Majority protein IDs Entry name Protein names Gene names Organism Gene ontology (biological process) Gene ontology (cellular component) Gene ontology (GO) Gene ontology (molecular function) Peptide sequences Q-value Intensity ABF group_1_RC4_01_24000 Intensity ABF group_1_RC4_01_24001 Intensity ABF group_1_RC4_01_24002 Intensity ABF group_10_RD5_01_24030 Intensity ABF group_10_RD5_01_24031 Intensity ABF group_10_RD5_01_24032 Intensity ABF group_11_RD6_01_24033 Intensity ABF group_11_RD6_01_24034 Intensity ABF group_11_RD6_01_24035 Intensity ABF group_12_RD7_01_24036 Intensity ABF group_12_RD7_01_24037 Intensity ABF group_12_RD7_01_24038 Intensity ABF group_13_RD8_01_24040 Intensity ABF group_13_RD8_01_24041 Intensity ABF group_13_RD8_01_24042 Intensity ABF group_14_RE1_01_24043 Intensity ABF group_14_RE1_01_24044 Intensity ABF group_14_RE1_01_24045 Intensity ABF group_15_RE2_01_24046 Intensity ABF group_15_RE2_01_24047 Intensity ABF group_15_RE2_01_24048 Intensity ABF group_16_RE3_01_24050 Intensity ABF group_16_RE3_01_24051 Intensity ABF group_16_RE3_01_24052 Intensity ABF group_17_RE4_01_24053 Intensity ABF group_17_RE4_01_24054 Intensity ABF group_17_RE4_01_24055 Intensity ABF group_18_RE5_01_24056 Intensity ABF group_18_RE5_01_24057 Intensity ABF group_18_RE5_01_24058 Intensity ABF group_2_RC5_01_24003 Intensity ABF group_2_RC5_01_24004 Intensity ABF group_2_RC5_01_24005 Intensity ABF group_3_RC6_01_24006 Intensity ABF group_3_RC6_01_24007 Intensity ABF group_3_RC6_01_24008 Intensity ABF group_4_RC7_01_24010 Intensity ABF group_4_RC7_01_24011 Intensity ABF group_4_RC7_01_24012 Intensity ABF group_5_RC8_01_24013 Intensity ABF group_5_RC8_01_24014 Intensity ABF group_5_RC8_01_24015 Intensity ABF group_6_RD1_01_24016 Intensity ABF group_6_RD1_01_24017 Intensity ABF group_6_RD1_01_24018 Intensity ABF group_7_RD2_01_24020 Intensity ABF group_7_RD2_01_24021 Intensity ABF group_7_RD2_01_24022 Intensity ABF group_8_RD3_01_24023 Intensity ABF group_8_RD3_01_24024 Intensity ABF group_8_RD3_01_24025 Intensity ABF group_9_RD4_01_24026 Intensity ABF group_9_RD4_01_24027 Intensity ABF group_9_RD4_01_24028 Intensity Normal group_1_BE6_01_23925 Intensity Normal group_1_BE6_01_23926 Intensity Normal group_1_BE6_01_23927 Intensity Normal group_10_RA7_01_23955 Intensity Normal group_10_RA7_01_23956 Intensity Normal group_10_RA7_01_23957 Intensity Normal group_11_RA8_01_23958 Intensity Normal group_11_RA8_01_23959 Intensity Normal group_11_RA8_01_23960 Intensity Normal group_12_RB1_01_23961 Intensity Normal group_12_RB1_01_23962 Intensity Normal group_12_RB1_01_23963 Intensity Normal group_13_RB2_01_23965 Intensity Normal group_13_RB2_01_23966 Intensity Normal group_13_RB2_01_23967 Intensity Normal group_14_RB3_01_23968 Intensity Normal group_14_RB3_01_23969 Intensity Normal group_14_RB3_01_23970 Intensity Normal group_15_RB4_01_23971 Intensity Normal group_15_RB4_01_23972 Intensity Normal group_15_RB4_01_23973 Intensity Normal group_16_RB5_01_23975 Intensity Normal group_16_RB5_01_23976 Intensity Normal group_16_RB5_01_23977 Intensity Normal group_17_RB6_01_23978 Intensity Normal group_17_RB6_01_23979 Intensity Normal group_17_RB6_01_23980 Intensity Normal group_18_RB7_01_23981 Intensity Normal group_18_RB7_01_23982 Intensity Normal group_18_RB7_01_23983 Intensity Normal group_19_RB8_01_23985 Intensity Normal group_19_RB8_01_23986 Intensity Normal group_19_RB8_01_23987 Intensity Normal group_2_BE7_01_23928 Intensity Normal group_2_BE7_01_23929 Intensity Normal group_2_BE7_01_23930 Intensity Normal group_20_RC1_01_23988 Intensity Normal group_20_RC1_01_23989 Intensity Normal group_20_RC1_01_23990 Intensity Normal group_3_BE8_01_23931 Intensity Normal group_3_BE8_01_23932 Intensity Normal group_3_BE8_01_23933 Intensity Normal group_4_RA1_01_23935 Intensity Normal group_4_RA1_01_23936 Intensity Normal group_4_RA1_01_23937 Intensity Normal group_5_RA2_01_23938 Intensity Normal group_5_RA2_01_23939 Intensity Normal group_5_RA2_01_23940 Intensity Normal group_6_RA3_01_23941 Intensity Normal group_6_RA3_01_23942 Intensity Normal group_6_RA3_01_23943 Intensity Normal group_7_RA4_01_23945 Intensity Normal group_7_RA4_01_23946 Intensity Normal group_7_RA4_01_23947 Intensity Normal group_8_RA5_01_23948 Intensity Normal group_8_RA5_01_23949 Intensity Normal group_8_RA5_01_23950 Intensity Normal group_9_RA6_01_23951 Intensity Normal group_9_RA6_01_23952 Intensity Normal group_9_RA6_01_23953 A0A1A9ATS7 A0A1A9ATS7_PLESH Inosine/xanthosine triphosphatase (ITPase/XTPase) (EC 3.6.1.73) (Non-canonical purine NTP phosphatase) (Non-standard purine NTP phosphatase) (Nucleoside-triphosphate phosphatase) (NTPase) yjjX C7R88_07990 GBN28_03210 Plesiomonas shigelloides (Aeromonas shigelloides) nucleotide metabolic process [GO:0009117] ITPase activity [GO:0103023]; metal ion binding [GO:0046872]; nucleoside-triphosphatase activity [GO:0017111]; nucleotide binding [GO:0000166]; nucleotide metabolic process [GO:0009117] ITPase activity [GO:0103023]; metal ion binding [GO:0046872]; nucleoside-triphosphatase activity [GO:0017111]; nucleotide binding [GO:0000166] GAYNRVRNAELACPK 0.92667 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5419 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A1A9AUD3 A0A1A9AUD3_PLESH Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.171) rsmD C7R88_09880 GBN28_05360 Plesiomonas shigelloides (Aeromonas shigelloides) 16S rRNA (guanine(966)-N(2))-methyltransferase activity [GO:0052913]; nucleic acid binding [GO:0003676] 16S rRNA (guanine(966)-N(2))-methyltransferase activity [GO:0052913]; nucleic acid binding [GO:0003676] ARRSPTTAK 0.904 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.6389 A0A1A9AWF4 A0A1A9AWF4_PLESH VOC family protein (Virulence protein STM3117) C7R88_05325 J2R62_09180 NCTC10363_01050 Plesiomonas shigelloides (Aeromonas shigelloides) DPDGNLIEIANR 0.94127 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6946 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A1A9AYZ5 A0A1A9AYZ5_PLESH Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) pyrF C7R88_00630 GBN28_10280 J2R62_01640 NCTC10363_02104 Plesiomonas shigelloides (Aeromonas shigelloides) 'de novo' pyrimidine nucleobase biosynthetic process [GO:0006207]; 'de novo' UMP biosynthetic process [GO:0044205] orotidine-5'-phosphate decarboxylase activity [GO:0004590]; 'de novo' pyrimidine nucleobase biosynthetic process [GO:0006207]; 'de novo' UMP biosynthetic process [GO:0044205] orotidine-5'-phosphate decarboxylase activity [GO:0004590] EMFTLFGPDFVR 0.79762 0 0 0 0 0 0 11.57 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.407 0 0 0 0 0 0 15.3785 0 0 14.1763 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A1A9AZ25 A0A1A9AZ25_PLESH Uncharacterized protein C7R88_00230 GBN28_09880 J2R62_02035 Plesiomonas shigelloides (Aeromonas shigelloides) EFVRELASTSLCD 0.94671 0 0 0 0 0 0 0 0 0 0 0 13.4047 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A1A9B000 A0A1A9B000_PLESH DUF485 domain-containing protein C7R88_12070 GBN28_03390 J2R62_16465 Plesiomonas shigelloides (Aeromonas shigelloides) FQELVSK 0.94589 0 0 0 0 0 0 0 0 0 13.5794 12.8809 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.7785 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.5444 0 0 12.8344 12.9701 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.279 0 0 0 A0A1A9B0I4 A0A1A9B0I4_PLESH Ubiquinone biosynthesis accessory factor UbiT ubiT C7R88_13525 GBN28_07530 J2R62_10655 Plesiomonas shigelloides (Aeromonas shigelloides) ubiquinone biosynthetic process [GO:0006744] ubiquinone biosynthetic process [GO:0006744] MLTQLQARLVK 0.94888 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7087 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6152 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0492 0 0 0 14.7838 A0A1A9B1V9 A0A1A9B1V9_PLESH Uncharacterized protein C7R88_11535 J2R62_09875 NCTC10363_03073 Plesiomonas shigelloides (Aeromonas shigelloides) LLNQILQQRR 0.94737 0 0 0 0 0 15.2889 16.2386 0 15.1368 0 12.7577 0 16.7735 0 16.5392 0 0 14.6491 14.0204 0 13.7613 0 0 0 0 0 13.7689 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.976 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.9774 0 0 0 0 0 0 0 0 0 0 0 13.6448 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2K8HPJ4 A0A2K8HPJ4_PLESH Ferric uptake regulation protein (Fragment) fur Plesiomonas shigelloides (Aeromonas shigelloides) cytoplasm [GO:0005737] cytoplasm [GO:0005737]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; metal ion binding [GO:0046872] DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; metal ion binding [GO:0046872] HNFEGGKSVFELTQQHHH 0.94991 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.32 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4312 0 15.4308 13.1031 15.3309 0 0 0 0 0 0 0 0 0 0 0 0 11.5144 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.0796 0 0 0 A0A2P1VL34 A0A2P1VL34_PLESH Mechanosensitive channel MscK C7R88_00250 Plesiomonas shigelloides (Aeromonas shigelloides) transmembrane transport [GO:0055085] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transport [GO:0055085] DRSFAVDELNR 0.94907 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7957 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VL51 A0A2P1VL51_PLESH 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) queC C7R88_00385 Plesiomonas shigelloides (Aeromonas shigelloides) queuosine biosynthetic process [GO:0008616] "ATP binding [GO:0005524]; ligase activity, forming carbon-nitrogen bonds [GO:0016879]; zinc ion binding [GO:0008270]; queuosine biosynthetic process [GO:0008616]" "ATP binding [GO:0005524]; ligase activity, forming carbon-nitrogen bonds [GO:0016879]; zinc ion binding [GO:0008270]" AETWALADYYDALETVR 0.94271 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9751 0 0 0 0 0 0 0 0 0 0 0 16.1357 0 0 0 9.66023 0 10.475 0 0 0 10.3432 0 0 0 0 0 0 11.3674 0 0 0 0 0 0 0 0 12.8426 0 0 0 0 13.4676 0 0 14.7526 16.1305 13.4607 12.5988 12.2379 14.3863 0 14.7197 0 0 12.6515 14.0416 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.837 12.1401 12.8297 0 0 0 0 12.2452 0 0 0 0 13.737 14.5398 0 0 0 0 0 15.6565 15.6445 16.207 14.3112 16.5141 A0A2P1VLB8 A0A2P1VLB8_PLESH DNA mismatch repair protein MutT C7R88_00765 Plesiomonas shigelloides (Aeromonas shigelloides) hydrolase activity [GO:0016787] hydrolase activity [GO:0016787] RGVGIVPLHADGSITLVRQTR 0.94324 0 0 0 0 0 0 11.3117 0 0 0 0 11.5373 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8357 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.698 0 0 0 0 12.6081 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.7245 0 0 14.1001 0 0 0 0 0 A0A2P1VLH6 A0A2P1VLH6_PLESH Phosphatase C7R88_01000 Plesiomonas shigelloides (Aeromonas shigelloides) catalytic activity [GO:0003824] catalytic activity [GO:0003824] AHFARYLMELGVASTMQGVFKK 0.94551 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.464 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6043 0 0 0 0 0 0 0 0 0 A0A2P1VLI2 A0A2P1VLI2_PLESH Fumarate hydratase class I (EC 4.2.1.2) C7R88_01085 Plesiomonas shigelloides (Aeromonas shigelloides) generation of precursor metabolites and energy [GO:0006091] "4 iron, 4 sulfur cluster binding [GO:0051539]; fumarate hydratase activity [GO:0004333]; metal ion binding [GO:0046872]; generation of precursor metabolites and energy [GO:0006091]" "4 iron, 4 sulfur cluster binding [GO:0051539]; fumarate hydratase activity [GO:0004333]; metal ion binding [GO:0046872]" DAIAQILINSR 0.94579 0 0 0 12.1561 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2986 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3488 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2284 0 0 0 0 0 0 0 0 0 11.5154 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4033 0 0 0 0 0 0 0 0 0 0 14.422 A0A2P1VLM7 A0A2P1VLM7_PLESH Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) tmk C7R88_01310 Plesiomonas shigelloides (Aeromonas shigelloides) dTDP biosynthetic process [GO:0006233]; dTTP biosynthetic process [GO:0006235] ATP binding [GO:0005524]; thymidylate kinase activity [GO:0004798]; dTDP biosynthetic process [GO:0006233]; dTTP biosynthetic process [GO:0006235] ATP binding [GO:0005524]; thymidylate kinase activity [GO:0004798] EPGGTPLAERLRSLIK 0.93496 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2116 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.754 0 0 A0A2P1VLN8 A0A2P1VLN8_PLESH Beta-hexosaminidase (EC 3.2.1.52) (Beta-N-acetylhexosaminidase) (N-acetyl-beta-glucosaminidase) nagZ C7R88_01360 Plesiomonas shigelloides (Aeromonas shigelloides) carbohydrate metabolic process [GO:0005975]; cell cycle [GO:0007049]; cell division [GO:0051301]; cell wall organization [GO:0071555]; peptidoglycan biosynthetic process [GO:0009252]; peptidoglycan turnover [GO:0009254]; regulation of cell shape [GO:0008360] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; beta-N-acetylhexosaminidase activity [GO:0004563]; N-acetyl-beta-D-galactosaminidase activity [GO:0102148]; carbohydrate metabolic process [GO:0005975]; cell cycle [GO:0007049]; cell division [GO:0051301]; cell wall organization [GO:0071555]; peptidoglycan biosynthetic process [GO:0009252]; peptidoglycan turnover [GO:0009254]; regulation of cell shape [GO:0008360] beta-N-acetylhexosaminidase activity [GO:0004563]; N-acetyl-beta-D-galactosaminidase activity [GO:0102148] AFDEDPK 0.94551 0 0 0 0 0 0 0 13.1661 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.9402 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.6544 0 0 A0A2P1VLT2 A0A2P1VLT2_PLESH Uncharacterized protein C7R88_01570 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] IADAAPQPHK 0.94019 0 0 0 0 0 0 0 13.8957 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0588 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0145 14.4535 0 0 0 A0A2P1VLV7 A0A2P1VLV7_PLESH "Putative phosphoenolpyruvate synthase regulatory protein (PEP synthase regulatory protein) (PSRP) (EC 2.7.11.33) (EC 2.7.4.28) (Pyruvate, water dikinase regulatory protein)" C7R88_01815 Plesiomonas shigelloides (Aeromonas shigelloides) protein dephosphorylation [GO:0006470] "ADP binding [GO:0043531]; ATP binding [GO:0005524]; phosphotransferase activity, phosphate group as acceptor [GO:0016776]; protein serine/threonine kinase activity [GO:0004674]; protein dephosphorylation [GO:0006470]" "ADP binding [GO:0043531]; ATP binding [GO:0005524]; phosphotransferase activity, phosphate group as acceptor [GO:0016776]; protein serine/threonine kinase activity [GO:0004674]" CGKTPTSLYMAMQFGLK 0.94074 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3867 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2437 0 0 0 0 0 0 0 0 0 11.5469 0 0 0 0 0 0 0 0 0 0 A0A2P1VLZ7 A0A2P1VLZ7_PLESH DUF1320 domain-containing protein C7R88_02020 Plesiomonas shigelloides (Aeromonas shigelloides) DQQATNLMDER 0.94211 0 0 0 0 0 0 14.2177 0 0 0 0 0 0 0 0 13.4871 0 12.5542 0 0 14.1378 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.6212 0 0 0 0 0 0 0 0 15.7216 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1805 17.4911 0 16.307 0 0 0 0 0 A0A2P1VLZ8 A0A2P1VLZ8_PLESH Phage head protein C7R88_02030 Plesiomonas shigelloides (Aeromonas shigelloides) AELNEANFAEAKEMLGSMK 0.93821 0 0 0 0 0 0 0 16.1723 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 18.5708 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 19.4662 0 21.3835 0 21.2174 19.5287 20.762 20.2903 0 0 15.521 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.7994 0 0 0 0 0 0 16.3034 16.4131 17.7897 16.8057 0 0 0 0 14.9596 0 0 0 0 0 0 0 0 15.3737 0 0 A0A2P1VM00 A0A2P1VM00_PLESH Excisionase C7R88_01940 Plesiomonas shigelloides (Aeromonas shigelloides) DNA recombination [GO:0006310] DNA binding [GO:0003677]; DNA recombination [GO:0006310] DNA binding [GO:0003677] LIPLSEWADLTFAKNAPCK 0.94606 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7534 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.6788 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.4603 0 15.3356 0 0 0 0 0 0 0 A0A2P1VM09 A0A2P1VM09_PLESH Phage_Mu_F domain-containing protein C7R88_02040 Plesiomonas shigelloides (Aeromonas shigelloides) AREQALKSDLLTK 0.94916 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9528 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.642 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0367 0 0 0 14.1617 13.5596 15.7037 0 0 0 A0A2P1VM11 A0A2P1VM11_PLESH Uncharacterized protein C7R88_02140 Plesiomonas shigelloides (Aeromonas shigelloides) MGCHVLKVTRTPAR 0.94059 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.0482 14.3358 0 0 0 0 0 0 0 0 0 0 13.3132 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VM32 A0A2P1VM32_PLESH Uncharacterized protein C7R88_02255 Plesiomonas shigelloides (Aeromonas shigelloides) GNLVRQGEEIEYYDYQDGQYK 0.93585 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.2121 0 0 12.2588 0 0 12.5611 0 15.8011 14.5738 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VM34 A0A2P1VM34_PLESH Uncharacterized protein C7R88_02175 Plesiomonas shigelloides (Aeromonas shigelloides) QKTLKSWNAGTCQLTTYDICIAMTLACLK 0.9491 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 18.6683 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VM60 A0A2P1VM60_PLESH Glyoxalase C7R88_02270 Plesiomonas shigelloides (Aeromonas shigelloides) VFGWRFVDYGPEYTAFSTEELNGGFFKAELTSR 0.94705 0 0 0 0 0 0 0 0 0 0 11.3407 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0776 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3132 0 14.3834 0 A0A2P1VM61 A0A2P1VM61_PLESH DUF1349 domain-containing protein C7R88_02415 Plesiomonas shigelloides (Aeromonas shigelloides) FTEMNLEPCK 0.94292 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5066 0 0 A0A2P1VM72 A0A2P1VM72_PLESH HTH-type transcriptional regulator YidZ C7R88_02400 Plesiomonas shigelloides (Aeromonas shigelloides) DNA-binding transcription factor activity [GO:0003700] DNA-binding transcription factor activity [GO:0003700] DWFDDPLFVR 0.94049 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3479 0 0 0 0 0 0 0 0 0 A0A2P1VM95 A0A2P1VM95_PLESH Antibiotic acetyltransferase C7R88_02530 Plesiomonas shigelloides (Aeromonas shigelloides) "acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]" "acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]" GDTHIGDGAWLGMR 0.93649 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.0078 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VMH0 A0A2P1VMH0_PLESH Heme lyase NrfEFG subunit NrfE C7R88_02875 Plesiomonas shigelloides (Aeromonas shigelloides) cytochrome complex assembly [GO:0017004] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; heme binding [GO:0020037]; heme transmembrane transporter activity [GO:0015232]; lyase activity [GO:0016829]; cytochrome complex assembly [GO:0017004] heme binding [GO:0020037]; heme transmembrane transporter activity [GO:0015232]; lyase activity [GO:0016829] AQQIALRVAHK 0.94576 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8958 0 0 0 0 13.4397 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.26 0 0 0 0 0 12.1709 11.9862 0 0 0 0 13.3763 0 A0A2P1VMJ6 A0A2P1VMJ6_PLESH Uncharacterized protein C7R88_03140 Plesiomonas shigelloides (Aeromonas shigelloides) EVWHIVPY 0.93519 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.5658 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VMK4 A0A2P1VMK4_PLESH TonB-dependent receptor C7R88_03215 Plesiomonas shigelloides (Aeromonas shigelloides) ion transport [GO:0006811]; organic substance transport [GO:0071702] cell outer membrane [GO:0009279] cell outer membrane [GO:0009279]; ion transport [GO:0006811]; organic substance transport [GO:0071702] ADGVTRYIGGAQNGK 0.94764 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.3267 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6192 0 0 0 0 0 0 19.3802 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2612 0 14.0718 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1268 0 17.1539 16.9623 17.2122 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.6941 0 A0A2P1VMN5 A0A2P1VMN5_PLESH Catalase-peroxidase (CP) (EC 1.11.1.21) (Peroxidase/catalase) katG C7R88_03375 Plesiomonas shigelloides (Aeromonas shigelloides) hydrogen peroxide catabolic process [GO:0042744]; response to oxidative stress [GO:0006979] catalase activity [GO:0004096]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; hydrogen peroxide catabolic process [GO:0042744]; response to oxidative stress [GO:0006979] catalase activity [GO:0004096]; heme binding [GO:0020037]; metal ion binding [GO:0046872] DVYWGSEKEWLAPSSAK 0.94544 0 0 0 0 