO:0018105];protein autophosphorylation [GO:0046777] ATP binding [GO:0005524];calcium-dependent protein serine/threonine kinase activity [GO:0009931];calmodulin binding [GO:0005516];calmodulin-dependent protein kinase activity [GO:0004683] MDIPNIHDINHPSFPSCK 0.95898 0 18.0327 0 0 0 18.0327 15.5695 0 A0A2C9UNG0 GST C-terminal domain-containing protein MANES_13G040400 A0A2C9UNG0_MANES Manihot esculenta (Cassava) (Jatropha manihot) glutathione metabolic process [GO:0006749] cytoplasm [GO:0005737] cytoplasm [GO:0005737];glutathione transferase activity [GO:0004364];glutathione metabolic process [GO:0006749] glutathione transferase activity [GO:0004364] VVEYPNLHGYMR 0.95574 0 18.0377 0 0 0 16.5601 17.6246 18.0377 A0A2C9W6Z0 RRM domain-containing protein MANES_03G129400 A0A2C9W6Z0_MANES Manihot esculenta (Cassava) (Jatropha manihot) "mRNA splicing, via spliceosome [GO:0000398]" U12-type spliceosomal complex [GO:0005689] "U12-type spliceosomal complex [GO:0005689];mRNA binding [GO:0003729];snRNA binding [GO:0017069];mRNA splicing, via spliceosome [GO:0000398]" mRNA binding [GO:0003729];snRNA binding [GO:0017069] IILVEKSK 0.9679 15.8949 18.0654 15.8949 15.6355 0 0 18.0654 0 A0A2C9U8H8 Uncharacterized protein MANES_17G124200 A0A2C9U8H8_MANES Manihot esculenta (Cassava) (Jatropha manihot) LDRACASPR 0.97756 14.7345 18.0986 14.7345 0 0 18.0944 18.0986 17.4082 A0A2C9W047 Uncharacterized protein MANES_04G019400 A0A2C9W047_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] NAGSFVLPVDPNDKETWGDSEHR 0.96352 17.4165 18.1657 0 17.4165 0 14.9557 18.0173 18.1657 A0A251L699 Uncharacterized protein MANES_03G024900 A0A251L699_MANES Manihot esculenta (Cassava) (Jatropha manihot) signal transduction [GO:0007165] nucleus [GO:0005634] nucleus [GO:0005634];signal transduction [GO:0007165] SVHASFN 0.96801 18.1661 18.1694 17.8994 18.1661 0 17.6658 0 18.1694 A0A2C9US49 RING-type domain-containing protein MANES_13G152000 A0A2C9US49_MANES Manihot esculenta (Cassava) (Jatropha manihot) ubiquitin-dependent protein catabolic process [GO:0006511] ubiquitin protein ligase activity [GO:0061630];ubiquitin-dependent protein catabolic process [GO:0006511] ubiquitin protein ligase activity [GO:0061630] EMVMVTPCNHMFHEECIVPWVKSHGQCPVCR 1.0078 0 18.171 0 0 0 0 0 18.171 A0A2C9UDK0 Uncharacterized protein MANES_15G066500 A0A2C9UDK0_MANES Manihot esculenta (Cassava) (Jatropha manihot) endocytosis [GO:0006897];endosomal transport [GO:0016197] cytoplasm [GO:0005737];intracellular membrane-bounded organelle [GO:0043231];plasma membrane [GO:0005886] cytoplasm [GO:0005737];intracellular membrane-bounded organelle [GO:0043231];plasma membrane [GO:0005886];calcium ion binding [GO:0005509];GTP binding [GO:0005525];endocytosis [GO:0006897];endosomal transport [GO:0016197] calcium ion binding [GO:0005509];GTP binding [GO:0005525] MEISTGPICSCSKENQKIYLEWFNFADSDGDGR 1.0478 0 18.171 0 0 0 0 0 18.171 A0A2C9V950 Uncharacterized protein MANES_09G081400 A0A2C9V950_MANES Manihot esculenta (Cassava) (Jatropha manihot) SSIGAPDDDSRSIVSMQSDR 0.98061 15.5498 18.1754 0 0 15.5498 16.6867 15.6678 18.1754 A0A2C9VPF2 Uncharacterized protein MANES_06G092600 A0A2C9VPF2_MANES Manihot esculenta (Cassava) (Jatropha manihot) response to auxin [GO:0009733] response to auxin [GO:0009733] LLENWMK 0.96722 20.4566 18.2665 20.4566 19.3849 20.0324 0 18.1054 18.2665 A0A2C9UUP0 GTD-binding domain-containing protein MANES_12G045100 A0A2C9UUP0_MANES Manihot esculenta (Cassava) (Jatropha manihot) myosin XI tail binding [GO:0080115] myosin XI tail binding [GO:0080115] LFVDWPIR 0.97607 16.7829 