T: Majority protein IDs	Entry name	Protein names	Gene names	Organism	Gene ontology (biological process)	Gene ontology (cellular component)	Gene ontology (GO)	Gene ontology (molecular function)	T: Peptide sequences	N: Q-value	Intensity ABF group_1_RC4_01_24000	Intensity ABF group_1_RC4_01_24001	Intensity ABF group_1_RC4_01_24002	Intensity ABF group_10_RD5_01_24030	Intensity ABF group_10_RD5_01_24031	Intensity ABF group_10_RD5_01_24032	Intensity ABF group_11_RD6_01_24033	Intensity ABF group_11_RD6_01_24034	Intensity ABF group_11_RD6_01_24035	Intensity ABF group_12_RD7_01_24036	Intensity ABF group_12_RD7_01_24037	Intensity ABF group_12_RD7_01_24038	Intensity ABF group_13_RD8_01_24040	Intensity ABF group_13_RD8_01_24041	Intensity ABF group_13_RD8_01_24042	Intensity ABF group_14_RE1_01_24043	Intensity ABF group_14_RE1_01_24044	Intensity ABF group_14_RE1_01_24045	Intensity ABF group_15_RE2_01_24046	Intensity ABF group_15_RE2_01_24047	Intensity ABF group_15_RE2_01_24048	Intensity ABF group_16_RE3_01_24050	Intensity ABF group_16_RE3_01_24051	Intensity ABF group_16_RE3_01_24052	Intensity ABF group_17_RE4_01_24053	Intensity ABF group_17_RE4_01_24054	Intensity ABF group_17_RE4_01_24055	Intensity ABF group_18_RE5_01_24056	Intensity ABF group_18_RE5_01_24057	Intensity ABF group_18_RE5_01_24058	Intensity ABF group_2_RC5_01_24003	Intensity ABF group_2_RC5_01_24004	Intensity ABF group_2_RC5_01_24005	Intensity ABF group_3_RC6_01_24006	Intensity ABF group_3_RC6_01_24007	Intensity ABF group_3_RC6_01_24008	Intensity ABF group_4_RC7_01_24010	Intensity ABF group_4_RC7_01_24011	Intensity ABF group_4_RC7_01_24012	Intensity ABF group_5_RC8_01_24013	Intensity ABF group_5_RC8_01_24014	Intensity ABF group_5_RC8_01_24015	Intensity ABF group_6_RD1_01_24016	Intensity ABF group_6_RD1_01_24017	Intensity ABF group_6_RD1_01_24018	Intensity ABF group_7_RD2_01_24020	Intensity ABF group_7_RD2_01_24021	Intensity ABF group_7_RD2_01_24022	Intensity ABF group_8_RD3_01_24023	Intensity ABF group_8_RD3_01_24024	Intensity ABF group_8_RD3_01_24025	Intensity ABF group_9_RD4_01_24026	Intensity ABF group_9_RD4_01_24027	Intensity ABF group_9_RD4_01_24028	Intensity Normal group_1_BE6_01_23925	Intensity Normal group_1_BE6_01_23926	Intensity Normal group_1_BE6_01_23927	Intensity Normal group_10_RA7_01_23955	Intensity Normal group_10_RA7_01_23956	Intensity Normal group_10_RA7_01_23957	Intensity Normal group_11_RA8_01_23958	Intensity Normal group_11_RA8_01_23959	Intensity Normal group_11_RA8_01_23960	Intensity Normal group_12_RB1_01_23961	Intensity Normal group_12_RB1_01_23962	Intensity Normal group_12_RB1_01_23963	Intensity Normal group_13_RB2_01_23965	Intensity Normal group_13_RB2_01_23966	Intensity Normal group_13_RB2_01_23967	Intensity Normal group_14_RB3_01_23968	Intensity Normal group_14_RB3_01_23969	Intensity Normal