10.8487 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0414 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3686 0 0 0 0 0 0 A0A2P1VMP4 A0A2P1VMP4_PLESH Dioxygenase C7R88_03455 Plesiomonas shigelloides (Aeromonas shigelloides) cellular aromatic compound metabolic process [GO:0006725] "dioxygenase activity [GO:0051213]; ferrous iron binding [GO:0008198]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen [GO:0016701]; zinc ion binding [GO:0008270]; cellular aromatic compound metabolic process [GO:0006725]" "dioxygenase activity [GO:0051213]; ferrous iron binding [GO:0008198]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen [GO:0016701]; zinc ion binding [GO:0008270]" AANNAFQQWLIDTCTSQELSELER 0.94662 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8048 0 12.4595 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3092 0 0 0 0 0 0 0 0 11.7127 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3759 A0A2P1VMP8 A0A2P1VMP8_PLESH Uncharacterized protein C7R88_03465 J2R62_16905 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] ARMEKMWHEFGTGNK 0.94715 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.4083 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8342 0 14.3213 0 16.7861 A0A2P1VMQ4 A0A2P1VMQ4_PLESH Uncharacterized protein C7R88_03515 Plesiomonas shigelloides (Aeromonas shigelloides) KLIFNEQEDDWWTCTEYFVK 0.94326 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.654 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.165 0 0 0 0 0 0 0 0 0 0 0 0 14.2798 0 0 0 0 0 0 12.0561 0 13.1087 0 0 0 0 0 0 0 0 0 14.0278 16.1153 A0A2P1VMR3 A0A2P1VMR3_PLESH Uncharacterized protein C7R88_03470 Plesiomonas shigelloides (Aeromonas shigelloides) ATLCPLTKCYLKGEFNR 0.94133 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7239 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2535 14.5282 0 17.7492 0 0 0 0 13.5407 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6694 15.9191 15.7848 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4853 0 0 0 0 0 15.9255 0 0 0 A0A2P1VMR5 A0A2P1VMR5_PLESH Uncharacterized protein C7R88_03550 Plesiomonas shigelloides (Aeromonas shigelloides) CFRVQKYDDGEVIDVFHEHIPSYR 0.94162 0 0 0 12.5359 11.5072 11.9705 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.1208 0 0 0 0 0 11.3531 0 0 12.4783 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.474 0 16.3162 0 0 14.0883 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5012 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.0203 0 0 0 0 0 15.9943 0 A0A2P1VMV2 A0A2P1VMV2_PLESH Chaperone protein TorD torD C7R88_03760 Plesiomonas shigelloides (Aeromonas shigelloides) metabolic process [GO:0008152]; protein complex oligomerization [GO:0051259]; protein folding [GO:0006457] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; metabolic process [GO:0008152]; protein complex oligomerization [GO:0051259]; protein folding [GO:0006457] QGALPYASCYEGDK 0.94651 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3083 0 0 0 13.2584 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.301 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8933 0 0 0 0 0 0 0 14.7708 0 0 0 16.7884 0 0 0 A0A2P1VMV5 A0A2P1VMV5_PLESH Histidine kinase (EC 2.7.13.3) C7R88_03735 Plesiomonas shigelloides (Aeromonas shigelloides) protein autophosphorylation [GO:0046777] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; phosphorelay sensor kinase activity [GO:0000155]; protein autophosphorylation [GO:0046777] phosphorelay sensor kinase activity [GO:0000155] CAQVSTADLLNLEQLRDDYQR 0.94351 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5932 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9909 0 0 0 13.6653 0 0 0 0 0 0 0 12.3837 0 0 0 0 0 0 0 0 0 0 0 0 11.889 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3706 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VMY7 A0A2P1VMY7_PLESH Uncharacterized protein C7R88_03995 Plesiomonas shigelloides (Aeromonas shigelloides) HQQWPMPFSVTMDER 0.92308 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4042 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VN44 A0A2P1VN44_PLESH MFS transporter TsgA C7R88_04280 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] CEQSAESSDSAK 0.94745 0 0 0 0 11.6761 0 0 0 0 0 0 13.016 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7142 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VN50 A0A2P1VN50_PLESH TonB-dependent receptor C7R88_04305 Plesiomonas shigelloides (Aeromonas shigelloides) cell outer membrane [GO:0009279] cell outer membrane [GO:0009279]; heme transmembrane transporter activity [GO:0015232] heme transmembrane transporter activity [GO:0015232] APSMEEMYTTGTHFCMGPMGCNVFK 0.9433 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4746 0 14.2001 0 12.1255 12.8508 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7975 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VN98 A0A2P1VN98_PLESH Gluconate transporter C7R88_04590 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; gluconate transmembrane transporter activity [GO:0015128] gluconate transmembrane transporter activity [GO:0015128] GELPSFGLAMGLIGLPLLMIGLKTIAAR 0.94326 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.9783 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7238 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6113 0 0 0 0 13.2511 0 0 0 0 0 A0A2P1VNB3 A0A2P1VNB3_PLESH Uncharacterized protein C7R88_04645 Plesiomonas shigelloides (Aeromonas shigelloides) DVRNLLILKYK 0.9496 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0236 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.046 0 0 0 0 0 0 0 12.3185 12.5898 13.1205 13.828 13.6195 0 0 0 0 10.8855 0 16.3928 0 11.9309 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.3104 0 0 0 0 0 0 0 14.0846 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VNB4 A0A2P1VNB4_PLESH LacI family transcriptional regulator C7R88_04670 Plesiomonas shigelloides (Aeromonas shigelloides) outer membrane-bounded periplasmic space [GO:0030288] outer membrane-bounded periplasmic space [GO:0030288] ATMDELAKHMGQK 0.94606 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.8655 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2936 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.0061 0 0 13.5942 A0A2P1VNL8 A0A2P1VNL8_PLESH Quinol dehydrogenase ferredoxin subunit NapH C7R88_05235 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021]; 4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]" "4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]" CMDVCAEHVLEFK 0.93893 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.919 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VNM2 A0A2P1VNM2_PLESH Ferredoxin-type protein NapF napF C7R88_05265 Plesiomonas shigelloides (Aeromonas shigelloides) cytoplasm [GO:0005737] "cytoplasm [GO:0005737]; 4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]" "4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]" AECTFCR 0.94141 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.1974 0 0 0 0 0 0 0 0 A0A2P1VNW8 A0A2P1VNW8_PLESH Uncharacterized protein C7R88_05790 Plesiomonas shigelloides (Aeromonas shigelloides) APQGFDALMVKIRNDR 0.94864 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.4707 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VNZ9 A0A2P1VNZ9_PLESH Phosphoethanolamine transferase C7R88_05930 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] "integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; sulfuric ester hydrolase activity [GO:0008484]; transferase activity, transferring phosphorus-containing groups [GO:0016772]" "sulfuric ester hydrolase activity [GO:0008484]; transferase activity, transferring phosphorus-containing groups [GO:0016772]" AIPFQHLGMDAQDSAR 0.84615 0 0 0 0 0 0 0 0 0 0 0 16.5888 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.8781 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VPB8 A0A2P1VPB8_PLESH Uncharacterized protein C7R88_06665 Plesiomonas shigelloides (Aeromonas shigelloides) DFSGWGRQYYLFSPLTK 0.94911 0 0 0 0 0 0 0 11.5723 0 0 11.533 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0957 0 0 0 14.3851 0 0 0 0 0 0 10.8389 0 0 0 0 0 0 0 0 0 0 11.1041 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.3222 0 0 0 0 0 0 A0A2P1VPC3 A0A2P1VPC3_PLESH Flagellar hook-associated protein 3 flgL C7R88_06670 Plesiomonas shigelloides (Aeromonas shigelloides) bacterial-type flagellum-dependent cell motility [GO:0071973] bacterial-type flagellum hook [GO:0009424]; extracellular region [GO:0005576] bacterial-type flagellum hook [GO:0009424]; extracellular region [GO:0005576]; structural molecule activity [GO:0005198]; bacterial-type flagellum-dependent cell motility [GO:0071973] structural molecule activity [GO:0005198] DDPANPGTLLPPEPQPVDMK 0.94778 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.048 0 0 0 17.6528 17.4593 17.1113 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VPC7 A0A2P1VPC7_PLESH Flagellar basal body rod protein FlgB flgB_2 flgB C7R88_06720 GBN28_13765 J2R62_00600 NCTC10363_00806 Plesiomonas shigelloides (Aeromonas shigelloides) bacterial-type flagellum-dependent cell motility [GO:0071973] "bacterial-type flagellum basal body, rod [GO:0030694]" "bacterial-type flagellum basal body, rod [GO:0030694]; bacterial-type flagellum-dependent cell motility [GO:0071973]" DMDFSQALDQAIAQGSDQLSGGSLAMTDSR 0.93828 0 0 0 13.8216 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.3268 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.75108 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6903 A0A2P1VPC9 A0A2P1VPC9_PLESH Uncharacterized protein C7R88_06400 Plesiomonas shigelloides (Aeromonas shigelloides) GGSGHAGR 0.94605 0 0 0 0 13.1632 0 0 0 0 0 0 0 0 13.3297 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.036 12.8896 0 0 12.803 13.3211 13.9763 0 13.7651 0 13.0924 0 0 0 0 0 0 0 0 0 13.521 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1138 A0A2P1VPF4 A0A2P1VPF4_PLESH Uncharacterized protein C7R88_06800 Plesiomonas shigelloides (Aeromonas shigelloides) ATIAMLVK 0.94937 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.2077 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2781 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.8013 0 0 0 0 0 0 0 0 0 0 0 0 13.1838 0 0 14.3407 14.6349 15.6959 0 13.9166 0 0 0 0 0 0 0 A0A2P1VPF8 A0A2P1VPF8_PLESH Peptidase M66 C7R88_06865 Plesiomonas shigelloides (Aeromonas shigelloides) carbohydrate metabolic process [GO:0005975] extracellular region [GO:0005576] "extracellular region [GO:0005576]; carbohydrate binding [GO:0030246]; hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]; metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]; carbohydrate metabolic process [GO:0005975]" "carbohydrate binding [GO:0030246]; hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]; metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]" AEATYVGGDLASHNGK 0 0 0 0 0 0 13.5929 13.5864 0 13.2953 0 0 0 0 0 0 16.6051 11.3816 11.9945 0 0 0 0 0 0 12.7863 0 0 0 0 0 0 0 9.82974 0 0 0 0 0 0 0 0 0 0 12.6998 0 0 13.1351 0 0 11.997 0 0 0 0 13.5707 0 0 13.255 0 13.8685 15.32 15.4204 16.3608 15.4778 16.3827 13.4745 0 0 0 0 0 0 0 0 0 0 0 12.6618 0 0 0 0 0 11.2626 12.8435 0 0 13.6598 0 0 0 0 0 0 10.1472 12.8758 0 0 0 0 0 11.5195 13.8655 18.4063 17.4554 15.5373 14.8453 16.9976 18.0383 17.639 0 13.5341 0 16.4241 A0A2P1VPG6 A0A2P1VPG6_PLESH DUF4258 domain-containing protein C7R88_06960 Plesiomonas shigelloides (Aeromonas shigelloides) HAQQRMQQRGISSQAVEWLLDFGHADYHR 0 0 0 0 14.1109 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0197 13.0517 14.0487 12.0841 0 0 14.3362 0 0 0 0 11.7757 0 0 0 12.2456 0 0 12.9794 0 14.655 11.9338 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.714 12.7626 11.7805 12.1975 11.3558 0 0 0 0 0 0 0 0 0 0 0 14.0861 0 15.4488 13.8674 A0A2P1VPG7 A0A2P1VPG7_PLESH General secretion pathway protein F gspF C7R88_06920 Plesiomonas shigelloides (Aeromonas shigelloides) protein secretion by the type II secretion system [GO:0015628] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; type II protein secretion system complex [GO:0015627] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; type II protein secretion system complex [GO:0015627]; metal ion binding [GO:0046872]; protein secretion by the type II secretion system [GO:0015628] metal ion binding [GO:0046872] CGELEPMLAQAADNQDR 0.94293 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5008 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.287 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VPJ4 A0A2P1VPJ4_PLESH Uncharacterized protein C7R88_06840 Plesiomonas shigelloides (Aeromonas shigelloides) FGYRYFSIDYDR 0.94923 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1586 0 0 0 0 0 0 0 14.5311 15.9266 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.4883 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VPJ9 A0A2P1VPJ9_PLESH Oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB C7R88_07150 Plesiomonas shigelloides (Aeromonas shigelloides) oxidoreductase activity [GO:0016491] oxidoreductase activity [GO:0016491] EQGFTAVAMVALGYR 0.93984 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.108 0 0 0 0 0 0 14.8108 0 14.2718 0 0 0 14.8517 0 0 0 0 13.8171 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7057 A0A2P1VPL2 A0A2P1VPL2_PLESH N-acetylglucosamine-binding protein GbpA C7R88_06875 Plesiomonas shigelloides (Aeromonas shigelloides) chitin binding [GO:0008061] chitin binding [GO:0008061] AYTAGTTVLQPKNGKIYECK 0.94056 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.4083 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VPM0 A0A2P1VPM0_PLESH Haloacid dehalogenase C7R88_06955 Plesiomonas shigelloides (Aeromonas shigelloides) metal ion binding [GO:0046872] metal ion binding [GO:0046872] ESLQRLPPSR 0.9442 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2149 11.4497 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VPM5 A0A2P1VPM5_PLESH NAD-dependent malic enzyme (EC 1.1.1.38) C7R88_07170 Plesiomonas shigelloides (Aeromonas shigelloides) malate dehydrogenase (decarboxylating) (NAD+) activity [GO:0004471]; metal ion binding [GO:0046872]; NAD binding [GO:0051287]; oxaloacetate decarboxylase activity [GO:0008948] malate dehydrogenase (decarboxylating) (NAD+) activity [GO:0004471]; metal ion binding [GO:0046872]; NAD binding [GO:0051287]; oxaloacetate decarboxylase activity [GO:0008948] ACQEFSHRYQK 0.94547 0 0 0 0 0 12.8549 0 0 0 0 0 0 0 0 0 0 0 0 0 16.465 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5998 15.737 0 0 0 12.9014 0 0 0 15.6397 0 15.612 0 0 0 0 14.5518 14.5735 12.3387 0 13.1631 15.3913 15.6705 15.2586 13.6723 12.6792 13.6229 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5287 0 0 0 0 0 0 0 10.2209 0 0 0 0 0 0 16.1528 15.5525 0 0 0 15.6066 15.7083 0 0 15.8104 0 A0A2P1VPM7 A0A2P1VPM7_PLESH Uncharacterized protein C7R88_07450 Plesiomonas shigelloides (Aeromonas shigelloides) GNNSAGER 0.15 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.2941 15.982 0 14.0906 0 14.9516 13.2673 16.3165 13.7626 14.6024 14.5866 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.2878 0 0 0 0 0 0 0 0 0 15.2495 15.1169 0 0 18.5459 0 17.5231 17.2429 17.392 0 16.9087 18.5063 18.667 16.4368 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.3899 16.6615 0 0 0 0 0 15.4191 13.596 0 0 0 0 0 0 16.261 16.3205 16.418 0 0 0 18.5003 18.7575 15.3595 0 0 0 A0A2P1VPS3 A0A2P1VPS3_PLESH Uncharacterized protein C7R88_07625 Plesiomonas shigelloides (Aeromonas shigelloides) DELQERLQDWWQAQDPAR 0.94385 0 0 0 0 0 0 0 0 13.9491 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.2386 0 0 A0A2P1VPX5 A0A2P1VPX5_PLESH MDR efflux pump AcrAB transcriptional activator RobA C7R88_07980 Plesiomonas shigelloides (Aeromonas shigelloides) DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565] DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565] ASPDIEIFPTSSERPMEFGIIQCDYYIPIR 0.94975 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3032 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2491 13.6426 0 0 0 14.4747 0 0 0 0 0 14.0177 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9724 0 A0A2P1VPY1 A0A2P1VPY1_PLESH Uncharacterized protein C7R88_07935 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] FMVVTSQQQTQQLLNQLAQQK 0.93774 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2518 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VPY5 A0A2P1VPY5_PLESH Biosynthetic peptidoglycan transglycosylase (EC 2.4.1.129) (Glycan polymerase) (Peptidoglycan glycosyltransferase MtgA) (PGT) mgt mtgA C7R88_07970 NCTC10363_00545 Plesiomonas shigelloides (Aeromonas shigelloides) cell wall organization [GO:0071555]; peptidoglycan biosynthetic process [GO:0009252]; regulation of cell shape [GO:0008360] integral component of membrane [GO:0016021]; peptidoglycan-based cell wall [GO:0009274]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; peptidoglycan-based cell wall [GO:0009274]; plasma membrane [GO:0005886]; pentosyltransferase activity [GO:0016763]; peptidoglycan glycosyltransferase activity [GO:0008955]; cell wall organization [GO:0071555]; peptidoglycan biosynthetic process [GO:0009252]; regulation of cell shape [GO:0008360] pentosyltransferase activity [GO:0016763]; peptidoglycan glycosyltransferase activity [GO:0008955] EAALLAAVLPNPIRYKVQAPSGYVVR 0.94916 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9437 0 14.8136 0 0 0 0 0 0 0 0 0 0 0 0 13.0438 0 0 0 0 0 0 10.8329 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VQ19 A0A2P1VQ19_PLESH PTS N-acetylgalactosamine transporter subunit IIB C7R88_08120 Plesiomonas shigelloides (Aeromonas shigelloides) phosphoenolpyruvate-dependent sugar phosphotransferase system [GO:0009401] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; kinase activity [GO:0016301]; protein-N(PI)-phosphohistidine-sugar phosphotransferase activity [GO:0008982]; phosphoenolpyruvate-dependent sugar phosphotransferase system [GO:0009401] kinase activity [GO:0016301]; protein-N(PI)-phosphohistidine-sugar phosphotransferase activity [GO:0008982] GGVPITHCNVGNMHFHEGKTQIAKTVSVDEK 0.94676 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 18.3813 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VQ96 A0A2P1VQ96_PLESH Iron ABC transporter permease C7R88_08615 Plesiomonas shigelloides (Aeromonas shigelloides) transmembrane transport [GO:0055085] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transport [GO:0055085] ALFGWQTLQDYWFPPIR 0.94216 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.6211 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VQC1 A0A2P1VQC1_PLESH Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) coaE C7R88_08755 Plesiomonas shigelloides (Aeromonas shigelloides) coenzyme A biosynthetic process [GO:0015937] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; ATP binding [GO:0005524]; dephospho-CoA kinase activity [GO:0004140]; coenzyme A biosynthetic process [GO:0015937] ATP binding [GO:0005524]; dephospho-CoA kinase activity [GO:0004140] AALRARIFAEPEEK 0.94516 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3094 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VQJ7 A0A2P1VQJ7_PLESH Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19) C7R88_08720 Plesiomonas shigelloides (Aeromonas shigelloides) NAD biosynthetic process [GO:0009435] nicotinate-nucleotide diphosphorylase (carboxylating) activity [GO:0004514]; NAD biosynthetic process [GO:0009435] nicotinate-nucleotide diphosphorylase (carboxylating) activity [GO:0004514] DIPSRVR 0.93738 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.7863 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3264 13.264 13.6359 14.7681 0 13.6347 0 14.0161 14.7816 14.2091 0 0 0 15.4317 0 16.8455 0 0 14.603 14.0709 0 14.6217 12.7268 13.3079 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8485 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.6352 0 0 17.1214 0 16.2703 A0A2P1VQR8 A0A2P1VQR8_PLESH Type II secretion system protein K C7R88_09670 Plesiomonas shigelloides (Aeromonas shigelloides) protein secretion [GO:0009306] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; protein secretion [GO:0009306] ANLSQSWAVGER 0.94904 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1261 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VQZ7 A0A2P1VQZ7_PLESH OmpA-like domain-containing protein C7R88_10015 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] MQEKDMMPLQRTGSR 0.93711 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7332 0 0 0 0 0 0 0 0 0 11.812 0 15.5187 15.5118 15.0099 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.689 15.9931 