18.3107 0 16.7829 0 17.009 17.4326 18.3107 A0A2C9U6D2 IPPc domain-containing protein MANES_17G089300 A0A2C9U6D2_MANES Manihot esculenta (Cassava) (Jatropha manihot) phosphatidylinositol dephosphorylation [GO:0046856] phosphatase activity [GO:0016791];phosphatidylinositol dephosphorylation [GO:0046856] phosphatase activity [GO:0016791] ILDHDHVILFGDLNYRISLPEETTR 0.99658 0 18.3262 0 0 0 17.2448 17.8148 18.3262 A0A2C9UIQ0 CS domain-containing protein MANES_14G006200 A0A2C9UIQ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein folding [GO:0006457] cytoplasm [GO:0005737] cytoplasm [GO:0005737];unfolded protein binding [GO:0051082];protein folding [GO:0006457] unfolded protein binding [GO:0051082] LSDLDPETR 0.99489 0 18.3864 0 0 0 18.3864 18.0947 17.7285 A0A2C9UQ40 RING-type E3 ubiquitin transferase (EC 2.3.2.27) MANES_13G084400 A0A2C9UQ40_MANES Manihot esculenta (Cassava) (Jatropha manihot) AFDNFQFVNFTK 0.95582 0 18.395 0 0 0 0 18.395 0 Q52QX9 Aldo/keto reductase AKR MANES_05G194600 Q52QX9_MANES Manihot esculenta (Cassava) (Jatropha manihot) cytoplasm [GO:0005737] cytoplasm [GO:0005737];aldo-keto reductase (NADP) activity [GO:0004033];D-threo-aldose 1-dehydrogenase activity [GO:0047834] aldo-keto reductase (NADP) activity [GO:0004033];D-threo-aldose 1-dehydrogenase activity [GO:0047834] AACEASLK 0.96949 0 18.5798 0 0 0 0 18.5798 0 A0A2C9VIU8 Uncharacterized protein MANES_07G057500 A0A2C9VIU8_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] PCSLAFGVDQLDK 1.0138 18.0901 18.6034 18.0901 0 17.9771 18.178 0 18.6034 A0A2C9VIJ0 Uncharacterized protein MANES_07G044900 A0A2C9VIJ0_MANES Manihot esculenta (Cassava) (Jatropha manihot) ATP binding [GO:0005524];protein kinase activity [GO:0004672];ubiquitin-protein transferase activity [GO:0004842] ATP binding [GO:0005524];protein kinase activity [GO:0004672];ubiquitin-protein transferase activity [GO:0004842] HQVTNEDPLYQSCR 0.96922 19.5036 18.6638 19.5036 18.1297 0 17.1858 17.8677 18.6638 A0A2C9WMD1 Catalase (EC 1.11.1.6) MANES_01G154400 A0A2C9WMD1_MANES Manihot esculenta (Cassava) (Jatropha manihot) hydrogen peroxide catabolic process [GO:0042744];response to hydrogen peroxide [GO:0042542] cytoplasm [GO:0005737];peroxisome [GO:0005777];plasma membrane [GO:0005886] cytoplasm [GO:0005737];peroxisome [GO:0005777];plasma membrane [GO:0005886];catalase activity [GO:0004096];heme binding [GO:0020037];metal ion binding [GO:0046872];hydrogen peroxide catabolic process [GO:0042744];response to hydrogen peroxide [GO:0042542] catalase activity [GO:0004096];heme binding [GO:0020037];metal ion binding [GO:0046872] SLLEDEAIR 1.0045 0 18.6753 0 0 0 18.5047 17.5056 18.6753 A0A251LSL4 "30S ribosomal protein S17, chloroplastic" MANES_01G180900 A0A251LSL4_MANES Manihot esculenta (Cassava) (Jatropha manihot) translation [GO:0006412] ribosome [GO:0005840] ribosome [GO:0005840];rRNA binding [GO:0019843];structural constituent of ribosome [GO:0003735];translation [GO:0006412] rRNA binding [GO:0019843];structural constituent of ribosome [GO:0003735] VRLDPSR 0.96398 16.1503 18.6907 0 0 16.1503 18.6907 18.1046 0 A0A2C9UUT6 Uncharacterized protein MANES_12G097200 A0A2C9UUT6_MANES Manihot esculenta (Cassava) (Jatropha manihot) photosystem II assembly [GO:0010207];photosystem II stabilization [GO:0042549] photosystem II oxygen evolving complex [GO:0009654] photosystem II oxygen evolving complex [GO:0009654];oxygen evolving activity [GO:0010242];photosystem II assembly [GO:0010207];photosystem II stabilization [GO:0042549] oxygen evolving activity [GO:0010242] GGSTGYDNAVALPAGGR 0.96735 