group_14_RB3_01_23970	Intensity Normal group_15_RB4_01_23971	Intensity Normal group_15_RB4_01_23972	Intensity Normal group_15_RB4_01_23973	Intensity Normal group_16_RB5_01_23975	Intensity Normal group_16_RB5_01_23976	Intensity Normal group_16_RB5_01_23977	Intensity Normal group_17_RB6_01_23978	Intensity Normal group_17_RB6_01_23979	Intensity Normal group_17_RB6_01_23980	Intensity Normal group_18_RB7_01_23981	Intensity Normal group_18_RB7_01_23982	Intensity Normal group_18_RB7_01_23983	Intensity Normal group_19_RB8_01_23985	Intensity Normal group_19_RB8_01_23986	Intensity Normal group_19_RB8_01_23987	Intensity Normal group_2_BE7_01_23928	Intensity Normal group_2_BE7_01_23929	Intensity Normal group_2_BE7_01_23930	Intensity Normal group_20_RC1_01_23988	Intensity Normal group_20_RC1_01_23989	Intensity Normal group_20_RC1_01_23990	Intensity Normal group_3_BE8_01_23931	Intensity Normal group_3_BE8_01_23932	Intensity Normal group_3_BE8_01_23933	Intensity Normal group_4_RA1_01_23935	Intensity Normal group_4_RA1_01_23936	Intensity Normal group_4_RA1_01_23937	Intensity Normal group_5_RA2_01_23938	Intensity Normal group_5_RA2_01_23939	Intensity Normal group_5_RA2_01_23940	Intensity Normal group_6_RA3_01_23941	Intensity Normal group_6_RA3_01_23942	Intensity Normal group_6_RA3_01_23943	Intensity Normal group_7_RA4_01_23945	Intensity Normal group_7_RA4_01_23946	Intensity Normal group_7_RA4_01_23947	Intensity Normal group_8_RA5_01_23948	Intensity Normal group_8_RA5_01_23949	Intensity Normal group_8_RA5_01_23950	Intensity Normal group_9_RA6_01_23951	Intensity Normal group_9_RA6_01_23952	Intensity Normal group_9_RA6_01_23953
A0A412AV07	A0A412AV07_9FIRM	Uncharacterized protein	DWY99_12280	[Clostridium] leptum		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		KLFPFTIILILVYFVPPIFILVQQEEEIIER	0	9.47344	10.0699	8.86715	10.4453	10.5201	10.8062	10.3379	10.7182	11.4267	10.1666	11.2669	9.73989	9.50305	10.2553	9.19642	11.2942	9.56592	10.5868	10.1044	10.608	10.5638	10.5366	10.7676	10.6412	10.5206	11.7264	10.3536	10.4224	10.758	10.796	9.37729	9.62523	9.18013	9.35581	9.31557	9.33399	8.91365	9.28041	10.0257	9.35464	9.26645	9.61167	9.74872	8.92565	9.17774	10.4635	10.5982	11.6909	11.2998	11.3577	10.6204	10.0024	10.9094	9.99197	11.5142	9.93804	10.198	12.0361	11.3909	10.9808	13.1565	11.4393	11.387	10.6817	10.2274	10.139	9.94222	10.8399	10.9171	9.85546	10.4836	10.5642	9.01269	10.7564	10.1142	10.3195	11.1144	10.1677	10.0736	8.92304	10.6897	9.82205	10.176	10.514	10.3466	10.0627	10.4157	10.0923	9.75854	10.3614	10.1679	9.47876	10.3362	10.6465	11.3089	10.2561	10.1892	10.0993	10.3749	10.2935	10.3197	10.4284	10.6863	11.3171	9.95682	11.483	10.5549	11.6701	12.3092	12.6231	11.653	10.4087	11.3625	11.7167