0 16.6563 0 0 14.1532 A0A2P1VR41 A0A2P1VR41_PLESH Molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) mobA C7R88_10350 Plesiomonas shigelloides (Aeromonas shigelloides) Mo-molybdopterin cofactor biosynthetic process [GO:0006777] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; GTP binding [GO:0005525]; metal ion binding [GO:0046872]; molybdenum cofactor guanylyltransferase activity [GO:0061603]; Mo-molybdopterin cofactor biosynthetic process [GO:0006777] GTP binding [GO:0005525]; metal ion binding [GO:0046872]; molybdenum cofactor guanylyltransferase activity [GO:0061603] QVAGHPLYWYAVQR 0.94864 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2434 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.0593 0 0 0 13.4682 0 0 0 A0A2P1VR48 A0A2P1VR48_PLESH ATP-dependent helicase C7R88_10085 Plesiomonas shigelloides (Aeromonas shigelloides) ATP binding [GO:0005524]; helicase activity [GO:0004386] ATP binding [GO:0005524]; helicase activity [GO:0004386] ALYEQAR 0.93162 0 0 0 0 0 0 0 11.3414 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5127 0 0 15.3591 0 14.8056 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.753 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1065 0 0 0 0 0 13.4374 0 0 0 0 0 0 0 0 17.8671 0 0 0 0 0 A0A2P1VR68 A0A2P1VR68_PLESH Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) rfbA C7R88_10200 Plesiomonas shigelloides (Aeromonas shigelloides) extracellular polysaccharide biosynthetic process [GO:0045226] glucose-1-phosphate thymidylyltransferase activity [GO:0008879]; metal ion binding [GO:0046872]; extracellular polysaccharide biosynthetic process [GO:0045226] glucose-1-phosphate thymidylyltransferase activity [GO:0008879]; metal ion binding [GO:0046872] AISIEEK 0.94654 0 0 0 0 0 0 11.0709 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.9863 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.4576 17.6422 0 0 0 0 0 0 0 0 0 0 14.0461 14.4019 0 0 0 0 13.6784 0 17.9589 17.9921 0 14.1091 0 12.7364 0 0 0 0 0 0 0 0 0 0 0 0 10.7631 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9045 0 0 0 0 0 14.2893 0 14.8923 A0A2P1VR86 A0A2P1VR86_PLESH Flagellin C7R88_10530 Plesiomonas shigelloides (Aeromonas shigelloides) bacterial-type flagellum [GO:0009288]; extracellular region [GO:0005576] bacterial-type flagellum [GO:0009288]; extracellular region [GO:0005576]; structural molecule activity [GO:0005198] structural molecule activity [GO:0005198] ALFASAGGLASGITFQVGAEMK 0.94297 9.8759 0 0 12.3307 13.8136 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1677 0 13.3658 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.1115 15.8193 0 0 0 0 15.1028 0 15.4422 0 0 0 0 0 12.9951 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5794 0 13.329 0 0 0 0 0 0 0 0 0 0 0 0 15.1907 15.278 0 15.0062 0 A0A2P1VR91 A0A2P1VR91_PLESH Flagellar hook-associated protein 2 (HAP2) (Flagellar cap protein) C7R88_10525 Plesiomonas shigelloides (Aeromonas shigelloides) cell adhesion [GO:0007155] bacterial-type flagellum filament cap [GO:0009421]; bacterial-type flagellum hook [GO:0009424]; extracellular region [GO:0005576] bacterial-type flagellum filament cap [GO:0009421]; bacterial-type flagellum hook [GO:0009424]; extracellular region [GO:0005576]; cell adhesion [GO:0007155] AISEDPESISTVFLGADGK 0.4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.7549 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VRD0 A0A2P1VRD0_PLESH Uncharacterized protein C7R88_10535 Plesiomonas shigelloides (Aeromonas shigelloides) FAFDGGK 0.9375 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7309 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VRE9 A0A2P1VRE9_PLESH Flagellar hook-basal body complex protein FliE fliE C7R88_10635 GBN28_04625 J2R62_04340 Plesiomonas shigelloides (Aeromonas shigelloides) bacterial-type flagellum-dependent cell motility [GO:0071973] bacterial-type flagellum basal body [GO:0009425] bacterial-type flagellum basal body [GO:0009425]; cytoskeletal motor activity [GO:0003774]; structural molecule activity [GO:0005198]; bacterial-type flagellum-dependent cell motility [GO:0071973] cytoskeletal motor activity [GO:0003774]; structural molecule activity [GO:0005198] ASLSFTALVQVRQK 0.94914 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4742 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8452 0 0 0 0 0 13.4476 0 12.8413 0 13.2506 0 0 0 0 14.0685 0 0 0 14.0306 0 14.3879 0 0 0 0 A0A2P1VRJ9 A0A2P1VRJ9_PLESH DUF4056 domain-containing protein C7R88_11265 Plesiomonas shigelloides (Aeromonas shigelloides) DDFVHFAIAAEQR 0.9488 0 0 0 14.1866 15.0963 14.2716 0 0 0 0 11.4019 0 14.981 14.3965 16.6785 0 0 0 0 13.0147 0 0 0 0 0 12.8127 13.0654 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6451 0 0 17.5878 11.7543 0 0 0 13.67 0 0 15.4554 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0428 0 0 14.6554 15.7212 16.5096 0 0 0 0 13.9406 0 0 13.6587 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VRM2 A0A2P1VRM2_PLESH Uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) hemX C7R88_11300 J2R62_10120 Plesiomonas shigelloides (Aeromonas shigelloides) methylation [GO:0032259] methyltransferase activity [GO:0008168]; methylation [GO:0032259] methyltransferase activity [GO:0008168] DGNVEPLLAPNQDYYLR 0.94375 0 0 0 14.9045 16.1115 0 0 0 0 0 0 0 0 15.7284 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.042 12.3891 13.0166 0 13.8444 0 0 0 0 0 0 13.2393 17.0872 17.032 17.4127 0 0 13.4371 0 0 14.9796 13.026 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.7589 12.3129 14.8614 14.8773 0 0 0 0 0 15.512 16.8386 0 0 0 0 0 0 0 0 0 0 11.7275 0 0 0 0 0 0 10.2921 0 0 0 0 0 0 0 0 0 0 0 0 13.8249 0 A0A2P1VRN3 A0A2P1VRN3_PLESH Glucose-1-phosphatase C7R88_11505 Plesiomonas shigelloides (Aeromonas shigelloides) hydrolase activity [GO:0016787]; metal ion binding [GO:0046872] hydrolase activity [GO:0016787]; metal ion binding [GO:0046872] DAQTVPEYFR 0.94628 0 0 0 0 0 0 0 0 0 0 0 0 0 12.2476 0 0 12.4761 0 0 14.3857 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5087 0 0 0 0 0 0 13.8427 0 0 0 0 0 0 0 14.0866 17.6244 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5081 14.7115 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VRQ5 A0A2P1VRQ5_PLESH Coenzyme A biosynthesis bifunctional protein CoaBC (DNA/pantothenate metabolism flavoprotein) (Phosphopantothenoylcysteine synthetase/decarboxylase) (PPCS-PPCDC) [Includes: Phosphopantothenoylcysteine decarboxylase (PPC decarboxylase) (PPC-DC) (EC 4.1.1.36) (CoaC); Phosphopantothenate--cysteine ligase (EC 6.3.2.5) (CoaB) (Phosphopantothenoylcysteine synthetase) (PPC synthetase) (PPC-S)] coaBC C7R88_11645 Plesiomonas shigelloides (Aeromonas shigelloides) coenzyme A biosynthetic process [GO:0015937]; pantothenate catabolic process [GO:0015941] FMN binding [GO:0010181]; metal ion binding [GO:0046872]; phosphopantothenate--cysteine ligase activity [GO:0004632]; phosphopantothenoylcysteine decarboxylase activity [GO:0004633]; coenzyme A biosynthetic process [GO:0015937]; pantothenate catabolic process [GO:0015941] FMN binding [GO:0010181]; metal ion binding [GO:0046872]; phosphopantothenate--cysteine ligase activity [GO:0004632]; phosphopantothenoylcysteine decarboxylase activity [GO:0004633] AACVAPEKIK 0.93942 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0751 0 0 0 0 0 A0A2P1VRZ0 A0A2P1VRZ0_PLESH Cyclic nucleotide-binding protein C7R88_12085 Plesiomonas shigelloides (Aeromonas shigelloides) [protein-PII] uridylyltransferase activity [GO:0008773] [protein-PII] uridylyltransferase activity [GO:0008773] AGDEITR 0.94386 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5332 0 0 0 0 0 0 0 0 0 A0A2P1VS50 A0A2P1VS50_PLESH Thiol:disulfide interchange protein DsbD (EC 1.8.1.8) (Protein-disulfide reductase) (Disulfide reductase) dipZ dsbD C7R88_12265 Plesiomonas shigelloides (Aeromonas shigelloides) cytochrome complex assembly [GO:0017004] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; electron transfer activity [GO:0009055]; protein-disulfide reductase (NAD(P)) activity [GO:0047134]; cytochrome complex assembly [GO:0017004] electron transfer activity [GO:0009055]; protein-disulfide reductase (NAD(P)) activity [GO:0047134] GFLVLRIAALIGMILLAR 0.94031 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VS62 A0A2P1VS62_PLESH DUF2157 domain-containing protein C7R88_12320 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] FGPLTYSALSATLLLIALLLAEVLHRR 0.93962 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9648 0 0 15.6176 15.539 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.3898 0 15.1089 0 0 0 A0A2P1VS85 A0A2P1VS85_PLESH Acetyl-coenzyme A synthetase (AcCoA synthetase) (Acs) (EC 6.2.1.1) (Acetate--CoA ligase) (Acyl-activating enzyme) acs C7R88_12075 Plesiomonas shigelloides (Aeromonas shigelloides) acetyl-CoA biosynthetic process from acetate [GO:0019427]; chemotaxis [GO:0006935] acetate-CoA ligase activity [GO:0003987]; AMP binding [GO:0016208]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; acetyl-CoA biosynthetic process from acetate [GO:0019427]; chemotaxis [GO:0006935] acetate-CoA ligase activity [GO:0003987]; AMP binding [GO:0016208]; ATP binding [GO:0005524]; metal ion binding [GO:0046872] ADYETLYRQSVSNPDSFWREQGK 0.9292 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.9216 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VS92 A0A2P1VS92_PLESH Chaperone SurA (Peptidyl-prolyl cis-trans isomerase SurA) (PPIase SurA) (EC 5.2.1.8) (Rotamase SurA) surA C7R88_12745 Plesiomonas shigelloides (Aeromonas shigelloides) Gram-negative-bacterium-type cell outer membrane assembly [GO:0043165]; maintenance of stationary phase [GO:0060274]; protein folding [GO:0006457]; protein stabilization [GO:0050821] outer membrane-bounded periplasmic space [GO:0030288] outer membrane-bounded periplasmic space [GO:0030288]; peptide binding [GO:0042277]; peptidyl-prolyl cis-trans isomerase activity [GO:0003755]; unfolded protein binding [GO:0051082]; Gram-negative-bacterium-type cell outer membrane assembly [GO:0043165]; maintenance of stationary phase [GO:0060274]; protein folding [GO:0006457]; protein stabilization [GO:0050821] peptide binding [GO:0042277]; peptidyl-prolyl cis-trans isomerase activity [GO:0003755]; unfolded protein binding [GO:0051082] AQGINYADYREQIR 0.89865 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.206 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VS98 A0A2P1VS98_PLESH Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) msrA C7R88_12630 Plesiomonas shigelloides (Aeromonas shigelloides) cellular protein modification process [GO:0006464] L-methionine:thioredoxin-disulfide S-oxidoreductase activity [GO:0033744]; peptide-methionine (S)-S-oxide reductase activity [GO:0008113]; cellular protein modification process [GO:0006464] L-methionine:thioredoxin-disulfide S-oxidoreductase activity [GO:0033744]; peptide-methionine (S)-S-oxide reductase activity [GO:0008113] AAGPFYLAEDK 0.94525 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.7335 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2427 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.6277 14.5204 0 A0A2P1VSK4 A0A2P1VSK4_PLESH Uncharacterized protein C7R88_13325 Plesiomonas shigelloides (Aeromonas shigelloides) MMELQNFYVR 0.94503 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.893 0 0 0 0 0 0 0 0 0 11.8861 0 0 0 0 0 0 0 0 0 0 0 12.1674 12.7603 0 0 0 0 0 0 0 A0A2P1VSP6 A0A2P1VSP6_PLESH Putrescine transporter PotE (Putrescine-proton symporter / putrescine-ornithine antiporter) potE C7R88_13560 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of plasma membrane [GO:0005887] integral component of plasma membrane [GO:0005887]; putrescine:ornithine antiporter activity [GO:0015496]; symporter activity [GO:0015293] putrescine:ornithine antiporter activity [GO:0015496]; symporter activity [GO:0015293] FEVQPAIEMATSNTDSDASAQNSGAVTSA 0.94 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1614 0 0 13.5726 18.6612 0 11.2457 0 0 18.7185 18.9842 19.9857 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 19.2292 19.1861 18.4315 13.1678 12.7085 17.681 13.6358 14.0439 16.9654 17.8087 0 17.3394 14.1159 16.8332 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6922 0 0 0 13.3836 0 0 0 0 0 0 0 0 0 11.1375 0 0 0 0 13.9952 15.3686 19.9679 15.2407 13.3914 0 A0A2P1VSR6 A0A2P1VSR6_PLESH Uncharacterized protein C7R88_13205 Plesiomonas shigelloides (Aeromonas shigelloides) FFSELLSLPDTPDGAIVLPRPLQR 0.94228 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3199 0 0 0 0 11.4921 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6281 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2695 0 0 0 0 0 0 0 0 0 0 0 0 13.8698 14.5567 0 0 0 13.2864 13.1754 0 0 0 0 0 0 0 0 13.7367 0 0 0 0 0 A0A2P1VSY9 A0A2P1VSY9_PLESH BMP family ABC transporter substrate-binding protein (Purine nucleoside receptor A) tmpC C7R88_14210 NCTC10363_02558 Plesiomonas shigelloides (Aeromonas shigelloides) plasma membrane [GO:0005886] plasma membrane [GO:0005886] DAQDGKFTAGEQSLGLK 0.94382 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.4471 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.4205 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VT21 A0A2P1VT21_PLESH dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) C7R88_13705 Plesiomonas shigelloides (Aeromonas shigelloides) nucleobase-containing small molecule biosynthetic process [GO:0034404]; nucleotide metabolic process [GO:0009117]; purine nucleoside triphosphate catabolic process [GO:0009146] dITP diphosphatase activity [GO:0035870]; ITP diphosphatase activity [GO:0036220]; metal ion binding [GO:0046872]; nucleoside-triphosphatase activity [GO:0017111]; nucleotide binding [GO:0000166]; XTP diphosphatase activity [GO:0036222]; nucleobase-containing small molecule biosynthetic process [GO:0034404]; nucleotide metabolic process [GO:0009117]; purine nucleoside triphosphate catabolic process [GO:0009146] dITP diphosphatase activity [GO:0035870]; ITP diphosphatase activity [GO:0036220]; metal ion binding [GO:0046872]; nucleoside-triphosphatase activity [GO:0017111]; nucleotide binding [GO:0000166]; XTP diphosphatase activity [GO:0036222] AQALKKLQDAMTHA 0.94479 0 0 0 0 12.5207 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8297 0 0 0 16.7122 16.8204 14.755 0 0 0 0 11.474 10.6544 0 0 0 0 0 0 0 0 0 0 0 10.2724 12.8427 0 16.8062 0 13.0801 0 0 0 0 16.999 15.3447 15.8629 17.7581 11.5054 18.9952 15.4833 13.7849 15.9158 14.3267 0 16.3576 13.9217 16.0634 15.2467 15.7261 16.1696 12.8622 15.4638 0 0 0 0 0 14.8927 0 0 0 0 0 0 0 0 0 15.1565 14.7083 11.6425 0 0 0 0 0 0 0 0 16.6673 0 0 0 0 0 0 0 0 0 20.0144 21.1906 15.0667 0 14.7425 A0A2P1VT38 A0A2P1VT38_PLESH tRNA-modifying protein YgfZ C7R88_14510 Plesiomonas shigelloides (Aeromonas shigelloides) RNA modification [GO:0009451]; tRNA processing [GO:0008033] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; folic acid binding [GO:0005542]; RNA modification [GO:0009451]; tRNA processing [GO:0008033] folic acid binding [GO:0005542] ALYTLAGHGHTAPQAGDSLELQLDENWR 0.94439 0 0 0 0 0 0 0 0 14.5379 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8586 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4902 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VTA5 A0A2P1VTA5_PLESH Riboflavin synthase (EC 2.5.1.9) C7R88_14910 Plesiomonas shigelloides (Aeromonas shigelloides) riboflavin biosynthetic process [GO:0009231] riboflavin synthase activity [GO:0004746]; riboflavin biosynthetic process [GO:0009231] riboflavin synthase activity [GO:0004746] ITLVPHTQQETTTLNWQAGSKINLEVDLLAR 0.94755 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9873 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0712 0 0 0 0 0 0 0 0 0 0 0 12.7109 0 0 0 0 12.1926 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2866 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VTJ6 A0A2P1VTJ6_PLESH Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) nadD C7R88_15155 Plesiomonas shigelloides (Aeromonas shigelloides) NAD biosynthetic process [GO:0009435] ATP binding [GO:0005524]; nicotinate-nucleotide adenylyltransferase activity [GO:0004515]; NAD biosynthetic process [GO:0009435] ATP binding [GO:0005524]; nicotinate-nucleotide adenylyltransferase activity [GO:0004515] LACAANPLFVPDLR 0.93233 0 0 0 0 0 0 14.7596 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VTQ4 A0A2P1VTQ4_PLESH Uncharacterized protein C7R88_15685 Plesiomonas shigelloides (Aeromonas shigelloides) MDPLDLAVGYIKYVCYR 0.94086 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.8423 0 0 0 12.5196 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.2957 14.4342 14.3762 0 A0A2P1VTT2 A0A2P1VTT2_PLESH Arginine ABC transporter permease ArtQ C7R88_15615 Plesiomonas shigelloides (Aeromonas shigelloides) nitrogen compound transport [GO:0071705] ATP-binding cassette (ABC) transporter complex [GO:0043190] ATP-binding cassette (ABC) transporter complex [GO:0043190]; transmembrane transporter activity [GO:0022857]; nitrogen compound transport [GO:0071705] transmembrane transporter activity [GO:0022857] FVSWPVSTLVTVLR 0.92373 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.4781 0 0 12.9506 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1309 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4119 13.4398 0 0 0 0 0 0 0 0 0 0 A0A2P1VTT4 A0A2P1VTT4_PLESH Anthranilate synthase component II C7R88_00990 Plesiomonas shigelloides (Aeromonas shigelloides) cellular biosynthetic process [GO:0044249]; organonitrogen compound biosynthetic process [GO:1901566] cellular biosynthetic process [GO:0044249]; organonitrogen compound biosynthetic process [GO:1901566] HISAQLR 0.83117 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.867 0 0 0 13.1336 13.7805 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7984 0 0 12.2488 12.3197 13.8197 12.9213 0 0 0 A0A2P1VTX2 A0A2P1VTX2_PLESH Amino acid carrier protein (Sodium:alanine symporter family protein) C7R88_03975 GBN28_16455 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; alanine:sodium symporter activity [GO:0015655] alanine:sodium symporter activity [GO:0015655] CVTYLFGTKGIR 0.94542 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.1181 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6687 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VTY5 A0A2P1VTY5_PLESH Uncharacterized protein C7R88_04660 Plesiomonas shigelloides (Aeromonas shigelloides) "hydrolase activity, acting on ester bonds [GO:0016788]" "hydrolase activity, acting on ester bonds [GO:0016788]" DGENKSIALYGNSYTHYNNHLNTR 0.94846 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0162 0 0 0 0 0 15.8085 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.575 0 0 A0A2P1VU69 A0A2P1VU69_PLESH Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) thiE C7R88_10960 Plesiomonas shigelloides (Aeromonas shigelloides) thiamine biosynthetic process [GO:0009228]; thiamine diphosphate biosynthetic process [GO:0009229] magnesium ion binding [GO:0000287]; thiamine-phosphate diphosphorylase activity [GO:0004789]; thiamine biosynthetic process [GO:0009228]; thiamine diphosphate biosynthetic process [GO:0009229] magnesium ion binding [GO:0000287]; thiamine-phosphate diphosphorylase activity [GO:0004789] LLALGGR 0.83696 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5214 13.5162 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3446 15.5955 0 0 0 0 0 0 0 0 0 14.3798 0 14.4189 12.9329 14.6085 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4036 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VU80 A0A2P1VU80_PLESH Pilus assembly protein TapA C7R88_08725 Plesiomonas shigelloides (Aeromonas shigelloides) cell adhesion [GO:0007155] integral component of membrane [GO:0016021]; pilus [GO:0009289] integral component of membrane [GO:0016021]; pilus [GO:0009289]; cell adhesion [GO:0007155] GDLTSCATTLAAGK 0.94568 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.06 0 0 0 0 0 0 0 0 0 0 0 0 13.1977 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VU84 A0A2P1VU84_PLESH Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) fkpB C7R88_13380 GBN28_07390 Plesiomonas shigelloides (Aeromonas shigelloides) peptidyl-prolyl cis-trans isomerase activity [GO:0003755] peptidyl-prolyl cis-trans isomerase activity [GO:0003755] RFTLQPEEAFGLPSPDNVYHFER 0.9447 0 0 0 0 0 0 0 12.5682 0 0 0 0 0 0 0 0 0 0 0 0 12.5954 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.6527 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VU97 A0A2P1VU97_PLESH Cytochrome c5 family protein C7R88_10225 Plesiomonas shigelloides (Aeromonas shigelloides) electron transfer