17.5343 18.6912 15.1739 17.5343 0 18.1719 18.0671 18.6912 A0A2C9VLL0 Uncharacterized protein MANES_06G000900 A0A2C9VLL0_MANES Manihot esculenta (Cassava) (Jatropha manihot) RNA processing [GO:0006396] nucleus [GO:0005634] nucleus [GO:0005634];RNA processing [GO:0006396] LKSGGRYWSAK 0.96068 0 18.8084 0 0 0 18.8084 0 0 A0A251IS04 TIR domain-containing protein MANES_18G112200 A0A251IS04_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953];defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953] LLKCFRSSNK 0.96072 19.346 18.8084 19.346 0 0 18.8084 0 0 A0A2C9VZA8 Acyl-[acyl-carrier-protein] desaturase (EC 1.14.19.-) MANES_04G034900 A0A2C9VZA8_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];fatty acid biosynthetic process [GO:0006633];fatty acid metabolic process [GO:0006631] chloroplast [GO:0009507] chloroplast [GO:0009507];acyl-[acyl-carrier-protein] desaturase activity [GO:0045300];metal ion binding [GO:0046872];stearoyl-CoA 9-desaturase activity [GO:0004768];defense response [GO:0006952];fatty acid biosynthetic process [GO:0006633];fatty acid metabolic process [GO:0006631] acyl-[acyl-carrier-protein] desaturase activity [GO:0045300];metal ion binding [GO:0046872];stearoyl-CoA 9-desaturase activity [GO:0004768] KPFTPPR 0.96648 17.4165 18.9749 0 17.4165 0 18.6907 18.9749 0 A0A251LCG5 RING-type E3 ubiquitin transferase (EC 2.3.2.27) MANES_05G146700 A0A251LCG5_MANES Manihot esculenta (Cassava) (Jatropha manihot) ubiquitin-protein transferase activity [GO:0004842] ubiquitin-protein transferase activity [GO:0004842] LIQEVREHTK 0.95782 0 18.996 0 0 0 0 18.996 0 A0A2C9WJH4 Uncharacterized protein MANES_01G099600 A0A2C9WJH4_MANES Manihot esculenta (Cassava) (Jatropha manihot) SIHCFILR 0.97661 15.1424 19.0888 0 15.1424 0 18.3307 18.9407 19.0888 A0A251K3C9 HP domain-containing protein MANES_09G021000 A0A251K3C9_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin filament capping [GO:0051693];actin filament organization [GO:0007015] actin filament binding [GO:0051015];actin filament capping [GO:0051693];actin filament organization [GO:0007015] actin filament binding [GO:0051015] EDFLLYCWFGK 0.99678 13.6888 19.0937 0 0 13.6888 16.1662 19.0937 0 A0A2C9W4P9 Uncharacterized protein MANES_04G133200 A0A2C9W4P9_MANES Manihot esculenta (Cassava) (Jatropha manihot) ITDSPFPLR 1.0022 15.1424 19.2342 10.6618 15.1424 0 18.5069 18.4492 19.2342 A0A2C9WDW1 Uncharacterized protein MANES_02G094400 A0A2C9WDW1_MANES Manihot esculenta (Cassava) (Jatropha manihot) rRNA processing [GO:0006364];tRNA export from nucleus [GO:0006409] CURI complex [GO:0032545];small-subunit processome [GO:0032040];UTP-C complex [GO:0034456] CURI complex [GO:0032545];small-subunit processome [GO:0032040];UTP-C complex [GO:0034456];RNA binding [GO:0003723];rRNA processing [GO:0006364];tRNA export from nucleus [GO:0006409] RNA binding [GO:0003723] EIGSDIVKR 0.99911 15.769 19.2352 15.769 0 13.9564 19.2352 18.8402 19.0744 A0A2C9VND9 TTC5_OB domain-containing protein MANES_06G062500 A0A2C9VND9_MANES Manihot esculenta (Cassava) (Jatropha manihot) AYQNAEK 0.96654 11.2719 19.2635 0 11.2719 0 19.2635 12.5949 0 A0A251LKC5 PORR domain-containing protein MANES_02G208600 A0A251LKC5_MANES Manihot esculenta (Cassava) (Jatropha manihot) chloroplast [GO:0009507];spliceosomal complex [GO:0005681] chloroplast [GO:0009507];spliceosomal complex [GO:0005681];RNA binding [GO:0003723] RNA binding [GO:0003723] TLIDHLTHFR 0.96125 17.2659 19.2686 17.2659 0 0 18.8084 0 19.2686 A0A2C9UZM3 Uncharacterized protein MANES_11G045400 A0A2C9UZM3_MANES Manihot esculenta (Cassava) (Jatropha manihot) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] VVVVDQVI 0.96701 0 19.4631 0 0 0 0 19.4631 0 A0A2C9ULW0 TIR domain-containing protein MANES_14G148800 A0A2C9ULW0_MANES Manihot esculenta (Cassava) (Jatropha manihot) defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953];defense response [GO:0006952];signal transduction [GO:0007165] ADP binding [GO:0043531];NAD+ nucleosidase activity [GO:0003953] LPSSMNQLR 0.99637 16.2373 19.4873 16.2373 15.1424 14.8224 19.2086 19.4873 19.4833 A0A251K950 Uncharacterized protein MANES_08G009700 A0A251K950_MANES Manihot esculenta (Cassava) (Jatropha manihot) SHASAPPTTDVLNDYIAEGPR 0.95971 17.9922 19.6768 0 17.9922 0 0 19.6768 0 A0A2C9U619 Nucleoporin_N domain-containing protein MANES_17G083900 A0A2C9U619_MANES Manihot esculenta (Cassava) (Jatropha manihot) protein import into nucleus [GO:0006606];protein localization to nuclear inner membrane [GO:0036228];RNA export from nucleus [GO:0006405];transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery [GO:0000972] nuclear pore inner ring [GO:0044611] nuclear pore inner ring [GO:0044611];structural constituent of nuclear pore [GO:0017056];protein import into nucleus [GO:0006606];protein localization to nuclear inner membrane [GO:0036228];RNA export from nucleus [GO:0006405];transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery [GO:0000972] structural constituent of nuclear pore [GO:0017056] LFEANSPR 0.96966 0 19.7999 0 0 0 19.7999 0 0 A0A2C9VUD3 NAB domain-containing protein MANES_05G080300 A0A2C9VUD3_MANES Manihot esculenta (Cassava) (Jatropha manihot) actin binding [GO:0003779] actin binding [GO:0003779] LKEVCER 0.96871 16.7993 19.7999 0 16.7993 0 19.7999 0 0 A0A2C9UYY6 Uncharacterized protein MANES_11G064000 A0A2C9UYY6_MANES Manihot esculenta (Cassava) (Jatropha manihot) PEGEGTK 0.96794 17.2108 20.0085 0 17.2108 0 0 20.0085 0 A0A2C9VSP9 Uncharacterized protein MANES_06G155900 A0A2C9VSP9_MANES Manihot esculenta (Cassava) (Jatropha manihot) DNA replication [GO:0006260];mitotic DNA replication checkpoint signaling [GO:0033314];mitotic G2 DNA damage checkpoint signaling [GO:0007095];regulation of DNA-dependent DNA replication initiation [GO:0030174];response to ionizing radiation [GO:0010212] nucleus [GO:0005634] nucleus [GO:0005634];chromatin binding [GO:0003682];DNA replication [GO:0006260];mitotic DNA replication checkpoint signaling [GO:0033314];mitotic G2 DNA damage checkpoint signaling [GO:0007095];regulation of DNA-dependent DNA replication initiation [GO:0030174];response to ionizing radiation [GO:0010212] chromatin binding [GO:0003682] SDDPSGR 0.9671 16.487 20.1007 16.487 0 16.1503 20.1007 19.6277 17.9038 A0A2C9W8C8 NAB domain-containing protein MANES_03G174800 A0A2C9W8C8_MANES Manihot esculenta (Cassava) (Jatropha manihot) plasma membrane [GO:0005886] plasma membrane [GO:0005886];actin filament binding [GO:0051015] actin filament binding [GO:0051015] IEQMKER 0.96324 20.4566 20.5565 20.4566 18.2465 0 20.5565 0 18.2665 A0A2C9UST7 Uncharacterized protein MANES_13G132000 A0A2C9UST7_MANES Manihot esculenta (Cassava) (Jatropha manihot) cell surface receptor signaling pathway [GO:0007166] integral component of membrane [GO:0016021];plasma membrane [GO:0005886] integral component of membrane [GO:0016021];plasma membrane [GO:0005886];ATP binding [GO:0005524];protein kinase activity [GO:0004672];cell surface receptor signaling pathway [GO:0007166] ATP binding [GO:0005524];protein kinase activity [GO:0004672] GLPWTIR 0.96747 17.4165 20.7969 0 17.4165 0 19.9091 20.7969 16.8137