A0A412B0E1	A0A412B0E1_9FIRM	AraC family transcriptional regulator	DWY99_02375	[Clostridium] leptum			DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	CENLDDTEQFLLEFQRDLK	0	9.55491	8.93966	9.67597	10.2042	11.7508	10.584	9.99868	10.6881	11.4679	10.5501	10.812	11.8266	10.0968	10.7024	11.1081	10.8794	10.5276	10.1558	10.2563	11.5641	9.40363	12.2316	10.7203	10.6155	10.1174	10.6469	10.373	10.8464	11.4693	11.0824	10.4481	9.31619	9.5899	8.95859	9.37803	9.42592	8.81707	8.94038	10.7748	9.95262	9.58611	10.9201	9.15446	8.93564	9.4787	9.80556	10.3614	9.88888	10.6258	11.0879	10.3611	11.4047	10.6535	9.94974	14.0203	13.2114	10.0329	11.3364	11.1471	10.8685	11.515	11.9151	10.5761	9.07064	10.0565	9.99389	10.2469	10.8682	10.5247	9.52515	10.1493	11.0125	10.1984	9.66659	9.65615	8.68509	10.6279	10.092	10.5402	9.24022	9.99195	9.41401	10.6777	10.8758	9.12654	9.78332	9.99982	10.302	10.6231	11.481	10.2353	10.1753	10.7792	10.2893	9.70726	9.79331	10.6932	10.9021	9.60104	10.5158	10.0228	11.1876	9.8551	11.0527	11.6187	11.1588	10.5139	10.7399	11.3289	10.2168	11.4655	11.8774	12.1974	11.3885
A0A412B176	A0A412B176_9FIRM	Uncharacterized protein	DWY99_00125	[Clostridium] leptum					RHALQYADVLTHDIELLDI	0	9.47893	10.293	8.86453	9.95712	10.7703	10.9402	10.8039	10.5566	10.1837	11.0106	11.7319	10.5352	9.92251	11.3625	9.23596	9.9154	10.5061	10.2825	9.42264	9.84492	9.95337	9.97344	10.5749	11.0357	9.1704	10.1957	9.66928	10.7639	10.6493	10.2671	9.40233	10.1622	9.46568	9.85428	8.18072	10.1818	9.784	8.50336	10.0766	9.9747	8.53607	10.0645	8.91565	10.1698	10.0704	10.7029	9.92507	10.3703	10.6963	10.4091	10.992	10.4027	10.5361	10.2507	14.5243	10.8246	11.7195	10.396	10.2049	10.4172	11.6632	15.2351	11.8645	10.2866	10.977	10.07	10.3828	11.0178	10.5771	9.91364	10.377	10.5372	9.36609	9.19771	10.7627	9.67358	9.55792	9.66393	9.78686	11.0116	10.2265	9.84105	10.4594	9.27277	10.0534	10.2338	10.4832	10.8505	10.6719	9.8561	10.1298	9.88982	10.4407	9.99211	10.1966	10.9079	10.3974	10.0533	10.761	11.1804	11.4649	10.104	11.2799	9.99846	10.7267	10.745	10.8328	10.7364	12.0388	12.13	10.8751	11.9973	11.9735	11.6264
A7VQT8	A7VQT8_9FIRM	HTH luxR-type domain-containing protein	CH238_06520 CLOLEP_00920	[Clostridium] leptum DSM 753	"regulation of transcription, DNA-templated [GO:0006355]"		"DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	AKRIYFLLK	0	9.09042	9.09122	8.98339	11.1144	11.0263	9.9884	10.879	10.6583	11.6679	10.4951	10.3305	10.7162	9.88278	9.57736	10.9264	9.84827	10.6851	9.87793	10.392	9.90221	9.75711	9.57385	10.6144	10.0018	10.6931	10.7951	10.6368	11.3011	9.54713	11.0104	9.17112	10.1009	9.62092	9.81666	9.45051	9.67851	8.77309	9.40837	11.6392	10.0177	9.60443	9.34802	10.1532	8.32961	10.8226	10.7097	10.3927	10.1386	10.6569	10.3559	10.5078	11.1025	10.1422	10.2759	11.2188	10.1647	11.1455	9.67389	11.3684	11.2643	10.6993	12.4373	10.4855	11.5383	10.4561	10.782	10.9208	14.6331	9.46853	9.67518	10.7904	10.0757	9.46287	10.5507	9.47133	10.1543	10.308	10.7414	9.52738	9.71201	10.389	9.28808	9.90223	9.18487	9.45601	10.3205	11.1188	10.8954	10.0215	10.9548	9.70675	9.28897	9.48609	9.54492	9.58661	10.1835	10.4574	10.3703	10.3843	10.658	10.4952	10.8809	11.2893	11.155	10.4072	10.6215	11.6312	10.6534	11.6552	10.3066	11.4475	11.7108	11.125	11.0539