activity [GO:0009055]; heme binding [GO:0020037]; iron ion binding [GO:0005506] electron transfer activity [GO:0009055]; heme binding [GO:0020037]; iron ion binding [GO:0005506] FRDAAQWAPRLK 0.94584 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.2949 0 0 0 0 0 0 0 13.2463 13.1623 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8394 0 0 0 0 0 0 0 14.6671 0 0 0 0 0 0 0 0 0 0 0 0 13.248 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9506 13.9135 14.2269 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.4224 0 15.3115 0 0 0 A0A2P1VUD2 A0A2P1VUD2_PLESH MFS transporter C7R88_06820 Plesiomonas shigelloides (Aeromonas shigelloides) cell periphery [GO:0071944]; integral component of membrane [GO:0016021] cell periphery [GO:0071944]; integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] DFAETLR 0.93802 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.9452 11.9738 0 0 0 11.3334 13.319 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VUD4 A0A2P1VUD4_PLESH Uncharacterized protein C7R88_15915 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] NDLAVRNSDMLSR 0.94521 0 0 0 0 0 0 13.6656 0 0 0 0 0 0 0 0 0 0 0 12.4265 14.545 0 0 0 0 0 0 0 10.8242 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VUF2 A0A2P1VUF2_PLESH Uncharacterized protein C7R88_15910 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] AKVSHLGAYFTNGDGEVNIYK 0.9368 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.1165 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.6301 0 17.4589 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VUF5 A0A2P1VUF5_PLESH ADP-ribosylglycohydrolase family protein C7R88_16015 Plesiomonas shigelloides (Aeromonas shigelloides) cellular protein modification process [GO:0006464] hydrolase activity [GO:0016787]; cellular protein modification process [GO:0006464] hydrolase activity [GO:0016787] AIDGADWATICR 0.93561 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8697 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VUH2 A0A2P1VUH2_PLESH GNAT family N-acetyltransferase C7R88_15950 Plesiomonas shigelloides (Aeromonas shigelloides) N-acetyltransferase activity [GO:0008080] N-acetyltransferase activity [GO:0008080] ELIRQTFHCLQPGCKVILLAAPQAVDYYPK 0.94898 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5063 0 14.2581 0 0 0 0 0 0 A0A2P1VUJ1 A0A2P1VUJ1_PLESH t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE (tRNA threonylcarbamoyladenosine biosynthesis protein TsaE) C7R88_12400 Plesiomonas shigelloides (Aeromonas shigelloides) tRNA threonylcarbamoyladenosine modification [GO:0002949] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; transferase activity [GO:0016740]; tRNA threonylcarbamoyladenosine modification [GO:0002949] transferase activity [GO:0016740] GFLQVLGHAGNVK 0.94151 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1038 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0449 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VUJ6 A0A2P1VUJ6_PLESH Phosphonoacetaldehyde hydrolase (Phosphonatase) (EC 3.11.1.1) (Phosphonoacetaldehyde phosphonohydrolase) phnX C7R88_15815 Plesiomonas shigelloides (Aeromonas shigelloides) organic phosphonate catabolic process [GO:0019700] magnesium ion binding [GO:0000287]; phosphonoacetaldehyde hydrolase activity [GO:0050194]; organic phosphonate catabolic process [GO:0019700] magnesium ion binding [GO:0000287]; phosphonoacetaldehyde hydrolase activity [GO:0050194] AFDFPVSLAEAR 0.93856 0 0 0 0 0 0 0 0 0 0 0 0 12.5763 0 0 14.3776 0 14.029 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5141 0 11.2196 14.0951 0 0 13.4619 0 0 0 0 0 14.3957 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5867 13.2262 0 0 0 0 0 12.2235 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.6721 13.3592 14.3022 0 0 0 0 0 0 0 0 0 0 0 12.8905 14.6006 A0A2P1VUK0 A0A2P1VUK0_PLESH Uncharacterized protein C7R88_16230 Plesiomonas shigelloides (Aeromonas shigelloides) EYALAHPESGQILSIID 0.94154 0 0 0 16.1371 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6764 0 12.9526 0 0 0 0 0 0 14.6516 0 0 0 0 0 0 0 0 0 13.7858 0 0 0 0 0 0 18.6341 0 0 0 0 0 0 0 0 0 0 15.0667 14.9555 15.6958 0 0 12.6683 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VUK6 A0A2P1VUK6_PLESH Integrase C7R88_16095 Plesiomonas shigelloides (Aeromonas shigelloides) DNA integration [GO:0015074]; DNA recombination [GO:0006310]; establishment of integrated proviral latency [GO:0075713]; viral entry into host cell [GO:0046718]; viral genome integration into host DNA [GO:0044826] DNA binding [GO:0003677]; DNA integration [GO:0015074]; DNA recombination [GO:0006310]; establishment of integrated proviral latency [GO:0075713]; viral entry into host cell [GO:0046718]; viral genome integration into host DNA [GO:0044826] DNA binding [GO:0003677] ALTDIKIKTAK 0.9443 0 0 0 11.3191 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6177 0 11.1572 0 0 0 10.9359 0 10.3901 0 0 13.1044 0 0 0 0 0 0 0 0 11.5967 0 11.7405 0 0 15.077 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8837 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.215 0 13.921 15.9882 A0A2P1VUK7 A0A2P1VUK7_PLESH Helicase ATP-binding domain-containing protein C7R88_16145 Plesiomonas shigelloides (Aeromonas shigelloides) "ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent activity, acting on DNA [GO:0008094]; nucleic acid binding [GO:0003676]" "ATP binding [GO:0005524]; ATP-dependent activity, acting on DNA [GO:0008094]; ATP hydrolysis activity [GO:0016887]; nucleic acid binding [GO:0003676]" FDSYATVATNEFYYPLK 0.94463 0 0 0 0 0 0 0 13.6345 14.6072 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.2063 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.2137 0 0 0 0 0 0 A0A2P1VUL0 A0A2P1VUL0_PLESH Biosynthetic arginine decarboxylase (ADC) (EC 4.1.1.19) speA C7R88_13810 Plesiomonas shigelloides (Aeromonas shigelloides) arginine catabolic process [GO:0006527]; putrescine biosynthetic process [GO:0009446]; spermidine biosynthetic process [GO:0008295] arginine decarboxylase activity [GO:0008792]; metal ion binding [GO:0046872]; arginine catabolic process [GO:0006527]; putrescine biosynthetic process [GO:0009446]; spermidine biosynthetic process [GO:0008295] arginine decarboxylase activity [GO:0008792]; metal ion binding [GO:0046872] DFGYENNYMLVYPIK 0.88889 0 0 11.9989 13.2222 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2555 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9516 0 0 0 0 0 14.2165 0 0 0 0 0 0 15.2968 12.5482 0 0 14.8667 0 0 0 15.111 0 0 0 0 0 0 0 0 0 0 0 10.8121 0 0 0 0 0 0 15.3542 15.0822 0 0 0 10.1392 0 0 0 0 15.2694 0 0 0 0 0 0 0 0 0 0 0 14.338 13.8007 0 0 15.5799 A0A2P1VUM9 A0A2P1VUM9_PLESH Uncharacterized protein C7R88_16390 Plesiomonas shigelloides (Aeromonas shigelloides) DMLVGAAAIGAAGALGYYAGHHKK 0.94515 0 0 0 13.9325 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4826 0 0 0 15.4096 0 0 0 12.0991 13.0966 0 0 0 0 0 0 0 0 11.2445 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8387 0 0 0 0 0 0 0 0 0 0 A0A2P1VUN0 A0A2P1VUN0_PLESH DUF805 domain-containing protein C7R88_16395 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] NYYITALNNYINFK 0.94538 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.3358 0 0 0 0 0 0 14.1817 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4676 0 0 14.5734 13.2636 0 15.8449 0 0 0 0 0 0 0 0 0 A0A2P1VUP6 A0A2P1VUP6_PLESH Uncharacterized protein C7R88_16385 Plesiomonas shigelloides (Aeromonas shigelloides) MPEYCSNYAAR 0.94172 0 0 0 0 0 0 12.4957 13.6775 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VUS9 A0A2P1VUS9_PLESH tRNA-binding protein C7R88_16490 Plesiomonas shigelloides (Aeromonas shigelloides) tRNA binding [GO:0000049] tRNA binding [GO:0000049] GETSECMLLCAETDDESESVLLTPER 0.89583 0 0 0 0 0 0 0 14.4278 14.1326 0 0 0 0 0 0 0 0 13.4423 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VUW5 A0A2P1VUW5_PLESH Phage tail protein C7R88_16910 Plesiomonas shigelloides (Aeromonas shigelloides) HEESRNHPDASLTEK 0.94692 0 0 0 0 0 0 0 0 0 0 0 0 0 11.916 11.0655 0 0 0 0 0 0 11.1171 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1776 10.8977 0 12.0357 11.1351 0 0 0 11.5069 0 12.7727 0 0 0 0 0 0 11.1863 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2168 0 12.5007 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VUW6 A0A2P1VUW6_PLESH Capsid assembly protein C7R88_16855 Plesiomonas shigelloides (Aeromonas shigelloides) peptidase activity [GO:0008233] peptidase activity [GO:0008233] EQFQAQMDMTR 0.94806 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7849 13.96 14.7767 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7869 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VUY5 A0A2P1VUY5_PLESH Uncharacterized protein C7R88_16880 Plesiomonas shigelloides (Aeromonas shigelloides) AIRMAYHR 0.44828 0 0 0 12.7841 0 0 0 11.8456 14.3669 0 0 0 0 0 0 0 0 0 0 0 12.2405 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5176 0 0 13.8117 0 0 0 0 0 0 12.2244 13.9342 0 0 13.5759 12.3124 0 0 0 14.8164 0 0 0 0 12.3297 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5965 0 0 13.2327 0 0 0 0 11.9215 0 0 0 0 0 0 0 0 0 0 0 0 12.5219 0 0 12.8876 0 0 12.6333 12.2907 0 0 0 0 A0A2P1VV10 A0A2P1VV10_PLESH DEAD/DEAH box helicase C7R88_17075 Plesiomonas shigelloides (Aeromonas shigelloides) "ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent activity, acting on DNA [GO:0008094]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]" "ATP binding [GO:0005524]; ATP-dependent activity, acting on DNA [GO:0008094]; ATP hydrolysis activity [GO:0016887]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]" DEIRDVVR 0.92105 0 0 0 0 0 12.9197 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VV32 A0A2P1VV32_PLESH Uncharacterized protein C7R88_16730 Plesiomonas shigelloides (Aeromonas shigelloides) AFEHAMAQIMQLQQK 0.92857 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3198 0 0 0 0 0 12.4361 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3022 0 0 0 0 A0A2P1VV36 A0A2P1VV36_PLESH Two-component system response regulator C7R88_17210 Plesiomonas shigelloides (Aeromonas shigelloides) "phosphorelay signal transduction system [GO:0000160]; regulation of transcription, DNA-templated [GO:0006355]" "ATP binding [GO:0005524]; sequence-specific DNA binding [GO:0043565]; phosphorelay signal transduction system [GO:0000160]; regulation of transcription, DNA-templated [GO:0006355]" ATP binding [GO:0005524]; sequence-specific DNA binding [GO:0043565] ETPEFIDEYIYK 0.93103 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8069 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VV72 A0A2P1VV72_PLESH MBL fold metallo-hydrolase C7R88_17430 Plesiomonas shigelloides (Aeromonas shigelloides) hydrolase activity [GO:0016787] hydrolase activity [GO:0016787] DYIQNFEHNLTEGK 0.42105 0 0 0 15.3731 0 14.6203 16.3047 0 12.4784 18.1448 13.4861 0 17.1081 0 17.2046 0 0 15.4683 0 0 0 0 0 0 11.9697 0 0 0 0 0 0 10.5201 0 0 0 0 0 0 0 0 0 14.1656 16.2133 16.6625 0 0 0 0 0 12.009 0 0 0 0 0 0 0 0 12.4145 0 0 0 13.5321 0 0 0 0 0 0 0 0 0 0 0 11.8667 0 0 0 0 0 13.4576 0 0 0 11.6067 0 12.6273 0 0 0 14.1626 13.6143 13.6156 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1536 0 13.1977 0 A0A2P1VV75 A0A2P1VV75_PLESH Uncharacterized protein C7R88_17070 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] NFISFREEFAVIR 0.82716 0 0 0 0 0 0 0 12.9242 0 13.4622 12.9383 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7899 0 0 0 0 13.557 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VV90 A0A2P1VV90_PLESH Uncharacterized protein C7R88_17345 GBN28_00210 J2R62_12770 NCTC10363_03271 Plesiomonas shigelloides (Aeromonas shigelloides) IAHQRLKYIEK 0.94372 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.5441 14.9293 0 12.1158 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.8708 0 0 0 0 0 0 13.7364 13.9353 14.4288 14.4474 13.9456 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7656 0 0 0 0 0 14.6172 0 0 0 0 0 12.123 0 15.4353 0 0 0 0 0 0 0 0 0 0 0 13.6367 A0A2P1VVF1 A0A2P1VVF1_PLESH AraC family transcriptional regulator C7R88_16530 Plesiomonas shigelloides (Aeromonas shigelloides) DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565] DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565] DEPWTVASLAQGAGMSR 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4429 0 0 0 0 0 0 14.3132 14.3124 0 15.2586 15.6533 15.5037 0 0 0 0 0 0 0 0 0 12.4549 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A2P1VVG2 A0A2P1VVG2_PLESH Uncharacterized protein C7R88_17820 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] MQQAEEGLLR 0.94327 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.68133 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5229 0 0 0 0 0 0 0 0 0 A0A2P1VVH1 A0A2P1VVH1_PLESH Mobilization protein C7R88_17695 Plesiomonas shigelloides (Aeromonas shigelloides) ILAALIVIR 0.90476 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7497 0 12.5875 0 0 0 0 15.6255 15.0086 15.7253 16.1145 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.64 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.264 0 0 A0A2P1VVH9 A0A2P1VVH9_PLESH Uncharacterized protein C7R88_17690 Plesiomonas shigelloides (Aeromonas shigelloides) WEMKPDK 0.94134 0 0 0 0 0 0 11.5879 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.382 0 0 0 0 0 0 13.3815 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4092 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.3715 0 0 0 0 0 0 0 0 A0A2P1VVI0 A0A2P1VVI0_PLESH OmpA-like domain-containing protein C7R88_17685 Plesiomonas shigelloides (Aeromonas shigelloides) membrane [GO:0016020] membrane [GO:0016020] LYYPYNIATTSR 0.94836 0 0 0 0 0 0 0 0 14.2558 0 0 0 0 0 12.7672 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.89408 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2441 0 0 0 13.2301 0 15.3992 0 0 0 13.6683 0 0 0 0 13.8216 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4623 0 0 0 0 0 0 11.5315 0 0 0 0 0 0 0 0 13.5614 13.0912 17.3382 0 0 0 14.48 0 15.2773 15.6468 0 A0A2P1VVK7 A0A2P1VVK7_PLESH LysR family transcriptional regulator C7R88_17985 Plesiomonas shigelloides (Aeromonas shigelloides) DNA-binding transcription factor activity [GO:0003700] DNA-binding transcription factor activity [GO:0003700] HARGVRLTDAGR 0.94341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.3596 0 0 0 0 0 14.215 12.5197 0 0 0 10.3041 0 0 0 0 0 0 0 0 10.2432 0 0 0 0 0 0 0 0 0 0 0 0 13.0524 0 0 0 0 0 0 0 0 0 0 0 14.8345 0 A0A379CIS0 A0A379CIS0_PLESH Polysaccharide antigen chain regulator wzzB NCTC10363_00106 Plesiomonas shigelloides (Aeromonas shigelloides) lipopolysaccharide biosynthetic process [GO:0009103] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; lipopolysaccharide biosynthetic process [GO:0009103] DNIQAQAYR 0.85556 0 0 0 0 0 0 0 0 0 0 0 13.8177 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.4753 0 0 0 12.1834 0 14.2905 0 0 0 0 0 13.9326 0 0 0 A0A379CIW8 A0A379CIW8_PLESH Spermidine/putrescine import ATP-binding protein PotA (EC 3.6.3.31) potA_1 NCTC10363_00010 Plesiomonas shigelloides (Aeromonas shigelloides) ATP binding [GO:0005524]; hydrolase activity [GO:0016787] ATP binding [GO:0005524]; hydrolase activity [GO:0016787] GFGMVFQNYALFPNLK 0.94568 0 0 0 0 0 0 0 0 0 0 0 15.3397 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.524 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8493 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.5357 A0A379CIX0 A0A379CIX0_PLESH H3 mcpB_3 NCTC10363_00146 Plesiomonas shigelloides (Aeromonas shigelloides) chemotaxis [GO:0006935]; signal transduction [GO:0007165] membrane [GO:0016020] membrane [GO:0016020]; transmembrane signaling receptor activity [GO:0004888]; chemotaxis [GO:0006935]; signal transduction [GO:0007165] transmembrane signaling receptor activity [GO:0004888] MLTGSLAALRSALCDYIDSGK 0.93489 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.2227 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4318 0 0 0 A0A379CJ55 A0A379CJ55_PLESH Cytochrome c oxidase accessory protein CcoG NCTC10363_00080 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; iron-sulfur cluster binding [GO:0051536]; metal ion binding [GO:0046872] iron-sulfur cluster binding [GO:0051536]; metal ion binding [GO:0046872] APRSANK 0.71186 0 0 0 0 14.3255 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4969 0 0 14.1737 14.2021 0 0 0 0 0 0 0 16.623 16.5978 0 13.0528 0 16.6881 16.6257 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.786 14.231 0 10.57 0 0 13.7587 0 13.574 0 0 0 0 0 0 0 0 0 0 0 0 0 15.7663 0 16.3574 0 0 A0A379CJE2 A0A379CJE2_PLESH Flagellar hook-length control protein fliK_1 NCTC10363_00046 Plesiomonas shigelloides (Aeromonas shigelloides) DDIKSAQHADTEAHAHAGAPSK 0.93994 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.2718 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.5651 15.1017 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CJH8 A0A379CJH8_PLESH Stringent starvation protein B sspB NCTC10363_00361 Plesiomonas shigelloides (Aeromonas shigelloides) DGQIVLNIAPR 0.94764 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5606 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CJT8 A0A379CJT8_PLESH H3 mcpB_2 NCTC10363_00144 Plesiomonas shigelloides (Aeromonas shigelloides) chemotaxis [GO:0006935]; signal transduction [GO:0007165] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane signaling receptor activity [GO:0004888]; chemotaxis [GO:0006935]; signal transduction [GO:0007165] transmembrane signaling receptor activity [GO:0004888] GDLQRGALCNFLDAGK 0.94615 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1507 0 11.7689 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CK60 A0A379CK60_PLESH Uncharacterized protein NCTC10363_00450 Plesiomonas shigelloides (Aeromonas shigelloides) type II protein secretion system complex [GO:0015627] type II protein secretion system complex [GO:0015627] FEVHNYVSAPDK 0.90083 0 0 0 12.3965 0 0 0 0 0 0 0 0 0 13.9244 14.6194 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4909 0 13.2151 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7424 0 0 0 A0A379CKB0 A0A379CKB0_PLESH D-alanyl-D-alanine carboxypeptidase NCTC10363_00670 Plesiomonas shigelloides (Aeromonas shigelloides) carboxypeptidase activity [GO:0004180] carboxypeptidase activity [GO:0004180] DFSRQQLIWNSK 0.93939 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8209 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0732 0 0 0 A0A379CKB6 A0A379CKB6_PLESH Penicillin-binding protein activator LpoA (PBP activator LpoA) lpoA NCTC10363_00365 Plesiomonas shigelloides (Aeromonas shigelloides) peptidoglycan biosynthetic process [GO:0009252]; regulation of cell shape [GO:0008360] periplasmic side of cell outer membrane [GO:0031241] periplasmic side of cell outer membrane [GO:0031241]; enzyme regulator activity [GO:0030234]; peptidoglycan biosynthetic process [GO:0009252]; regulation of cell shape [GO:0008360] enzyme regulator activity [GO:0030234] AELDVAK 0.94263 0 0 0 0 13.2693 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0447 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9656 16.8134 0 0 0 0 0 0 0 0 12.9906 13.3663 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.4808 0 0 0 0 0 0 15.8614 0 15.1996 0 0 0 0 0 0 0 0 0 16.2681 0 0 0 0 0 0 A0A379CKK9 A0A379CKK9_PLESH Protein of uncharacterized function (DUF2442) NCTC10363_00781 Plesiomonas shigelloides (Aeromonas shigelloides) AAIYGFTE 0.94652 0 0 0 0 0 0 14.0758 15.4447 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5631 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.798 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0282 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CKL0 A0A379CKL0_PLESH 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.180) fabH_1 NCTC10363_00683 Plesiomonas shigelloides (Aeromonas shigelloides) fatty acid biosynthetic process [GO:0006633] 3-oxoacyl-[acyl-carrier-protein] synthase activity [GO:0004315]; beta-ketoacyl-acyl-carrier-protein synthase III activity [GO:0033818]; fatty acid biosynthetic process [GO:0006633] 3-oxoacyl-[acyl-carrier-protein] synthase activity [GO:0004315]; beta-ketoacyl-acyl-carrier-protein synthase III activity [GO:0033818] ALVINPEICSGHVNFCDR 0.94659 0 0 0 0 0 0 0 14.1819 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.5734 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CKR1 A0A379CKR1_PLESH Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) coaE NCTC10363_00391 Plesiomonas shigelloides (Aeromonas shigelloides) coenzyme A biosynthetic process [GO:0015937] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; ATP binding [GO:0005524]; dephospho-CoA kinase activity [GO:0004140]; coenzyme A biosynthetic process [GO:0015937] ATP binding [GO:0005524]; dephospho-CoA kinase activity [GO:0004140] AALRARIFAEPEEK 0.9474 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.0498 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CKU4 A0A379CKU4_PLESH Hypoxic response protein 1 NCTC10363_00861 Plesiomonas shigelloides (Aeromonas shigelloides) [protein-PII] uridylyltransferase activity [GO:0008773] [protein-PII] uridylyltransferase activity [GO:0008773] AVELMMQHNVR 0.87671 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7256 0 0 11.8372 0 0 0 0 0 0 13.4057 0 0 0 0 0 0 0 0 0 0 0 14.4314 0 0 0 0 0 0 0 0 0 11.3645 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5922 0 12.1327 0 0 0 0 13.3015 0 0 0 0 0 0 0 0 0 16.732 12.1836 0 15.5972 A0A379CKV5 A0A379CKV5_PLESH Dihydrofolate synthase/folylpolyglutamate synthase folC NCTC10363_00910 Plesiomonas shigelloides (Aeromonas shigelloides) folic acid biosynthetic process [GO:0046656]; tetrahydrofolate biosynthetic process [GO:0046654] ATP binding [GO:0005524]; dihydrofolate synthase activity [GO:0008841]; metal ion binding [GO:0046872]; tetrahydrofolylpolyglutamate synthase activity [GO:0004326]; folic acid biosynthetic process [GO:0046656]; tetrahydrofolate biosynthetic process [GO:0046654] ATP binding [GO:0005524]; dihydrofolate synthase activity [GO:0008841]; metal ion binding [GO:0046872]; tetrahydrofolylpolyglutamate synthase activity [GO:0004326] LQEQPKTGR 0.94025 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0895 0 0 0 0 0 0 12.6776 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CKW5 A0A379CKW5_PLESH Spermidine/putrescine transport system permease protein PotB potB_1 NCTC10363_00009 Plesiomonas shigelloides (Aeromonas shigelloides) transmembrane transport [GO:0055085] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transport [GO:0055085] MPAITSRSHLSVTAR 0.94483 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.8173 18.0349 18.1348 17.8974 18.8127 18.3173 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.222 0 17.4564 19.0683 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.2633 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 19.4238 0 18.879 0 A0A379CL01 A0A379CL01_PLESH Nuclease sbcCD subunit C sbcC NCTC10363_00634 Plesiomonas shigelloides (Aeromonas shigelloides) AEQSWTQIEPKLK 0.94846 0 0 0 10.8756 0 0 13.0401 0 0 0 0 0 0 0 15.6048 15.9809 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7342 0 0 0 0 0 0 0 0 0 0 0 0 15.2202 14.8616 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.947 0 0 0 0 15.9716 15.3174 10.1997 15.6165 0 0 0 0 0 0 0 0 0 12.8563 0 0 0 0 0 0 0 11.6562 0 0 0 0 0 0 0 0 0 0 0 0 0 17.2372 0 0 A0A379CL92 A0A379CL92_PLESH General secretion pathway protein H (Type II secretion system protein H) epsH NCTC10363_00753 Plesiomonas shigelloides (Aeromonas shigelloides) protein secretion by the type II secretion system [GO:0015628] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; type II protein secretion system complex [GO:0015627] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; type II protein secretion system complex [GO:0015627]; protein secretion by the type II secretion system [GO:0015628] AQVTLPPQVRSQLELAALPSVR 0.94279 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8525 0 13.4903 0 0 13.0074 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.3795 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1235 14.5935 0 0 0 0 0 0 0 0 A0A379CLD5 A0A379CLD5_PLESH Leu/Ile/Val/Thr-binding protein livJ NCTC10363_00172 Plesiomonas shigelloides (Aeromonas shigelloides) amino acid transport [GO:0006865] amino acid transport [GO:0006865] ALRSAPVNTVMGPLTWDEKGDLK 0.90526 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.9296 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8288 0 0 11.241 0 0 0 11.2357 0 0 0 10.78 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8911 0 0 A0A379CLE5 A0A379CLE5_PLESH Flagellin fliC_1 NCTC10363_00824 Plesiomonas shigelloides (Aeromonas shigelloides) bacterial-type flagellum [GO:0009288]; extracellular region [GO:0005576] bacterial-type flagellum [GO:0009288]; extracellular region [GO:0005576]; structural molecule activity [GO:0005198] structural molecule activity [GO:0005198] DAAGAGASAKMASLSMANIDMSTQSGSNK 0.93918 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9141 0 13.7739 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3399 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CLF9 A0A379CLF9_PLESH Methyltransferase (EC 2.1.1.-) dpnA NCTC10363_01109 Plesiomonas shigelloides (Aeromonas shigelloides) DNA methylation [GO:0006306] DNA binding [GO:0003677]; N-methyltransferase activity [GO:0008170]; DNA methylation [GO:0006306] DNA binding [GO:0003677]; N-methyltransferase activity [GO:0008170] AAELRRSDTLQQPHNELTR 0.94741 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.861 0 0 0 0 0 0 0 0 0 0 0 14.8359 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CLH2 A0A379CLH2_PLESH Phosphatase yihX (EC 3.1.3.-) yihX_1 NCTC10363_00212 Plesiomonas shigelloides (Aeromonas shigelloides) hydrolase activity [GO:0016787]; metal ion binding [GO:0046872] hydrolase activity [GO:0016787]; metal ion binding [GO:0046872] AIPLEQARALIR 0.94828 0 0 0 0 0 0 0 0 17.5431 17.1331 17.3224 17.3625 0 0 17.43 0 0 0 17.2716 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3801 17.8565 15.1088 16.7918 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3169 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8496 0 0 0 0 0 0 0 15.1524 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CLN4 A0A379CLN4_PLESH Uncharacterized protein NCTC10363_00527 Plesiomonas shigelloides (Aeromonas shigelloides) LTGLVSNLTR 0.94206 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0835 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.8711 0 0 0 A0A379CLR3 A0A379CLR3_PLESH "Phage portal protein, lambda family" NCTC10363_01118 Plesiomonas shigelloides (Aeromonas shigelloides) virion assembly [GO:0019068] structural molecule activity [GO:0005198]; virion assembly [GO:0019068] structural molecule activity [GO:0005198] ARFSFQEARCSWAK 0.94648 0 0 0 0 0 0 0 0 15.5633 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CLR4 A0A379CLR4_PLESH Uncharacterized protein NCTC10363_01095 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] AACTKMHNCFRTTHDFLFR 0.81538 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3184 13.2661 0 13.7954 0 0 0 0 0 0 0 0 0 0 15.8784 0 0 0 14.4589 0 0 A0A379CLY7 A0A379CLY7_PLESH 7-carboxy-7-deazaguanine synthase (CDG synthase) (EC 4.3.99.3) (Queuosine biosynthesis protein QueE) queE NCTC10363_01295 Plesiomonas shigelloides (Aeromonas shigelloides) queuosine biosynthetic process [GO:0008616] "4 iron, 4 sulfur cluster binding [GO:0051539]; carbon-nitrogen lyase activity [GO:0016840]; magnesium ion binding [GO:0000287]; S-adenosyl-L-methionine binding [GO:1904047]; queuosine biosynthetic process [GO:0008616]" "4 iron, 4 sulfur cluster binding [GO:0051539]; carbon-nitrogen lyase activity [GO:0016840]; magnesium ion binding [GO:0000287]; S-adenosyl-L-methionine binding [GO:1904047]" EQSLGADVASAHSK 0.44118 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4384 0 A0A379CM00 A0A379CM00_PLESH Cellobiose phosphorylase NCTC10363_00666 Plesiomonas shigelloides (Aeromonas shigelloides) carbohydrate metabolic process [GO:0005975] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; carbohydrate binding [GO:0030246]; glycosyltransferase activity [GO:0016757]; carbohydrate metabolic process [GO:0005975] carbohydrate binding [GO:0030246]; glycosyltransferase activity [GO:0016757] AFGVPGLGLKR 0.94466 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6924 0 0 0 0 0 0 0 0 A0A379CM43 A0A379CM43_PLESH Uncharacterized protein NCTC10363_01091 Plesiomonas shigelloides (Aeromonas shigelloides) ENDTSPHTLRISDK 0.94056 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0466 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6609 0 0 13.3332 10.4175 0 0 0 13.7388 0 0 0 0 0 0 0 11.6124 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7761 0 0 0 0 0 0 11.5139 12.9452 0 0 0 0 0 0 0 0 0 0 0 12.8419 0 0 0 0 A0A379CM57 A0A379CM57_PLESH Uncharacterized protein NCTC10363_01256 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] DALLNGHLRCSK 0.94268 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5728 13.0724 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2038 0 0 0 0 13.4876 0 13.043 0 0 0 0 0 0 0 A0A379CM70 A0A379CM70_PLESH Uncharacterized protein NCTC10363_01264 Plesiomonas shigelloides (Aeromonas shigelloides) AAFTRLFQEPILK 0.94979 0 0 0 12.3152 14.4272 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6585 0 0 11.9708 0 14.441 0 0 15.8165 16.2497 0 0 0 13.7803 0 14.3786 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6325 14.3063 0 0 0 0 0 13.5645 12.5648 13.8648 0 0 0 0 0 0 0 0 0 0 0 17.5736 16.3531 0 16.2581 0 0 A0A379CM91 A0A379CM91_PLESH Arginine/agmatine antiporter adiC_2 NCTC10363_01271 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] DGIFPAFFAETNK 0.94381 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3971 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CMC8 A0A379CMC8_PLESH 2Fe-2S ferredoxin YfaE ycbX NCTC10363_01311 Plesiomonas shigelloides (Aeromonas shigelloides) "2 iron, 2 sulfur cluster binding [GO:0051537]; catalytic activity [GO:0003824]; molybdenum ion binding [GO:0030151]; pyridoxal phosphate binding [GO:0030170]" "2 iron, 2 sulfur cluster binding [GO:0051537]; catalytic activity [GO:0003824]; molybdenum ion binding [GO:0030151]; pyridoxal phosphate binding [GO:0030170]" ALCLRWTGFHSER 0.9378 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4062 0 A0A379CMD1 A0A379CMD1_PLESH DNA translocase FtsK ftsK NCTC10363_01324 Plesiomonas shigelloides (Aeromonas shigelloides) chromosome segregation [GO:0007059] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; chromosome segregation [GO:0007059] ATP binding [GO:0005524]; DNA binding [GO:0003677] AARISNLSR 0.93868 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2037 0 0 0 13.4207 0 0 0 0 0 0 0 0 0 16.3512 0 12.5044 12.0587 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.1246 0 0 0 0 0 0 0 0 0 0 12.1192 0 0 0 0 14.0307 14.5067 14.4103 11.6952 0 0 0 0 0 0 0 A0A379CME7 A0A379CME7_PLESH TraB family NCTC10363_01014 Plesiomonas shigelloides (Aeromonas shigelloides) YALSVVTEQVMKK 0.94239 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 18.4921 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CMF7 A0A379CMF7_PLESH Inner membrane protein yohK yohK NCTC10363_01367 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] IRHPSARGLAMGNASHALGTAR 0.946 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5485 0 0 0 0 A0A379CMG5 A0A379CMG5_PLESH Uncharacterized protein NCTC10363_01476 Plesiomonas shigelloides (Aeromonas shigelloides) MSKHVTSQSTSRQPIIEELK 0.94138 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.181 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CMG8 A0A379CMG8_PLESH Uncharacterized protein NCTC10363_01518 Plesiomonas shigelloides (Aeromonas shigelloides) LIPLSLSVVVLLAVVGLFMMNRK 0.94634 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7684 0 0 0 0 12.6827 0 0 0 0 0 0 0 0 0 0 0 11.1363 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1897 0 0 0 0 0 0 0 0 0 0 0 10.3853 0 0 0 0 0 A0A379CMK1 A0A379CMK1_PLESH Cytochrome c-type biogenesis protein ccmH_1 NCTC10363_01394 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; metal ion binding [GO:0046872] metal ion binding [GO:0046872] MKNASMKK 0.91346 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3159 0 0 0 0 0 13.8782 0 0 13.9444 0 0 0 0 0 0 0 15.4631 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7699 0 0 0 0 0 14.9283 14.1885 14.3604 14.5514 14.3046 14.1846 13.899 0 14.4817 0 14.9933 0 0 0 0 0 14.622 0 0 0 0 A0A379CML1 A0A379CML1_PLESH Uncharacterized protein NCTC10363_01407 Plesiomonas shigelloides (Aeromonas shigelloides) EMMKGDGQKAIR 0.94931 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 19.0417 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.857 17.8415 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.5498 0 0 0 13.7478 15.5699 14.2723 0 0 16.0061 0 0 0 0 16.0462 0 0 0 0 0 19.0915 0 0 0 0 A0A379CML5 A0A379CML5_PLESH Succinylglutamate desuccinylase (EC 3.5.1.96) astE NCTC10363_01569 Plesiomonas shigelloides (Aeromonas shigelloides) arginine catabolic process to glutamate [GO:0019544]; arginine catabolic process to succinate [GO:0019545] "hydrolase activity, acting on ester bonds [GO:0016788]; succinylglutamate desuccinylase activity [GO:0009017]; zinc ion binding [GO:0008270]; arginine catabolic process to glutamate [GO:0019544]; arginine catabolic process to succinate [GO:0019545]" "hydrolase activity, acting on ester bonds [GO:0016788]; succinylglutamate desuccinylase activity [GO:0009017]; zinc ion binding [GO:0008270]" AAKLEAYVDRFFR 0.94221 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2875 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.582 12.4655 13.8393 0 0 0 0 0 0 0 14.3626 14.218 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.93596 0 0 0 13.0442 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.762 A0A379CMQ8 A0A379CMQ8_PLESH Acetyltransferase (GNAT) family NCTC10363_01454 Plesiomonas shigelloides (Aeromonas shigelloides) N-acetyltransferase activity [GO:0008080] N-acetyltransferase activity [GO:0008080] DNSRTFVLEDNNDPR 0.94868 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0151 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3542 0 0 0 0 0 0 0 12.618 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CMR2 A0A379CMR2_PLESH Sensor protein QseC (EC 2.7.13.3) qseC NCTC10363_01623 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; nucleotide binding [GO:0000166]; phosphorelay sensor kinase activity [GO:0000155] nucleotide binding [GO:0000166]; phosphorelay sensor kinase activity [GO:0000155] AWRTFTLADPQQQR 0.94929 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2054 0 12.3585 0 0 0 0 0 0 12.9187 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.8617 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.268 12.784 0 A0A379CMS2 A0A379CMS2_PLESH "RNA-binding protein (Splicing factor, CC1-like family)" J2R62_16745 NCTC10363_01479 Plesiomonas shigelloides (Aeromonas shigelloides) nucleic acid binding [GO:0003676] nucleic acid binding [GO:0003676] KLLVRNLAR 0.9461 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1769 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CMS7 A0A379CMS7_PLESH Malonyl-[acyl-carrier protein] O-methyltransferase (Malonyl-ACP O-methyltransferase) (EC 2.1.1.197) (Biotin synthesis protein BioC) bioC NCTC10363_01633 Plesiomonas shigelloides (Aeromonas shigelloides) biotin biosynthetic process [GO:0009102]; methylation [GO:0032259] carboxyl-O-methyltransferase activity [GO:0010340]; malonyl-CoA methyltransferase activity [GO:0102130]; biotin biosynthetic process [GO:0009102]; methylation [GO:0032259] carboxyl-O-methyltransferase activity [GO:0010340]; malonyl-CoA methyltransferase activity [GO:0102130] AIGANHR 0.94982 11.995 0 0 0 0 0 0 0 0 0 0 13.165 0 0 0 0 9.08868 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5614 0 0 0 0 11.8575 0 16.6889 0 12.2165 0 0 0 0 0 0 0 0 0 13.3351 0 0 0 0 0 0 0 0 0 0 0 15.2565 12.7488 0 0 0 15.0502 13.9961 0 0 0 0 0 0 0 0 A0A379CMT9 A0A379CMT9_PLESH Uncharacterized protein NCTC10363_01494 Plesiomonas shigelloides (Aeromonas shigelloides) KLKQGHFEMGIR 0.93458 0 0 0 0 11.7855 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5626 0 14.4227 0 0 0 0 0 0 15.6209 0 13.6152 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4901 0 0 0 0 0 0 0 0 13.0918 0 0 A0A379CMU3 A0A379CMU3_PLESH Sec-independent protein translocase protein TatA tatA_1 tatA NCTC10363_01653 Plesiomonas shigelloides (Aeromonas shigelloides) protein transport by the Tat complex [GO:0043953] integral component of plasma membrane [GO:0005887]; TAT protein transport complex [GO:0033281] integral component of plasma membrane [GO:0005887]; TAT protein transport complex [GO:0033281]; protein transmembrane transporter activity [GO:0008320]; protein transport by the Tat complex [GO:0043953] protein transmembrane transporter activity [GO:0008320] ALGGQNENSAHMEMPGLNEQK 0.94568 0 0 0 0 0 0 0 0 14.3547 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.682 13.9194 15.0132 0 12.0115 0 0 13.0342 0 12.6817 12.9385 11.0887 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5961 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3538 0 0 15.4931 15.257 13.3754 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CMV2 A0A379CMV2_PLESH Uncharacterized protein J2R62_13650 NCTC10363_01631 Plesiomonas shigelloides (Aeromonas shigelloides) CHLGKSYEEACEVLGLDAGVGHR 0.93683 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.2077 0 0 0 0 0 0 0 0 14.5988 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2059 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2945 0 0 0 0 0 0 A0A379CMW2 A0A379CMW2_PLESH Heat shock protein hslJ hslJ_1 NCTC10363_01519 Plesiomonas shigelloides (Aeromonas shigelloides) WDAMFTQMLQQGATLTWQNQILHLTDGQHTMQFK 0.94626 0 0 0 0 0 0 0 15.1404 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CMY4 A0A379CMY4_PLESH tRNA(Met) cytidine acetyltransferase TmcA (EC 2.3.1.193) tmcA NCTC10363_00667 Plesiomonas shigelloides (Aeromonas shigelloides) tRNA acetylation [GO:0051391]; tRNA wobble cytosine modification [GO:0002101] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; ATP binding [GO:0005524]; tRNA binding [GO:0000049]; tRNA N-acetyltransferase activity [GO:0051392]; tRNA acetylation [GO:0051391]; tRNA wobble cytosine modification [GO:0002101] ATP binding [GO:0005524]; tRNA binding [GO:0000049]; tRNA N-acetyltransferase activity [GO:0051392] DIQLQQMTDELR 0.77778 0 0 0 14.7352 16.0023 16.0299 15.9944 15.4689 14.4492 0 0 0 0 0 0 12.9632 12.7055 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9527 0 0 0 12.9478 0 0 14.3516 14.3644 12.1205 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CMY8 A0A379CMY8_PLESH Probable siderophore transport system permease protein yfhA yfhA NCTC10363_01544 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] MMSDSIAPYRHR 0.94118 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2493 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CN27 A0A379CN27_PLESH Uncharacterized protein NCTC10363_01586 Plesiomonas shigelloides (Aeromonas shigelloides) KERNHIVSAHLSLLLR 0.93636 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2539 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CN40 A0A379CN40_PLESH Uncharacterized protein NCTC10363_01589 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] SAANSASK 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1109 0 0 0 13.4585 0 0 0 0 0 0 0 0 0 0 0 14.0693 0 0 0 0 12.1795 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5601 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CN41 A0A379CN41_PLESH Uncharacterized protein GBN28_11290 NCTC10363_01614 Plesiomonas shigelloides (Aeromonas shigelloides) AAFADLLTHPENVK 0.93743 0 0 0 0 0 0 0 0 0 0 16.4881 0 0 0 0 0 0 0 0 15.7787 18.2676 11.9291 15.6812 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4328 16.651 0 0 18.1852 19.8402 16.7569 17.3388 17.4591 17.3314 0 14.3762 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4342 18.3681 17.4934 0 0 0 0 0 0 0 0 0 16.6673 0 0 16.8327 15.9095 17.2521 0 0 17.5108 20.4245 0 16.9427 15.3072 0 14.9862 A0A379CN45 A0A379CN45_PLESH Hca operon transcriptional activator hcaR NCTC10363_00746 Plesiomonas shigelloides (Aeromonas shigelloides) DNA-binding transcription factor activity [GO:0003700] DNA-binding transcription factor activity [GO:0003700] GRHGAELTGVGR 0.94469 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2587 11.9982 12.8809 0 13.2247 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9472 0 0 13.2123 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.559 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8026 0 0 0 0 0 0 0 0 A0A379CN68 A0A379CN68_PLESH tRNA 5-carboxymethoxyuridine methyltransferase (EC 2.1.1.