A7VTE2	A7VTE2_9FIRM	Uncharacterized protein	CLOLEP_01834	[Clostridium] leptum DSM 753		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		CIRVDINEAK	0	9.07027	9.67516	8.23035	10.7112	11.7838	10.806	10.9501	11.3106	11.1033	11.2025	10.3693	11.0256	10.5938	12.5743	14.7551	10.8494	9.70589	10.4031	9.69539	11.4906	10.2825	10.2802	10.7679	9.84329	10.4735	10.67	9.97084	10.4879	9.9935	10.836	9.50505	10.2933	9.80636	9.09289	9.05451	10.5363	9.54193	9.68424	10.1005	8.66095	10.394	10.6298	10.4055	10.5256	10.7037	12.7951	9.82103	10.1253	9.28509	9.88939	10.8087	10.3718	10.924	10.5062	10.244	11.2892	11.4535	10.6907	9.89387	10.643	10.9293	12.2573	10.1659	10.9703	10.8272	10.7402	11.1413	11.5416	10.8066	10.5566	10.4944	9.39827	10.7827	9.6742	10.1579	9.25785	10.1802	9.87582	10.5347	9.63225	10.5694	10.1102	8.96506	10.5575	10.1954	9.61486	10.3923	10.0825	9.95241	9.83866	10.2457	8.87024	10.1011	10.0976	9.81598	9.14512	9.25858	9.98258	10.1644	10.3019	11.1332	10.3481	11.5318	10.5576	11.4589	11.802	11.3992	10.8615	11.7537	12.3778	11.6867	10.8347	12.3682	11.1645
R6P086	R6P086_9CLOT	Quinolinate synthase (EC 2.5.1.72)	BN578_01374	Clostridium leptum CAG:27	NAD biosynthetic process [GO:0009435]		"4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]; quinolinate synthetase A activity [GO:0008987]; NAD biosynthetic process [GO:0009435]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]; quinolinate synthetase A activity [GO:0008987]"	ALLCGVR	0	9.31444	10.1446	8.52285	10.8623	10.6654	9.69413	9.71637	11.2151	11.487	10.4677	10.1073	10.7133	9.30123	10.2746	10.8298	10.0288	10.5414	10.8117	11.2234	11.296	9.77122	10.152	10.4937	9.42629	10.9591	11.2796	10.5973	10.3217	10.7038	10.4095	10.362	9.5946	8.89875	10.1256	8.88956	8.94639	8.72073	10.7218	9.47812	8.53158	9.03831	10.108	9.42133	9.10535	9.17676	10.7989	10.3781	10.8446	10.2352	10.5466	11.0761	11.0371	10.8964	10.3969	10.4338	10.8696	11.2926	11.0688	10.3188	11.3088	10.2071	11.6048	11.4801	9.71799	10.4596	10.3701	9.9558	10.4987	9.77087	9.57785	9.06073	10.2109	9.25237	10.0616	10.4174	9.94359	10.4584	10.8519	9.21903	9.20716	10.123	8.71886	10.6473	9.60665	10.0714	9.71675	10.5979	10.1813	9.99809	9.73738	10.0436	9.93817	10.2819	10.1488	10.6378	10.8815	11.0173	9.83118	10.4061	11.4166	9.94343	9.72755	11.1138	10.9652	10.3826	10.2972	10.9305	11.3816	11.7871	11.3662	11.299	12.6872	11.9701	12.0164