-) (cmo5U methyltransferase) smtA cmoM NCTC10363_01272 Plesiomonas shigelloides (Aeromonas shigelloides) tRNA 5-carboxymethoxyuridine methyltransferase activity [GO:0097697] tRNA 5-carboxymethoxyuridine methyltransferase activity [GO:0097697] DKSQQETK 0.94567 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.3821 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CN76 A0A379CN76_PLESH Uncharacterized protein NCTC10363_01644 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] AVLTISPILIAQSLALMSLSLMSLALTNLAR 0.94433 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.3644 0 0 0 0 0 0 0 0 0 0 10.7231 0 12.4652 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2799 0 0 0 0 0 0 0 A0A379CN79 A0A379CN79_PLESH Uncharacterized protein NCTC10363_01761 Plesiomonas shigelloides (Aeromonas shigelloides) DNAYKTYRQR 0.94275 0 0 0 0 0 13.5605 0 13.1942 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.1262 0 0 14.4783 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6575 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.8732 0 0 0 0 0 0 0 0 0 0 14.7368 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CNA2 A0A379CNA2_PLESH Uncharacterized protein NCTC10363_01490 Plesiomonas shigelloides (Aeromonas shigelloides) CANFMPISNHFARKR 0.94411 0 0 0 0 0 0 14.1445 13.9075 14.0865 0 0 11.6007 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4547 0 14.1269 0 0 0 0 0 0 11.7925 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6735 12.174 0 10.6068 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.7135 A0A379CNB8 A0A379CNB8_PLESH Alanine dehydrogenase (EC 1.4.1.1) ald NCTC10363_01322 Plesiomonas shigelloides (Aeromonas shigelloides) L-alanine catabolic process [GO:0042853] alanine dehydrogenase activity [GO:0000286]; nucleotide binding [GO:0000166]; L-alanine catabolic process [GO:0042853] alanine dehydrogenase activity [GO:0000286]; nucleotide binding [GO:0000166] IIGIPKEIKNHEYR 0.94907 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9071 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0415 0 0 0 0 0 0 0 0 17.1757 12.4554 12.1221 0 0 0 0 0 12.7541 0 0 0 A0A379CNC4 A0A379CNC4_PLESH Probable diguanylate cyclase YdaM (EC 2.7.7.65) ydaM_2 NCTC10363_01694 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; diguanylate cyclase activity [GO:0052621] diguanylate cyclase activity [GO:0052621] FHRYGNPFSLVYIDLDNFK 0.94327 0 0 0 0 0 13.0815 15.8504 0 0 14.0709 13.461 0 0 0 15.1098 14.3058 0 13.846 15.1992 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9235 0 0 0 0 0 0 0 0 0 0 0 0 16.8781 0 0 0 0 0 0 0 0 A0A379CNI9 A0A379CNI9_PLESH Cytochrome c-type biogenesis protein CcmH ccmH_2 NCTC10363_01395 Plesiomonas shigelloides (Aeromonas shigelloides) cytochrome complex assembly [GO:0017004] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; cytochrome complex assembly [GO:0017004] AGITAPALK 0.94292 0 0 0 12.8688 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4991 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CNJ0 A0A379CNJ0_PLESH "Phage tail tape measure protein, TP901 family, core region" NCTC10363_01879 Plesiomonas shigelloides (Aeromonas shigelloides) AAEAAAK 0.94916 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8938 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3417 0 13.1792 13.5886 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CNJ9 A0A379CNJ9_PLESH Phage P2 baseplate assembly protein gpV NCTC10363_01126 NCTC10363_01889 Plesiomonas shigelloides (Aeromonas shigelloides) AIYNSHRHPHGEPMVGAVSHTQ 0.94679 0 0 0 13.1233 13.2589 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0012 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7782 0 A0A379CNK0 A0A379CNK0_PLESH Uncharacterized protein NCTC10363_01405 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] DVAALLSEQSHILNSFTCANNLGTVNYWDFYSKHIDSMK 0.94849 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0069 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9219 0 0 0 0 0 15.6585 0 0 0 0 0 0 0 14.2218 0 0 0 0 0 13.0043 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CNL3 A0A379CNL3_PLESH Molybdate-binding periplasmic protein modA NCTC10363_01349 Plesiomonas shigelloides (Aeromonas shigelloides) molybdate ion transport [GO:0015689] metal ion binding [GO:0046872]; molybdate ion binding [GO:0030973]; molybdate ion transport [GO:0015689] metal ion binding [GO:0046872]; molybdate ion binding [GO:0030973] AFADFLRSDAAR 0.94621 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2232 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0614 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CNQ9 A0A379CNQ9_PLESH Uncharacterized protein NCTC10363_01814 Plesiomonas shigelloides (Aeromonas shigelloides) GGATIVTLPSNGNAATSTGGTAALSNANSHEPPVR 0.94424 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.2256 16.5275 18.5161 0 0 14.211 A0A379CNS4 A0A379CNS4_PLESH Histidine kinase (EC 2.7.13.3) senX3 NCTC10363_01812 Plesiomonas shigelloides (Aeromonas shigelloides) phosphorelay sensor kinase activity [GO:0000155] phosphorelay sensor kinase activity [GO:0000155] ANTSDDEVVR 0.44444 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0928 14.6909 0 0 14.8348 15.2467 16.0655 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.1506 0 15.1139 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CNW8 A0A379CNW8_PLESH Uncharacterized protein NCTC10363_01471 Plesiomonas shigelloides (Aeromonas shigelloides) KRATLCPLAK 0.9187 0 0 0 0 0 0 0 0 0 0 0 0 15.9325 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.2672 0 0 0 0 0 0 0 A0A379CP74 A0A379CP74_PLESH Protein of uncharacterized function (DUF2514) NCTC10363_01114 Plesiomonas shigelloides (Aeromonas shigelloides) AADIAGGLRTRIAQLR 0.92053 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0116 0 0 0 11.2383 0 0 0 0 0 0 0 0 0 0 0 0 13.0542 0 0 0 0 0 0 0 0 0 13.5278 0 0 0 14.1017 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5166 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CPB0 A0A379CPB0_PLESH NADH dehydrogenase I subunit E (NADH-quinone oxidoreductase subunit E) (NDH-1 subunit E) nuoE NCTC10363_02048 Plesiomonas shigelloides (Aeromonas shigelloides) "2 iron, 2 sulfur cluster binding [GO:0051537]; metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]" "2 iron, 2 sulfur cluster binding [GO:0051537]; metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]" AEIQHEMSHYEDPR 0.93137 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.7517 0 0 0 0 0 0 0 0 0 0 0 13.013 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.0137 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CPD8 A0A379CPD8_PLESH Maltose O-acetyltransferase (EC 2.3.1.79) maa_1 NCTC10363_02084 Plesiomonas shigelloides (Aeromonas shigelloides) maltose O-acetyltransferase activity [GO:0008925] maltose O-acetyltransferase activity [GO:0008925] MKNDWEK 0.90833 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7017 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.8389 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.578 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7705 0 0 0 0 A0A379CPH6 A0A379CPH6_PLESH Uncharacterized protein NCTC10363_01730 Plesiomonas shigelloides (Aeromonas shigelloides) EPQVGDMVIECELCD 0.91096 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1651 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CPJ4 A0A379CPJ4_PLESH Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Flavocytochrome MsrQ) yedZ_2 msrQ NCTC10363_02097 Plesiomonas shigelloides (Aeromonas shigelloides) protein repair [GO:0030091] integral component of plasma membrane [GO:0005887] integral component of plasma membrane [GO:0005887]; electron transfer activity [GO:0009055]; FMN binding [GO:0010181]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; protein repair [GO:0030091] electron transfer activity [GO:0009055]; FMN binding [GO:0010181]; heme binding [GO:0020037]; metal ion binding [GO:0046872] ELEHFTGKVAINYIFIIVLIPIISKVIHWPNLFTQLK 0.94819 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6765 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.11 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CPJ7 A0A379CPJ7_PLESH UvrABC system protein C (Protein UvrC) (Excinuclease ABC subunit C) uvrC NCTC10363_01226 Plesiomonas shigelloides (Aeromonas shigelloides) nucleotide-excision repair [GO:0006289]; SOS response [GO:0009432] cytoplasm [GO:0005737]; excinuclease repair complex [GO:0009380] cytoplasm [GO:0005737]; excinuclease repair complex [GO:0009380]; DNA binding [GO:0003677]; excinuclease ABC activity [GO:0009381]; nucleotide-excision repair [GO:0006289]; SOS response [GO:0009432] DNA binding [GO:0003677]; excinuclease ABC activity [GO:0009381] ADYRRYNITGITPGDDYAAMEQVLR 0.93911 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9437 0 0 0 0 0 13.4273 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1051 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CPK2 A0A379CPK2_PLESH Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-) nfsA NCTC10363_02285 Plesiomonas shigelloides (Aeromonas shigelloides) oxidoreductase activity [GO:0016491] oxidoreductase activity [GO:0016491] ESRPFMLDYLHR 0.94938 0 0 0 0 0 0 14.18 17.8321 14.5151 0 0 0 0 12.5331 0 0 0 0 0 0 15.1832 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7162 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3071 13.421 14.5431 0 0 0 0 0 0 0 0 15.1448 14.6516 A0A379CPL1 A0A379CPL1_PLESH Uncharacterized protein NCTC10363_01726 Plesiomonas shigelloides (Aeromonas shigelloides) AALALGK 0.875 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.8322 0 0 13.4063 15.9849 0 0 11.5958 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CPS8 A0A379CPS8_PLESH Uncharacterized protein NCTC10363_01848 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] ARLIQLIVVLIIFLALVAWRTWSFYETR 0.94808 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2738 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4861 0 0 0 0 0 0 0 12.5616 0 0 0 0 0 0 0 0 0 12.8166 0 0 0 0 0 0 11.4812 0 13.8278 0 0 0 0 0 A0A379CQ21 A0A379CQ21_PLESH Esterase ybfF (EC 3.1.-.-) ybfF NCTC10363_02332 Plesiomonas shigelloides (Aeromonas shigelloides) hydrolase activity [GO:0016787] hydrolase activity [GO:0016787] GEHSPYIQDKFR 0.94422 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3273 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CQ26 A0A379CQ26_PLESH Copper resistance protein A copA_2 NCTC10363_01797 Plesiomonas shigelloides (Aeromonas shigelloides) copper ion binding [GO:0005507]; oxidoreductase activity [GO:0016491] copper ion binding [GO:0005507]; oxidoreductase activity [GO:0016491] DANHSALMDTISVPPMAK 0.9456 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2994 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CQ88 A0A379CQ88_PLESH Uncharacterized protein NCTC10363_02560 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] KLTCQEFFTQANPSEYLNKNK 0.94814 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7116 12.6285 12.0916 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7569 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CQA3 A0A379CQA3_PLESH Uncharacterized protein NCTC10363_02019 Plesiomonas shigelloides (Aeromonas shigelloides) AAEQVKTGWDK 0.94963 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1777 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5221 0 12.7125 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9.37265 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CQA6 A0A379CQA6_PLESH Uncharacterized protein NCTC10363_01493 Plesiomonas shigelloides (Aeromonas shigelloides) ILSLLEKK 0.91597 0 0 0 14.942 0 13.1033 0 0 13.3791 13.5245 15.7823 12.3503 14.7589 13.0504 0 0 13.8757 0 0 0 0 12.7471 16.4264 16.5743 17.3042 16.7272 19.5358 19.1247 19.0313 19.0326 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7433 0 16.7301 16.5979 14.2567 15.9645 15.6138 15.9978 16.9819 18.2378 16.8875 16.9643 0 0 0 0 12.1164 16.9748 0 17.4888 17.2985 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.375 16.6014 15.3737 0 0 0 13.3494 12.5349 0 13.6085 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.1341 15.6143 16.759 A0A379CQB1 A0A379CQB1_PLESH Acetyltransferase NCTC10363_01503 Plesiomonas shigelloides (Aeromonas shigelloides) N-acetyltransferase activity [GO:0008080] N-acetyltransferase activity [GO:0008080] QLVQQCLSFAQVQGFTQCYLDTLK 0.94578 0 0 0 0 0 12.1002 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7044 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5146 0 0 0 0 A0A379CQE6 A0A379CQE6_PLESH Uncharacterized protein NCTC10363_02384 Plesiomonas shigelloides (Aeromonas shigelloides) EFGYRIF 0.94027 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9936 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9476 0 0 0 0 14.2434 0 12.7388 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7692 0 0 0 0 0 0 0 0 0 0 0 0 0 11.4835 0 0 0 0 0 0 0 0 0 14.2681 13.196 13.8881 0 0 0 0 15.1705 14.803 0 0 0 0 0 13.1329 A0A379CQH5 A0A379CQH5_PLESH Inner membrane-spanning protein YciB yciB GBN28_12960 J2R62_04730 NCTC10363_02035 Plesiomonas shigelloides (Aeromonas shigelloides) division septum assembly [GO:0000917] integral component of plasma membrane [GO:0005887] integral component of plasma membrane [GO:0005887]; division septum assembly [GO:0000917] HIPQTEQSDNSASNDK 0.94831 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.6157 11.97 0 0 0 0 0 0 0 0 0 12.0135 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2543 0 0 0 0 0 0 0 0 0 0 15.2674 13.6843 13.4226 0 13.2875 0 0 0 13.1063 13.4277 14.034 13.0342 13.5702 0 10.9088 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5313 12.2051 12.8535 12.4821 0 0 14.3325 15.641 16.3139 15.6726 0 0 0 A0A379CQK0 A0A379CQK0_PLESH Long-chain-fatty-acid--CoA ligase FadD15 (EC 6.2.1.3) NCTC10363_01618 Plesiomonas shigelloides (Aeromonas shigelloides) long-chain fatty acid-CoA ligase activity [GO:0004467] long-chain fatty acid-CoA ligase activity [GO:0004467] ATELQANHVRR 0.92958 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0746 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CQM1 A0A379CQM1_PLESH Phage protein D NCTC10363_02577 Plesiomonas shigelloides (Aeromonas shigelloides) MGAEGNVLVLGHTYANKGNAER 0.94067 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.2904 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CQN4 A0A379CQN4_PLESH Bifunctional uridylyltransferase/uridylyl-removing enzyme (UTase/UR) (Bifunctional [protein-PII] modification enzyme) (Bifunctional nitrogen sensor protein) [Includes: [Protein-PII] uridylyltransferase (PII uridylyltransferase) (UTase) (EC 2.7.7.59); [Protein-PII]-UMP uridylyl-removing enzyme (UR) (EC 3.1.4.-)] glnD NCTC10363_02626 Plesiomonas shigelloides (Aeromonas shigelloides) nitrogen compound metabolic process [GO:0006807]; regulation of nitrogen utilization [GO:0006808] "[protein-PII] uridylyltransferase activity [GO:0008773]; guanosine-3',5'-bis(diphosphate) 3'-diphosphatase activity [GO:0008893]; phosphoric diester hydrolase activity [GO:0008081]; nitrogen compound metabolic process [GO:0006807]; regulation of nitrogen utilization [GO:0006808]" "[protein-PII] uridylyltransferase activity [GO:0008773]; guanosine-3',5'-bis(diphosphate) 3'-diphosphatase activity [GO:0008893]; phosphoric diester hydrolase activity [GO:0008081]" DIHDPEVVR 0.86486 0 0 0 12.7678 14.7492 14.916 13.1438 12.8565 13.7894 14.4229 15.1348 14.6337 16.6194 14.9319 14.7374 0 12.3656 12.8739 14.4501 16.2186 14.8799 16.2538 14.0459 16.8018 14.997 15.7498 16.0234 16.3059 17.7469 17.6217 9.92806 0 0 0 0 0 0 0 11.2068 0 0 0 0 10.6959 10.7172 0 0 0 0 0 0 12.768 14.0511 15.8317 15.1544 15.4922 15.5386 17.4571 17.9217 18.73 15.0623 14.9117 15.5875 16.7537 16.4885 15.4945 17.3231 17.8425 17.285 17.0777 16.1839 15.7711 13.2105 12.9495 14.4856 13.8362 0 12.9621 0 13.0571 14.4227 14.8435 13.7973 0 12.5213 12.4327 0 17.0229 16.8267 17.2383 0 0 0 16.8167 16.5183 16.5682 15.8777 13.3483 0 0 0 0 0 0 0 0 0 0 16.4664 17.8054 20.0215 17.3012 16.916 17.1677 A0A379CQV8 A0A379CQV8_PLESH Integrase core domain NCTC10363_02582 Plesiomonas shigelloides (Aeromonas shigelloides) DNA integration [GO:0015074]; transposition [GO:0032196] nucleic acid binding [GO:0003676]; DNA integration [GO:0015074]; transposition [GO:0032196] nucleic acid binding [GO:0003676] DLGESCGINR 0.94578 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1702 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9673 0 0 0 0 A0A379CQW2 A0A379CQW2_PLESH Paraquat-inducible protein B NCTC10363_02080 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] AGSTPLMYQGLK 0.93974 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.5551 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.9063 0 0 0 0 0 16.4326 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.3283 0 16.9157 A0A379CR08 A0A379CR08_PLESH Di-/tripeptide transporter dtpT_2 NCTC10363_02213 Plesiomonas shigelloides (Aeromonas shigelloides) oligopeptide transport [GO:0006857] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; peptide transmembrane transporter activity [GO:1904680]; oligopeptide transport [GO:0006857] peptide transmembrane transporter activity [GO:1904680] ALNTNRKTPLTAEEADR 0.94268 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0845 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CR30 A0A379CR30_PLESH Tfp pilus assembly protein FimT NCTC10363_02562 Plesiomonas shigelloides (Aeromonas shigelloides) electron transport chain [GO:0022900] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; electron transport chain [GO:0022900] ECGLTTPDNAGGQVCG 0.94706 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.914 0 14.5013 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4927 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1157 A0A379CRA2 A0A379CRA2_PLESH tRNA1(Val) (adenine(37)-N6)-methyltransferase (EC 2.1.1.223) (tRNA m6A37 methyltransferase) yfiC NCTC10363_02744 Plesiomonas shigelloides (Aeromonas shigelloides) cytoplasm [GO:0005737] cytoplasm [GO:0005737]; nucleic acid binding [GO:0003676]; tRNA (adenine-N6-)-methyltransferase activity [GO:0016430] nucleic acid binding [GO:0003676]; tRNA (adenine-N6-)-methyltransferase activity [GO:0016430] LCLVLPYSAGLALQSAAEQQGWFCYK 0.93866 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6435 0 0 0 A0A379CRA4 A0A379CRA4_PLESH FeoC like transcriptional regulator NCTC10363_02308 Plesiomonas shigelloides (Aeromonas shigelloides) ELARQLNSSEDGVDAMLQVWMR 0.94539 0 0 0 0 0 0 0 0 0 16.0631 0 0 0 0 0 0 0 0 0 17.2634 16.6237 0 0 0 14.9859 14.4703 0 14.7506 14.8257 15.4409 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.8057 0 0 0 0 0 0 15.0933 0 0 0 0 0 18.7408 18.4588 16.9773 A0A379CRG1 A0A379CRG1_PLESH Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) fkpB NCTC10363_02713 Plesiomonas shigelloides (Aeromonas shigelloides) peptidyl-prolyl cis-trans isomerase activity [GO:0003755] peptidyl-prolyl cis-trans isomerase activity [GO:0003755] RFTLQPEEAFGLPSPDNVYHFGR 0.94673 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8808 0 13.4214 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7377 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CRL0 A0A379CRL0_PLESH Aerobic respiration control sensor protein ArcB (EC 2.7.13.3) arcB_2 NCTC10363_02765 Plesiomonas shigelloides (Aeromonas shigelloides) "regulation of transcription, DNA-templated [GO:0006355]" integral component of membrane [GO:0016021] "integral component of membrane [GO:0016021]; phosphorelay sensor kinase activity [GO:0000155]; regulation of transcription, DNA-templated [GO:0006355]" phosphorelay sensor kinase activity [GO:0000155] AEHARQLAIEDLENEVFER 0.94904 0 0 0 0 13.4774 0 0 0 0 0 0 0 0 0 0 0 0 0 11.6272 0 0 0 0 0 0 11.5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.185 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CRS2 A0A379CRS2_PLESH Endonuclease V (EC 3.1.21.7) nfi_2 NCTC10363_02932 Plesiomonas shigelloides (Aeromonas shigelloides) deoxyribonuclease V activity [GO:0043737] deoxyribonuclease V activity [GO:0043737] MLRSAVANIMVNENQEATPEMK 0.94084 0 0 0 13.7769 0 0 0 0 0 0 0 0 12.6298 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.046 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CRU9 A0A379CRU9_PLESH Predicted ATPase GBN28_08225 NCTC10363_02531 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] DLRLKVALIR 0.9375 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1377 0 0 0 0 0 0 0 A0A379CRX0 A0A379CRX0_PLESH "dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" rffG_2 NCTC10363_03167 Plesiomonas shigelloides (Aeromonas shigelloides) nucleotide-sugar metabolic process [GO:0009225] "dTDP-glucose 4,6-dehydratase activity [GO:0008460]; nucleotide-sugar metabolic process [GO:0009225]" "dTDP-glucose 4,6-dehydratase activity [GO:0008460]" DWLYVEDHAR 0.93899 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9551 12.777 0 14.4748 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.0037 0 0 0 0 0 0 0 11.9749 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CRZ7 A0A379CRZ7_PLESH