R6MYJ9	R6MYJ9_9CLOT	Cof-like hydrolase	BN578_00368	Clostridium leptum CAG:27			hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	NALLAAMAQGVLVVPATGR	0	8.68105	9.19788	8.67312	10.1864	10.3844	10.9305	11.053	11.1284	10.5368	10.336	9.9103	10.1461	10.8184	9.7915	9.6886	9.48755	9.51058	10.4353	12.0694	10.974	10.1906	10.5746	9.86497	10.8778	10.8301	10.2763	10.5689	9.54022	10.6288	11.1338	10.3414	10.396	8.79161	8.86135	8.71773	9.48678	9.54663	9.11772	13.3486	10.0584	9.97167	9.39445	9.88475	9.62737	10.0415	11.2495	9.66559	11.3052	11.6496	10.0135	9.59157	10.5681	9.86596	11.1016	10.0933	10.939	10.3442	10.7102	11.5034	11.5854	11.5481	11.2685	10.5239	10.3746	10.5527	11.8338	9.95424	10.4145	11.2648	10.872	10.4293	10.1607	10.8211	10.8627	10.6372	10.1322	10.5958	10.2076	8.59542	10.6061	9.33114	9.89888	9.61224	9.92005	9.90901	11.3425	10.8741	10.2054	10.5468	10.3753	9.41104	10.0989	9.5166	9.63318	10.914	10.2056	10.6605	9.66499	10.2209	10.5996	10.648	11.713	11.2629	11.0219	11.2137	10.4847	11.5363	10.8631	11.5761	10.8352	11.5654	12.3345	12.2102	11.5239
R6N8B3	R6N8B3_9CLOT	FtsK/SpoIIIE family protein	BN578_00124	Clostridium leptum CAG:27					IKDNHSIVRR	0	9.25441	8.2897	8.61822	9.76195	10.2008	9.75828	10.7373	11.2163	11.3772	10.1729	10.3224	10.8953	9.32846	10.8377	10.2851	9.57382	10.0652	10.0628	10.0077	9.86511	10.7037	9.89809	9.61398	9.86315	9.64127	10.7434	9.77525	10.2451	11.2839	10.0905	9.54387	9.58234	10.0049	9.773	9.13295	9.88149	10.4324	8.55909	9.98806	9.69225	9.70143	8.69833	9.69718	9.92263	9.26385	9.59763	16.3463	12.2718	9.7477	10.3566	10.9346	10.8191	10.5892	11.3401	11.135	10.3156	11.1309	10.5416	10.9667	11.6258	11.1509	11.1926	11.1952	10.8877	9.81022	10.0673	11.0819	10.0385	10.0361	9.71072	10.6003	10.5169	9.58528	10.1233	10.1817	10.5637	11.2756	10.1417	9.88686	9.38197	10.2042	11.5021	10.2162	10.0168	10.2787	9.42372	10.146	10.288	10.5196	9.96954	9.2725	9.24754	10.4578	9.86763	10.6413	10.0413	10.2137	9.90699	10.7212	9.55025	10.3668	10.9638	10.7918	10.2414	11.1671	10.9053	11.0986	10.6992	12.214	10.6836	11.6012	11.7411	11.5605	10.7776
R6N8T1	R6N8T1_9CLOT	Uncharacterized protein	BN578_00304	Clostridium leptum CAG:27					LLMYLECINENLNTLILNQEMTYFIMQEILK	0	8.51608	9.82017	8.94972	12.6336	10.407	11.1885	11.237	10.9512	11.4576	10.9079	9.17604	10.0782	9.91919	10.7966	11.2671	10.6554	9.71115	10.1495	10.2323	10.6094	9.84761	10.68	10.0555	10.2994	10.4102	10.7774	10.8807	11.5759	11.3864	11.3845	8.41921	9.81826	9.69016	10.2715	9.72969	8.65607	9.77877	10.0879	10.0621	10.4542	9.41761	9.52766	9.73386	8.18132	9.46753	10.3842	10.6437	13.5302	10.1046	10.134	10.7609	10.1514	9.80999	10.3115	11.4902	11.3042	10.6169	10.6126	11.6137	10.8583	11.8046	10.6757	10.9886	10.7641	10.0684	10.5182	10.3897	10.9114	10.9035	10.7253	10.3911	10.3285	10.3361	10.1117	9.38787	10.9515	10.2562	9.24244	9.45494	10.1597	11.088	9.6005	10.0385	9.40726	8.8045	10.3836	9.87509	9.70841	10.5936	10.2311	10.2852	10.1453	10.1233	10.1203	10.0299	9.91795	10.7353	10.1344	10.1048	12.0263	10.4125	10.7116	9.85633	10.5497	10.6275	11.4189	11.4041	11.2732	11.6573	11.2218	11.3437	10.3235	10.7157	11.4726
R6NB55	R6NB55_9CLOT	ABC transporter ATP-binding protein	BN578_01463	Clostridium leptum CAG:27			ATP binding [GO:0005524]	ATP binding [GO:0005524]	DSRLNISYVSQDTSR	0	8.86636	9.17763	8.70132	9.67289	10.3104	10.9372	10.4152	10.4664	10.7968	12.3254	11.3291	14.8244	9.77816	10.2946	11.1087	10.3384	10.3374	10.2529	9.64009	10.5423	9.65747	9.79823	11.0735	10.7132	10.717	10.8713	10.5822	10.7391	10.4686	10.7798	8.986	10.0249	9.8635	8.95474	9.25461	9.91289	9.94266	9.79063	9.18624	8.93261	8.81674	9.28366	10.2179	10.5185	11.576	12.0266	9.93059	10.7952	10.4876	11.1353	10.6578	9.19022	9.5773	11.0021	10.7785	10.4566	10.6635	11.3202	11.4745	10.7771	11.2178	11.2081	11.3693	10.704	11.008	11.4411	9.98435	11.1331	11.5162	10.6042	8.90623	10.8672	10.2774	10.3406	9.64825	9.36914	9.10818	10.1579	9.70731	8.22045	10.9871	10.6213	9.77715	10.0097	9.77444	9.15607	10.2138	11.6125	10.7265	9.4748	9.60737	8.97537	10.1118	10.8575	9.70901	10.1428	11.5285	9.82699	10.5254	10.8681	9.79334	10.944	9.96715	10.885	10.7536	11.8998	11.9544	10.927	9.94232	11.5305	11.4207	11.4903	11.037	11.3527
A0A412AYW0	A0A412AYW0_9FIRM	Uncharacterized protein	DWY99_03705	[Clostridium] leptum		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GLEDFLARYADMVKLEDDR	0.18182	9.25067	9.70645	8.68051	10.5515	14.7128	11.3224	11.2783	10.4223	10.149	9.85271	10.4591	10.4786	10.1132	10.4777	10.5824	10.1048	10.298	9.38695	9.88188	11.8584	10.2643	9.42764	9.85412	10.523	10.24	10.3092	10.5139	10.6782	10.1786	10.9283	9.88231	10.1947	9.04187	9.88558	9.85174	10.0868	9.11634	9.96375	9.08901	9.60796	10.2513	9.52432	10.4294	10.2416	9.75571	9.47784	11.1988	10.4695	10.652	11.0163	10.3573	11.2643	11.4011	9.80585	9.86069	10.3431	11.5233	10.2273	10.7499	11.9953	11.1402	10.8133	11.1006	11.5188	10.3032	11.0227	10.2851	12.0283	10.1178	10.3809	9.45314	10.2308	11.0584	10.9865	10.3835	11.4116	8.96372	10.5235	10.6599	8.83881	10.5991	10.0994	10.2771	10.7801	9.7483	9.71367	10.5768	10.5859	10.5852	10.8124	9.42482	11.1346	9.42684	9.20874	10.6756	9.38799	10.1832	10.3929	10.6482	9.90062	11.5642	9.79847	10.2545	11.3921	10.2719	11.2115	11.7849	10.198	10.1035	11.4101	11.4115	10.6185	12.8929	11.6198
A7VP69	A7VP69_9FIRM	Uncharacterized protein	CLOLEP_00345	[Clostridium] leptum DSM 753		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MAKGCDCESFIGLASFPLK	0.5	9.77962	9.01227	9.0232	10.3987	11.9949	9.91675	10.3618	10.3485	10.7443	10.3534	10.2689	10.435	9.56277	9.74078	10.725	10.9145	11.227	10.1592	10.9167	10.9259	10.9455	9.28726	10.4282	9.25405	14.0373	16.6976	15.9258	10.4745	10.2412	11.0803	9.86505	9.00781	9.40841	9.28019	9.1483	9.60859	9.40452	9.31338	11.3151	9.21435	9.76674	10.1532	9.35488	10.5457	8.45591	9.45338	10.335	11.4455	10.3001	10.0043	10.9641	10.3147	11.1844	11.5946	10.8315	13.1917	10.7985	9.56446	10.1531	10.5268	