Ectoine utilization protein EutE NCTC10363_02672 Plesiomonas shigelloides (Aeromonas shigelloides) "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [GO:0016811]; hydrolase activity, acting on ester bonds [GO:0016788]; metal ion binding [GO:0046872]" "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [GO:0016811]; hydrolase activity, acting on ester bonds [GO:0016788]; metal ion binding [GO:0046872]" DFIPSDPDASPVNLNR 0.94518 0 0 0 0 0 0 13.4327 0 0 0 0 0 0 0 0 0 0 12.9461 0 0 0 11.4401 0 0 0 0 14.869 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4087 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CS15 A0A379CS15_PLESH Uncharacterized protein NCTC10363_02153 Plesiomonas shigelloides (Aeromonas shigelloides) MRTIYWLGKK 0.94091 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.25 0 0 0 0 0 0 0 A0A379CS22 A0A379CS22_PLESH Mannosylfructose-phosphate synthase (EC 2.4.1.246) mfpsA NCTC10363_03038 Plesiomonas shigelloides (Aeromonas shigelloides) mannosylfructose-phosphate synthase activity [GO:0103011] mannosylfructose-phosphate synthase activity [GO:0103011] FTRTQACEQYLAC 0.73684 0 0 0 0 14.3637 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CS59 A0A379CS59_PLESH RecBCD enzyme subunit RecC (EC 3.1.11.5) (Exonuclease V subunit RecC) (ExoV subunit RecC) (Helicase/nuclease RecBCD subunit RecC) recC NCTC10363_02554 Plesiomonas shigelloides (Aeromonas shigelloides) double-strand break repair via homologous recombination [GO:0000724] exodeoxyribonuclease V complex [GO:0009338] exodeoxyribonuclease V complex [GO:0009338]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; exodeoxyribonuclease V activity [GO:0008854]; double-strand break repair via homologous recombination [GO:0000724] ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; exodeoxyribonuclease V activity [GO:0008854] AFFRQRLR 0.94348 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.4682 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379CSC3 A0A379CSC3_PLESH Uncharacterized protein NCTC10363_02736 Plesiomonas shigelloides (Aeromonas shigelloides) DNCFRAAYR 0.94826 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1737 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5752 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1071 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.1487 0 0 0 0 0 0 0 9.95958 0 0 0 0 0 0 0 0 13.2751 13.0658 0 0 0 0 0 14.3398 A0A379CSC7 A0A379CSC7_PLESH Uncharacterized protein NCTC10363_03059 Plesiomonas shigelloides (Aeromonas shigelloides) HHKTAMHKK 0.94942 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1053 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.4631 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6349 0 0 0 0 0 0 A0A379CSF3 A0A379CSF3_PLESH 2-iminoacetate synthase (EC 4.1.99.19) thiH NCTC10363_03188 Plesiomonas shigelloides (Aeromonas shigelloides) "2-iminoacetate synthase activity [GO:0036355]; 4 iron, 4 sulfur cluster binding [GO:0051539]; iron ion binding [GO:0005506]" "2-iminoacetate synthase activity [GO:0036355]; 4 iron, 4 sulfur cluster binding [GO:0051539]; iron ion binding [GO:0005506]" DQVLPLGITSMSAESSTQPGGYAEQDAR 0.9439 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2317 14.9736 13.5378 0 13.2264 0 0 0 0 A0A379CSI2 A0A379CSI2_PLESH Epoxyqueuosine reductase (EC 1.1.-.-) queG NCTC10363_02873 Plesiomonas shigelloides (Aeromonas shigelloides) queuosine biosynthetic process [GO:0008616]; tRNA processing [GO:0008033] cytoplasm [GO:0005737] "cytoplasm [GO:0005737]; 4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]; queuosine biosynthetic process [GO:0008616]; tRNA processing [GO:0008033]" "4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]" AIEKGLPR 0.8125 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5659 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0871 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8136 0 14.8272 0 0 0 0 0 A0A379CSS8 A0A379CSS8_PLESH Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) rnpA NCTC10363_03236 Plesiomonas shigelloides (Aeromonas shigelloides) tRNA 5'-leader removal [GO:0001682] ribonuclease P activity [GO:0004526]; tRNA binding [GO:0000049]; tRNA 5'-leader removal [GO:0001682] ribonuclease P activity [GO:0004526]; tRNA binding [GO:0000049] RAHERNR 0.83721 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5392 0 0 0 0 0 A0A379H5L0 A0A379H5L0_PLESH Uncharacterized protein NCTC10363_03305 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] IITAALIHLMV 0.94121 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0383 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7938 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A379H5L6 A0A379H5L6_PLESH GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase (EC 2.4.1.345) pimB_2 NCTC10363_03277 Plesiomonas shigelloides (Aeromonas shigelloides) phosphatidylinositol alpha-mannosyltransferase activity [GO:0043750] phosphatidylinositol alpha-mannosyltransferase activity [GO:0043750] AQFSVQR 0.94585 0 0 0 0 0 14.0843 12.0289 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5595 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7172 0 0 0 0 0 0 0 0 0 12.103 14.1338 14.743 13.8767 15.1556 13.9775 0 0 0 15.292 13.9635 0 0 0 0 0 0 A0A379H5L9 A0A379H5L9_PLESH Probable diguanylate cyclase YcdT (EC 2.7.7.65) ycdT_2 NCTC10363_03369 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; diguanylate cyclase activity [GO:0052621] diguanylate cyclase activity [GO:0052621] DLNVMTWWISGNK 0.94454 0 0 0 13.7518 0 0 0 0 12.4748 0 0 0 0 0 0 0 0 0 0 0 14.4056 0 12.5277 0 14.4771 13.5791 0 0 13.5244 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0421 0 0 0 0 0 0 0 0 0 0 0 13.8399 0 0 0 0 0 13.4093 A0A379H5Q7 A0A379H5Q7_PLESH Beta-galactosidase (Beta-gal) (EC 3.2.1.23) (Lactase) lacZ NCTC10363_03399 Plesiomonas shigelloides (Aeromonas shigelloides) carbohydrate catabolic process [GO:0016052] beta-galactosidase complex [GO:0009341] beta-galactosidase complex [GO:0009341]; beta-galactosidase activity [GO:0004565]; carbohydrate binding [GO:0030246]; magnesium ion binding [GO:0000287]; carbohydrate catabolic process [GO:0016052] beta-galactosidase activity [GO:0004565]; carbohydrate binding [GO:0030246]; magnesium ion binding [GO:0000287] EEDKIYVRIDHQHMGVGGDDSWSPSVHQAFQLTDK 0.94683 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.4218 12.8964 15.0319 0 0 0 0 0 0 0 0 0 13.7107 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.8539 0 0 0 A0A379H7C1 A0A379H7C1_PLESH Lipoprotein-releasing system ATP-binding protein LolD (EC 3.6.3.-) lolD_3 NCTC10363_03374 Plesiomonas shigelloides (Aeromonas shigelloides) ATP binding [GO:0005524]; hydrolase activity [GO:0016787] ATP binding [GO:0005524]; hydrolase activity [GO:0016787] GQGSHTHR 0.94448 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6723 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.7695 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.8054 0 0 0 0 15.1817 0 0 0 A0A481WFT4 A0A481WFT4_PLESH Invasion protein invE Plesiomonas shigelloides (Aeromonas shigelloides) negative regulation of protein secretion [GO:0050709]; protein secretion by the type III secretion system [GO:0030254] cell surface [GO:0009986]; outer membrane [GO:0019867] cell surface [GO:0009986]; outer membrane [GO:0019867]; negative regulation of protein secretion [GO:0050709]; protein secretion by the type III secretion system [GO:0030254] ASDSTPAAEVQR 0.94472 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.3093 14.1695 13.9347 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A4D6U7A6 A0A4D6U7A6_PLESH Flippase wzx Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] LIRLLLGLLVSAWVAR 0.9437 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0269 0 0 0 0 0 0 0 0 0 0 0 0 0 16.1131 0 0 A0A4D6U7B7 A0A4D6U7B7_PLESH Transposase tnp Plesiomonas shigelloides (Aeromonas shigelloides) "transposition, DNA-mediated [GO:0006313]" "DNA binding [GO:0003677]; transposase activity [GO:0004803]; transposition, DNA-mediated [GO:0006313]" DNA binding [GO:0003677]; transposase activity [GO:0004803] AATYFAK 0.94128 0 0 0 0 0 0 14.268 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5456 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A4D6U7C1 A0A4D6U7C1_PLESH DegT/DnrJ/EryC1/StrS aminotransferase family protein pglC Plesiomonas shigelloides (Aeromonas shigelloides) transaminase activity [GO:0008483] transaminase activity [GO:0008483] GFYVIEDCAQAHGAK 0.94339 0 0 0 0 0 0 0 0 0 0 10.5861 0 0 12.8898 11.24 0 0 11.0318 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3865 0 0 12.3901 0 0 0 11.9243 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5937 14.5412 0 14.4581 0 0 0 A0A4D6U7D4 A0A4D6U7D4_PLESH Uncharacterized protein orf11 Plesiomonas shigelloides (Aeromonas shigelloides) MVIQQPSLQGVTVK 0.94964 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0511 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7216 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A4D6U7E9 A0A4D6U7E9_PLESH Putative O antigen flippase wzx Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] EHIRINIVILIFER 0.94647 11.9233 12.0745 12.8749 0 0 0 14.98 0 0 0 0 13.3541 0 0 0 0 0 0 0 0 0 0 0 0 14.7749 0 0 0 0 0 0 0 10.815 11.8999 0 0 0 0 0 0 0 0 0 0 0 12.474 0 0 0 0 12.5654 13.3656 0 0 0 14.4288 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8484 0 0 0 15.2734 14.1056 14.3809 0 0 0 0 0 0 12.7815 14.0164 0 0 12.1784 0 0 14.0442 13.9177 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A4D6U7F1 A0A4D6U7F1_PLESH Uncharacterized protein orf12 Plesiomonas shigelloides (Aeromonas shigelloides) KYNNYYQSIVDNYIK 0.94606 0 0 0 0 0 0 0 0 0 0 12.2424 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6812 0 13.6917 0 A0A4D6U7H9 A0A4D6U7H9_PLESH Uncharacterized protein orf21 Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] IMVLILMWLYLK 0.94646 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0705 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0168 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A4D6U7L9 A0A4D6U7L9_PLESH Vi polysaccharide biosynthesis UDP-N-acetylglucosaminuronic acid C-4 epimerase TviC vipB Plesiomonas shigelloides (Aeromonas shigelloides) catalytic activity [GO:0003824] catalytic activity [GO:0003824] SIGLRYFNVFGR 0.94277 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2492 0 0 0 0 0 0 0 0 14.6359 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8207 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4903 0 0 A0A4D6U7Q0 A0A4D6U7Q0_PLESH Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) rmlA Plesiomonas shigelloides (Aeromonas shigelloides) extracellular polysaccharide biosynthetic process [GO:0045226] glucose-1-phosphate thymidylyltransferase activity [GO:0008879]; metal ion binding [GO:0046872]; extracellular polysaccharide biosynthetic process [GO:0045226] glucose-1-phosphate thymidylyltransferase activity [GO:0008879]; metal ion binding [GO:0046872] IYLEQGNLSVAMMGR 0.92537 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9835 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A4D6U7T2 A0A4D6U7T2_PLESH N-acetyltransferase glmU wbbJ Plesiomonas shigelloides (Aeromonas shigelloides) transferase activity [GO:0016740] transferase activity [GO:0016740] DQYRDTWVKK 0.94606 0 0 0 0 0 0 18.1727 0 17.2236 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A0A4D6U7V6 A0A4D6U7V6_PLESH Cytochrome c5 c5 Plesiomonas shigelloides (Aeromonas shigelloides) electron transfer activity [GO:0009055]; heme binding [GO:0020037]; iron ion binding [GO:0005506] electron transfer activity [GO:0009055]; heme binding [GO:0020037]; iron ion binding [GO:0005506] FRDAAQWAPRLK 0.94073 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.6343 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.019 0 0 12.1695 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0882 11.9716 0 0 0 0 0 0 0 0 0 0 0 0 A0A4D6U7W5 A0A4D6U7W5_PLESH NAD-dependent epimerase/dehydratase wbhp Plesiomonas shigelloides (Aeromonas shigelloides) catalytic activity [GO:0003824] catalytic activity [GO:0003824] AANQVFLVSDDHDVSTSDMVR 0.9475 0 0 0 0 0 0 13.4392 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.0306 0 0 0 0 0 0 0 0 0 12.4594 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1594 0 0 0 0 0 0 0 0 0 0 13.3326 13.1065 0 13.5658 0 0 0 15.2903 0 0 14.0192 0 0 0 14.413 15.1669 15.4942 0 0 0 A0A6I1F248 A0A6I1F248_PLESH Transcription/translation regulatory transformer protein RfaH rfaH Plesiomonas shigelloides (Aeromonas shigelloides) "regulation of transcription, DNA-templated [GO:0006355]" "regulation of transcription, DNA-templated [GO:0006355]" AAQHLELQNIRYFCPMLTVKK 0.94901 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7568 0 0 0 0 0 0 0 10.4846 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4449 0 0 0 0 0 0 0 0 0 0 12.8472 12.0264 0 Q9LB33 Q9LB33_PLESH Chitinase A (EC 3.2.1.14) (Fragment) chiA Plesiomonas shigelloides (Aeromonas shigelloides) carbohydrate metabolic process [GO:0005975] chitinase activity [GO:0004568]; carbohydrate metabolic process [GO:0005975] chitinase activity [GO:0004568] ELREMLDR 0.94685 0 0 0 11.1983 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6371 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.3843 15.6308 0 15.2564 15.563 17.9308 15.1789 15.0076 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.695 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Q9RLF0 Q9RLF0_PLESH Putative mobilization protein mobB Plesiomonas shigelloides (Aeromonas shigelloides) integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] EFESKSKQQAK 0.94916 0 0 0 0 0 0 16.6867 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0452 0 0 0 13.9587 0 0 0 0 0 0 15.0051 0 15.0855 0 0 14.6795 0 13.7232 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.2212 0 13.5384 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 V5TDG9 V5TDG9_PLESH WabB Plesiomonas shigelloides (Aeromonas shigelloides) glycosyltransferase activity [GO:0016757] glycosyltransferase activity [GO:0016757] EIVAHPVDLSTVDLSR 0.94027 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.93 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 W0FYR6 W0FYR6_PLESH WfbD wfbD Plesiomonas shigelloides (Aeromonas shigelloides) fatty acid biosynthetic process [GO:0006633] fatty acid synthase complex [GO:0005835] fatty acid synthase complex [GO:0005835]; fatty acid synthase activity [GO:0004312]; fatty acid biosynthetic process [GO:0006633] fatty acid synthase activity [GO:0004312] LPGPGCVYVSQSFNFK 0.94884 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3408 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5564 15.4502 0 R8ALE7 R8ALE7_PLESH Nucleoside-diphosphate-sugar epimerase PLESHI_17126 Plesiomonas shigelloides 302-73 AVDFDANFAVAIAAR 0.92903 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.0015 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6525 0 R8ALF3 R8ALF3_PLESH Protein UmuC (Fragment) PLESHI_17102 Plesiomonas shigelloides 302-73 DNA repair [GO:0006281]; SOS response [GO:0009432] damaged DNA binding [GO:0003684]; DNA repair [GO:0006281]; SOS response [GO:0009432] damaged DNA binding [GO:0003684] INHSHLGK 0.71739 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6683 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0691 0 0 14.7 R8ALG6 R8ALG6_PLESH Iron-sulfur cluster assembly protein CyaY cyaY PLESHI_17027 Plesiomonas shigelloides 302-73 iron-sulfur cluster assembly [GO:0016226] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; ferric iron binding [GO:0008199]; iron-sulfur cluster assembly [GO:0016226] ferric iron binding [GO:0008199] MNDTEFHQAADAIWLALEEK 0.942 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1887 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2872 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8243 0 0 R8ALH5 R8ALH5_PLESH Uncharacterized protein PLESHI_17082 Plesiomonas shigelloides 302-73 DTADNTFYLYQALLPR 0.9478 0 0 0 0 0 0 15.0705 0 0 0 0 0 0 0 0 0 0 16.3972 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4001 0 0 0 13.3565 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ALJ7 R8ALJ7_PLESH Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) coaD PLESHI_16637 Plesiomonas shigelloides 302-73 coenzyme A biosynthetic process [GO:0015937] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; ATP binding [GO:0005524]; pantetheine-phosphate adenylyltransferase activity [GO:0004595]; coenzyme A biosynthetic process [GO:0015937] ATP binding [GO:0005524]; pantetheine-phosphate adenylyltransferase activity [GO:0004595] GLLVDLAK 0.7 15.0835 14.563 14.6419 12.9066 13.5948 0 0 0 0 0 12.9065 0 0 13.5234 13.2489 0 0 0 13.2193 0 0 0 0 0 0 0 0 0 0 0 13.9515 14.9033 13.6534 14.2074 12.8744 0 0 14.0199 0 0 0 0 0 16.2607 16.0253 16.4458 12.313 18.6944 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.7556 18.1078 0 0 0 0 0 0 0 0 16.8194 15.8155 15.9061 15.1812 0 0 0 15.0605 14.4714 14.5343 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ALN4 R8ALN4_PLESH Guanylate kinase (EC 2.7.4.8) (GMP kinase) gmk PLESHI_16747 Plesiomonas shigelloides 302-73 cytoplasm [GO:0005737] cytoplasm [GO:0005737]; ATP binding [GO:0005524]; guanylate kinase activity [GO:0004385] ATP binding [GO:0005524]; guanylate kinase activity [GO:0004385] HGAMISK 0.83871 0 0 0 13.0831 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.8711 0 0 0 12.2624 0 0 0 0 0 0 0 10.6503 0 0 0 0 0 0 11.6217 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0775 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2672 0 0 R8ALT9 R8ALT9_PLESH "1,4-dihydroxy-2-naphthoate octaprenyltransferase (DHNA-octaprenyltransferase) (EC 2.5.1.74)" menA PLESHI_16422 Plesiomonas shigelloides 302-73 menaquinone biosynthetic process [GO:0009234] integral component of plasma membrane [GO:0005887] "integral component of plasma membrane [GO:0005887]; 1,4-dihydroxy-2-naphthoate octaprenyltransferase activity [GO:0046428]; menaquinone biosynthetic process [GO:0009234]" "1,4-dihydroxy-2-naphthoate octaprenyltransferase activity [GO:0046428]" AMLLVLLLTLLSGGVLILLACQK 0.80723 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.599 0 0 0 0 0 0 0 R8ALU9 R8ALU9_PLESH Met repressor (Met regulon regulatory protein MetJ) metJ PLESHI_16367 Plesiomonas shigelloides 302-73 "methionine biosynthetic process [GO:0009086]; negative regulation of transcription, DNA-templated [GO:0045892]" cytoplasm [GO:0005737] "cytoplasm [GO:0005737]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; methionine biosynthetic process [GO:0009086]; negative regulation of transcription, DNA-templated [GO:0045892]" DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700] AKWNGEYISPYAEHGK 0.94718 0 0 0 0 0 0 0 0 0 0 11.7962 0 0 0 0 0 0 0 0 12.886 12.3443 12.2987 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9763 15.3025 0 13.0681 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.9774 0 0 0 0 0 12.764 0 17.8274 0 12.6912 0 0 0 12.3884 12.5919 12.7375 12.0956 10.8909 0 0 0 0 0 0 11.0676 10.6818 11.43 0 0 0 0 11.6723 0 0 0 0 0 0 0 19.7135 0 0 0 0 0 0 0 13.2152 R8ALV4 R8ALV4_PLESH Phosphoenolpyruvate carboxylase (Fragment) PLESHI_16332 Plesiomonas shigelloides 302-73 carbon fixation [GO:0015977]; tricarboxylic acid cycle [GO:0006099] phosphoenolpyruvate carboxylase activity [GO:0008964]; carbon fixation [GO:0015977]; tricarboxylic acid cycle [GO:0006099] phosphoenolpyruvate carboxylase activity [GO:0008964] AATPKGAG 0.75 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6099 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.684 0 0 0 0 0 0 0 0 R8ALV5 R8ALV5_PLESH tRNA/tmRNA (uracil-C(5))-methyltransferase (EC 2.1.1.35) (tRNA (uracil(54)-C(5))-methyltransferase) (tRNA(m5U54)-methyltransferase) (RUMT) (tmRNA (uracil(341)-C(5))-methyltransferase) trmA PLESHI_16272 Plesiomonas shigelloides 302-73 S-adenosylmethionine-dependent tRNA (m5U54) methyltransferase activity [GO:0030697] S-adenosylmethionine-dependent tRNA (m5U54) methyltransferase activity [GO:0030697] KLDEQWQHDAR 0.9392 0 0 0 0 0 0 15.8889 16.6301 15.5139 0 0 0 0 0 0 14.1472 0 0 0 0 0 0 0 0 15.2503 0 14.3318 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4905 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4648 0 13.5784 15.2035 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.1187 0 15.3696 0 0 0 0 0 0 0 0 13.9235 0 0 0 0 0 15.2747 0 R8ALW1 R8ALW1_PLESH DNA-binding transcriptional regulator OxyR PLESHI_16292 Plesiomonas shigelloides 302-73 DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700] DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700] DLEYLVALAEHKHFR 0.94749 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3394 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6218 0 12.9766 0 0 0 0 0 0 0 0 0 11.8436 0 14.0636 13.1555 12.9772 0 0 13.7316 12.8334 0 0 0 0 0 0 0 0 0 11.1885 0 0 0 0 0 0 0 14.4411 15.3233 0 0 0 11.4566 0 13.5816 0 13.901 10.8797 0 0 0 0 0 0 0 0 0 14.3041 0 0 14.7048 0 0 0 R8ALX7 R8ALX7_PLESH Anti-RNA polymerase sigma 70 factor PLESHI_16154 Plesiomonas shigelloides 302-73 "regulation of transcription, DNA-templated [GO:0006355]" "regulation of transcription, DNA-templated [GO:0006355]" DPAPTQGQAK 0.93969 0 0 0 0 0 0 0 12.7704 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.3858 0 0 12.8798 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ALZ1 R8ALZ1_PLESH Phosphoribosylamine--glycine ligase PLESHI_16114 Plesiomonas shigelloides 302-73 purine nucleobase biosynthetic process [GO:0009113]; purine nucleotide biosynthetic process [GO:0006164] nucleotide binding [GO:0000166]; phosphoribosylamine-glycine ligase activity [GO:0004637]; purine nucleobase biosynthetic process [GO:0009113]; purine nucleotide biosynthetic process [GO:0006164] nucleotide binding [GO:0000166]; phosphoribosylamine-glycine ligase activity [GO:0004637] AYQQAALIQWDDIYYR 0.94066 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8744 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8814 0 0 0 0 0 0 0 0 0 R8ALZ9 R8ALZ9_PLESH Bicyclomycin/multidrug efflux system protein PLESHI_16019 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] PHALFGTLLR 0.94985 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8249 14.309 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5975 14.0898 14.2833 0 0 0 12.6713 13.6856 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5392 12.6782 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9162 0 13.4353 0 R8AM09 R8AM09_PLESH Oligoribonuclease (EC 3.1.