16.9268	11.7029	10.6599	10.4709	14.1388	13.7194	11.4471	10.1401	11.1591	10.3403	11.0195	10.7161	9.48274	10.6407	8.53101	10.3553	9.63744	9.23521	9.62929	9.88486	9.69753	8.98214	9.80186	10.8344	10.9003	9.3423	11.1685	10.6764	10.6086	9.40254	9.56977	9.97475	9.82681	10.4204	10.4443	9.03999	10.2888	10.1314	10.0071	11.2611	10.9636	10.8129	11.0555	9.92646	13.3369	10.8961	11.4938	11.8133	12.0166	10.2205	11.6717	11.5103	12.0818	11.5254
R6P8G7	R6P8G7_9CLOT	TfoX N-terminal domain protein	BN578_01328	Clostridium leptum CAG:27					ELPEPKPR	0.53846	9.5079	10.1458	8.8892	10.865	10.8075	11.1151	10.0152	10.9726	10.1231	11.3091	9.48622	10.2984	10.4697	11.2074	10.2218	10.407	9.55091	9.90171	10.8347	9.97676	10.7528	9.57543	10.2777	8.89611	10.3922	9.27347	9.92258	11.3686	11.0738	9.69726	10.3157	8.5183	9.88501	9.36122	9.59224	9.70889	10.7289	9.04248	9.1856	9.29147	9.3575	9.99996	9.94122	9.90794	9.03265	11.3907	10.4334	10.4339	9.35827	10.9673	11.3715	10.8646	10.6509	11.3311	10.8589	12.108	10.4091	10.529	10.8603	9.67747	12.0407	13.9427	11.0998	10.9994	10.4658	9.52336	10.096	9.62471	10.5985	10.4216	10.2727	9.79939	10.4545	10.1112	11.0131	10.4596	10.4398	8.9619	10.4221	9.40106	9.98122	10.3061	9.15688	9.87207	10.6143	9.32764	9.55383	10.6001	10.1785	9.46146	10.0405	9.74448	10.9285	9.95905	9.51215	9.47578	10.4766	13.63	13.893	10.7383	11.7795	10.6324	9.74016	16.3046	11.1663	11.3687	16.4808	16.6489	11.9617	16.1605	10.8667	11.0586	10.8811	11.793
A7VSR5	A7VSR5_9FIRM	8-oxoguanine DNA-glycosylase (Ogg) (EC 3.2.2.-)	CLOLEP_01606	[Clostridium] leptum DSM 753	base-excision repair [GO:0006284]; nucleotide-excision repair [GO:0006289]		damaged DNA binding [GO:0003684]; oxidized purine nucleobase lesion DNA N-glycosylase activity [GO:0008534]; base-excision repair [GO:0006284]; nucleotide-excision repair [GO:0006289]	damaged DNA binding [GO:0003684]; oxidized purine nucleobase lesion DNA N-glycosylase activity [GO:0008534]	AAYLLDAAQK	0.71429	9.84956	8.81238	9.26425	11.1233	10.8113	10.3604	10.5436	10.9183	10.4298	11.1628	10.6803	10.7196	9.83837	9.65214	10.8126	9.70808	10.0657	10.8531	10.418	10.494	9.87263	10.2822	10.5657	10.3753	10.392	9.58728	10.5156	10.8232	9.88435	9.63441	9.7386	9.76937	10.303	9.37327	9.67458	8.78182	9.66865	9.35979	10.2046	10.0125	9.27738	9.50541	8.881	9.60533	10.2619	10.6013	11.408	9.7499	10.0699	10.5658	9.972	10.2603	8.9783	10.5422	11.0597	10.6055	10.2029	11.9903	10.8723	9.84453	11.9686	11.775	11.7391	10.7044	10.1565	10.727	12.2176	9.66179	10.4062	11.168	10.9934	9.70103	9.73205	10.4685	9.82518	10.1879	9.53851	11.5715	9.66381	9.0842	10.1279	9.7798	10.3486	10.0237	9.79514	9.56669	10.43	9.89162	9.47052	9.92171	10.0477	9.03396	9.6248	9.66481	10.435	9.79025	10.0341	9.15861	10.7516	10.5294	11.0226	10.3497	10.1835	10.8453	10.7003	10.861	11.3721	11.4045	11.3422	11.1435	10.1675	11.5546	12.4115	14.3961