-.-) orn PLESHI_15954 Plesiomonas shigelloides 302-73 cytoplasm [GO:0005737] cytoplasm [GO:0005737]; 3'-5'-exoribonuclease activity [GO:0000175]; nucleic acid binding [GO:0003676] 3'-5'-exoribonuclease activity [GO:0000175]; nucleic acid binding [GO:0003676] QGTHLALDDIR 0.94572 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.031 13.7777 0 0 0 0 R8AM18 R8AM18_PLESH Uncharacterized protein PLESHI_16034 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] EPFRMDFVWAGLCLLGAVFFMFR 0.94267 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.2353 0 0 0 R8AM19 R8AM19_PLESH Outer membrane lipoprotein Blc PLESHI_16004 Plesiomonas shigelloides 302-73 cell outer membrane [GO:0009279] cell outer membrane [GO:0009279]; lipid binding [GO:0008289] lipid binding [GO:0008289] GFDPAKQRWQVAEGK 0.93289 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7746 13.3507 0 0 0 0 0 0 0 0 12.7273 13.0336 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AM22 R8AM22_PLESH FxsA cytoplasmic membrane protein PLESHI_16059 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] DPPTHQGDNSQQGPDDHDQPPRLH 0.9466 0 0 0 0 0 11.6088 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7275 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.9617 0 0 0 0 0 0 0 0 0 0 0 0 13.8006 0 11.7573 0 0 0 0 0 12.2676 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3577 11.9351 0 0 0 0 0 0 0 0 0 0 19.2868 0 0 13.0262 0 0 0 15.9871 0 0 0 0 13.8751 11.5472 12.9576 R8AM35 R8AM35_PLESH Fumarate reductase subunit D (Fumarate reductase 13 kDa hydrophobic protein) (Quinol-fumarate reductase subunit D) (QFR subunit D) frdD PLESHI_15999 Plesiomonas shigelloides 302-73 fumarate metabolic process [GO:0006106] integral component of membrane [GO:0016021]; plasma membrane fumarate reductase complex [GO:0045284] integral component of membrane [GO:0016021]; plasma membrane fumarate reductase complex [GO:0045284]; succinate dehydrogenase activity [GO:0000104]; fumarate metabolic process [GO:0006106] succinate dehydrogenase activity [GO:0000104] VHVPAGK 0.85333 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0088 12.5371 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AM52 R8AM52_PLESH Octaprenyl diphosphate synthase PLESHI_15654 Plesiomonas shigelloides 302-73 isoprenoid biosynthetic process [GO:0008299] transferase activity [GO:0016740]; isoprenoid biosynthetic process [GO:0008299] transferase activity [GO:0016740] IRPMIAVLAAR 0.94185 0 10.7859 12.5835 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6764 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.4778 0 13.367 13.9031 0 0 0 0 0 0 0 14.3467 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AM67 R8AM67_PLESH "Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (EC 3.6.1.41) (Ap4A hydrolase) (Diadenosine 5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase) (Diadenosine tetraphosphatase)" apaH PLESHI_15614 Plesiomonas shigelloides 302-73 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) activity [GO:0008803] bis(5'-nucleosyl)-tetraphosphatase (symmetrical) activity [GO:0008803] DLGPAAR 0.93967 0 0 0 0 0 0 0 0 0 0 0 12.0023 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0733 0 0 0 0 0 0 0 0 0 0 0 0 0 11.3846 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7084 0 0 R8AM78 R8AM78_PLESH "Phosphoadenosine 5'-phosphosulfate reductase (PAPS reductase) (EC 1.8.4.8) (3'-phosphoadenylylsulfate reductase) (PAPS reductase, thioredoxin dependent) (PAPS sulfotransferase) (PAdoPS reductase)" cysH PLESHI_15779 Plesiomonas shigelloides 302-73 "hydrogen sulfide biosynthetic process [GO:0070814]; sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin) [GO:0019379]" cytoplasm [GO:0005737] "cytoplasm [GO:0005737]; phosphoadenylyl-sulfate reductase (thioredoxin) activity [GO:0004604]; hydrogen sulfide biosynthetic process [GO:0070814]; sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin) [GO:0019379]" phosphoadenylyl-sulfate reductase (thioredoxin) activity [GO:0004604] ALAALNQALLALPAAAR 0.94638 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7955 13.4418 13.6754 0 0 0 13.0974 0 0 0 0 0 0 0 0 0 0 0 0 12.7827 0 13.1161 12.231 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AMB0 R8AMB0_PLESH 50S ribosomal protein L9 rplI PLESHI_15839 Plesiomonas shigelloides 302-73 translation [GO:0006412] ribosome [GO:0005840] ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412] rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735] AVMATKK 0.94969 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9967 0 0 15.4283 0 12.1453 13.7224 0 14.4157 13.2943 12.4854 12.9805 16.0032 0 0 13.4929 0 0 0 0 0 0 0 13.3081 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7918 15.708 0 0 0 0 0 12.6366 0 0 0 13.5824 0 0 0 12.9222 0 0 0 12.5643 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AMG8 R8AMG8_PLESH Biosynthetic arginine decarboxylase (ADC) (EC 4.1.1.19) speA PLESHI_14718 Plesiomonas shigelloides 302-73 arginine catabolic process [GO:0006527]; putrescine biosynthetic process [GO:0009446]; spermidine biosynthetic process [GO:0008295] arginine decarboxylase activity [GO:0008792]; metal ion binding [GO:0046872]; arginine catabolic process [GO:0006527]; putrescine biosynthetic process [GO:0009446]; spermidine biosynthetic process [GO:0008295] arginine decarboxylase activity [GO:0008792]; metal ion binding [GO:0046872] DFGYENNYMLVYPIK 0.94321 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0524 12.9267 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.4467 0 0 0 0 0 0 0 0 0 0 11.5909 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AMH0 R8AMH0_PLESH Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) PLESHI_14798 Plesiomonas shigelloides 302-73 pyridoxal phosphate binding [GO:0030170] pyridoxal phosphate binding [GO:0030170] CERAPESVTLLAVSKTK 0.94279 0 0 0 0 0 0 0 0 0 0 0 10.2932 17.0524 0 16.3794 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.5955 0 0 0 0 0 0 0 0 0 0 14.2778 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8403 0 0 0 13.9908 13.7696 14.9443 13.3818 0 0 0 0 R8AMI3 R8AMI3_PLESH UPF0235 protein PLESHI_14813 PLESHI_14813 Plesiomonas shigelloides 302-73 FLAKQFRVAK 0.94321 0 0 0 0 0 13.7352 0 13.8906 14.3663 0 13.4829 0 14.5735 14.5194 0 0 0 0 0 0 0 14.4 13.3961 14.3945 14.2876 0 13.6358 14.3518 13.3796 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1093 12.3859 13.9416 13.6352 12.4745 15.27 0 0 0 0 13.0286 14.4707 0 0 0 0 0 0 0 0 13.807 13.1864 0 13.0789 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5042 12.4292 0 0 0 0 0 0 0 13.227 0 11.577 0 0 0 0 0 15.861 0 0 13.8055 0 0 0 R8AMI4 R8AMI4_PLESH Ubiquinone biosynthesis protein UbiV ubiV PLESHI_14978 Plesiomonas shigelloides 302-73 ubiquinone biosynthetic process [GO:0006744] "4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]; peptidase activity [GO:0008233]; ubiquinone biosynthetic process [GO:0006744]" "4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]; peptidase activity [GO:0008233]" DECATCCINYPNGR 0.18182 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0985 0 0 0 12.8386 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1053 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AMJ8 R8AMJ8_PLESH "Putative RNA-binding protein, YhbY family" PLESHI_15053 Plesiomonas shigelloides 302-73 RNA binding [GO:0003723] RNA binding [GO:0003723] QHLKGLAHPLK 0.94479 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6979 0 0 0 0 0 R8AMN2 R8AMN2_PLESH NptA protein PLESHI_15138 Plesiomonas shigelloides 302-73 sodium-dependent phosphate transport [GO:0044341] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; phosphate ion transmembrane transporter activity [GO:0015114]; sodium:phosphate symporter activity [GO:0005436]; sodium-dependent phosphate transport [GO:0044341] phosphate ion transmembrane transporter activity [GO:0015114]; sodium:phosphate symporter activity [GO:0005436] AQEVLKHAIGR 0.94854 0 0 0 0 0 13.4741 14.202 13.6339 14.6878 0 0 0 0 0 0 11.8534 0 13.933 0 0 0 13.1778 0 0 0 0 0 0 0 12.7176 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5588 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.2983 12.1952 13.2821 13.1153 0 0 0 0 13.6012 12.4831 12.3519 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AMS9 R8AMS9_PLESH Uncharacterized protein PLESHI_15278 Plesiomonas shigelloides 302-73 SIDILNDYSLEDLRF 0.90476 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5658 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.6825 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.853 0 13.0234 0 0 0 0 0 0 0 0 0 R8AMU2 R8AMU2_PLESH Uncharacterized protein PLESHI_15443 Plesiomonas shigelloides 302-73 AADAYFDMQVFGAYQVR 0.94908 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1093 0 0 0 0 0 0 0 0 0 0 0 0 12.4591 0 0 0 13.713 0 0 0 0 0 0 0 0 0 0 0 13.9777 0 0 0 0 13.2507 13.0915 0 0 0 0 0 0 0 11.3952 0 0 0 0 0 0 0 0 0 0 12.5287 0 0 0 0 0 0 0 0 15.3159 0 0 0 0 0 R8AMY7 R8AMY7_PLESH Competence/damage-inducible protein CinA-like protein PLESHI_13761 Plesiomonas shigelloides 302-73 HAVREQAVHFALQTLLNEFLF 0.94832 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1329 0 0 16.0776 12.6649 0 0 16.4066 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AN16 R8AN16_PLESH FAD assembly factor SdhE PLESHI_13911 Plesiomonas shigelloides 302-73 DDPDLFRWFMNNTR 0.94908 0 0 0 15.8878 0 0 14.3328 0 16.22 0 0 15.2525 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2085 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.092 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.4242 13.6856 15.6646 0 0 0 0 0 10.4084 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.1814 R8AN33 R8AN33_PLESH 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) PLESHI_13986 Plesiomonas shigelloides 302-73 5-formyltetrahydrofolate cyclo-ligase activity [GO:0030272]; ATP binding [GO:0005524]; metal ion binding [GO:0046872] 5-formyltetrahydrofolate cyclo-ligase activity [GO:0030272]; ATP binding [GO:0005524]; metal ion binding [GO:0046872] LGMGGGFYDRTLAPPHHSSQPHALNR 0.93827 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.3676 12.1086 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AN52 R8AN52_PLESH Uncharacterized protein PLESHI_14086 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] DLRLKVALIR 0.94345 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0982 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2642 0 0 0 0 13.3537 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AN61 R8AN61_PLESH Flavodoxin PLESHI_14046 Plesiomonas shigelloides 302-73 FMN binding [GO:0010181] FMN binding [GO:0010181] FDALLQEQGAQR 0.9492 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.6942 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.9853 17.016 17.191 14.3796 0 0 R8AN66 R8AN66_PLESH ABC transporter permease PLESHI_14191 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] MQGKMAPAWVRSALIPLLQLLLALGVSSLVVLMVGEDPLR 0.94469 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0165 0 0 0 0 0 0 0 0 0 0 13.5413 13.2232 13.3225 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0676 0 0 0 0 R8AN92 R8AN92_PLESH RecBCD enzyme subunit RecB (EC 3.1.11.5) (Exonuclease V subunit RecB) (ExoV subunit RecB) (Helicase/nuclease RecBCD subunit RecB) recB PLESHI_14171 Plesiomonas shigelloides 302-73 double-strand break repair via homologous recombination [GO:0000724] ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; exodeoxyribonuclease V activity [GO:0008854]; magnesium ion binding [GO:0000287]; double-strand break repair via homologous recombination [GO:0000724] ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; exodeoxyribonuclease V activity [GO:0008854]; magnesium ion binding [GO:0000287] ARIREGR 0.94775 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1198 0 0 14.2899 0 13.9228 0 0 0 0 13.1302 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.755 0 0 0 0 0 0 0 0 13.3978 14.2079 11.099 0 0 0 0 0 0 0 0 10.9741 0 0 0 11.4245 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1559 0 0 0 0 0 0 0 12.5329 0 0 0 0 0 0 10.2433 R8ANA5 R8ANA5_PLESH Tail completion protein R (GpR) PLESHI_14366 Plesiomonas shigelloides 302-73 KPESLRTFLCEK 0.94934 0 0 0 0 0 0 0 0 13.9266 12.3047 0 0 0 0 0 0 0 0 0 0 16.0219 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2204 0 13.8441 0 0 0 0 0 0 12.9473 0 12.6524 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.8199 0 0 0 0 0 0 0 0 0 0 0 17.2259 16.631 0 0 0 0 0 0 0 0 13.9962 0 0 0 0 13.509 13.2208 13.7913 0 0 15.2978 17.979 0 0 0 0 0 R8ANA9 R8ANA9_PLESH Ribosome association toxin RatA PLESHI_14281 Plesiomonas shigelloides 302-73 cellular respiration [GO:0045333]; ubiquinone biosynthetic process [GO:0006744] ubiquinone binding [GO:0048039]; cellular respiration [GO:0045333]; ubiquinone biosynthetic process [GO:0006744] ubiquinone binding [GO:0048039] AKEVYGG 0.90722 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0839 0 0 13.0758 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7864 0 0 0 13.8677 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1412 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6444 R8ANB1 R8ANB1_PLESH Outer membrane protein assembly factor BamE bamE PLESHI_14271 Plesiomonas shigelloides 302-73 Gram-negative-bacterium-type cell outer membrane assembly [GO:0043165]; protein insertion into membrane [GO:0051205] cell outer membrane [GO:0009279] cell outer membrane [GO:0009279]; Gram-negative-bacterium-type cell outer membrane assembly [GO:0043165]; protein insertion into membrane [GO:0051205] IDVDQGNYLEQKDVAQLRQGMNK 0.94668 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3286 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ANB9 R8ANB9_PLESH Major tail tube protein PLESHI_14321 Plesiomonas shigelloides 302-73 ADAVQLRFTGSIQRDDTAEVMAVEVVVR 0.94334 0 0 0 0 0 0 0 11.147 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7637 0 0 0 0 0 0 0 14.1449 0 0 0 0 0 0 0 0 0 0 0 0 11.4747 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2265 0 0 0 0 0 0 R8ANC3 R8ANC3_PLESH Phage tail protein PLESHI_14386 Plesiomonas shigelloides 302-73 MQHDTVDALCWR 0.94356 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.1294 0 0 10.6537 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.4404 R8AND0 R8AND0_PLESH Prophage Hp1 family holin PLESHI_14381 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] GIYEQLNR 0.94286 0 0 0 0 0 0 0 0 0 0 0 0 11.5688 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.6804 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5758 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7079 0 0 11.7873 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7587 13.9174 0 10.2908 11.0682 0 R8AND2 R8AND2_PLESH 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) pgl PLESHI_13033 Plesiomonas shigelloides 302-73 carbohydrate metabolic process [GO:0005975]; pentose-phosphate shunt [GO:0006098] 6-phosphogluconolactonase activity [GO:0017057]; carbohydrate metabolic process [GO:0005975]; pentose-phosphate shunt [GO:0006098] 6-phosphogluconolactonase activity [GO:0017057] ITLTLPALLASR 0.94688 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8769 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ANG8 R8ANG8_PLESH Ferrous iron transport protein A PLESHI_13088 Plesiomonas shigelloides 302-73 transition metal ion binding [GO:0046914] transition metal ion binding [GO:0046914] RTIAAGIDVEVLA 0.94603 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0151 0 15.4728 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ANI1 R8ANI1_PLESH Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) nadD PLESHI_13318 Plesiomonas shigelloides 302-73 NAD biosynthetic process [GO:0009435] ATP binding [GO:0005524]; nicotinate-nucleotide adenylyltransferase activity [GO:0004515]; NAD biosynthetic process [GO:0009435] ATP binding [GO:0005524]; nicotinate-nucleotide adenylyltransferase activity [GO:0004515] LACAANPLFVPDLR 0.45455 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8492 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ANI2 R8ANI2_PLESH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) PLESHI_13123 Plesiomonas shigelloides 302-73 L-lysine catabolic process to acetyl-CoA via saccharopine [GO:0033512]; tricarboxylic acid cycle [GO:0006099] oxoglutarate dehydrogenase complex [GO:0045252] oxoglutarate dehydrogenase complex [GO:0045252]; dihydrolipoyllysine-residue succinyltransferase activity [GO:0004149]; L-lysine catabolic process to acetyl-CoA via saccharopine [GO:0033512]; tricarboxylic acid cycle [GO:0006099] dihydrolipoyllysine-residue succinyltransferase activity [GO:0004149] DCDTLSLADIEKSIK 0.69388 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7324 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ANK7 R8ANK7_PLESH UPF0250 protein PLESHI_13353 PLESHI_13353 Plesiomonas shigelloides 302-73 LNELLEFPCSFTYK 0.93702 0 0 0 0 0 0 12.3916 14.4855 0 0 0 0 0 0 0 0 13.4393 0 0 0 0 0 0 0 11.2404 14.3788 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.2472 0 13.7426 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.712 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9079 0 14.414 0 0 0 0 0 0 12.4333 0 0 0 0 0 R8ANK9 R8ANK9_PLESH Uncharacterized protein PLESHI_13483 Plesiomonas shigelloides 302-73 DEILHHWWGR 0.94324 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.812 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ANM2 R8ANM2_PLESH Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.1.129) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) mrdB rodA PLESHI_13338 Plesiomonas shigelloides 302-73 cell division [GO:0051301]; cell wall organization [GO:0071555]; peptidoglycan biosynthetic process [GO:0009252]; regulation of cell shape [GO:0008360] integral component of plasma membrane [GO:0005887] integral component of plasma membrane [GO:0005887]; peptidoglycan glycosyltransferase activity [GO:0008955]; cell division [GO:0051301]; cell wall organization [GO:0071555]; peptidoglycan biosynthetic process [GO:0009252]; regulation of cell shape [GO:0008360] peptidoglycan glycosyltransferase activity [GO:0008955] GWLHGTQSQLEFLPER 0.94273 0 0 0 0 0 12.8321 13.9531 0 0 0 0 12.8507 0 0 0 0 0 0 12.6671 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.7407 14.0317 14.0942 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.6334 0 0 0 0 0 0 0 0 0 0 0 0 13.2707 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9678 0 0 15.5222 R8ANM4 R8ANM4_PLESH "6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78)" ribH PLESHI_13558 Plesiomonas shigelloides 302-73 riboflavin biosynthetic process [GO:0009231] riboflavin synthase complex [GO:0009349] "riboflavin synthase complex [GO:0009349]; 6,7-dimethyl-8-ribityllumazine synthase activity [GO:0000906]; riboflavin biosynthetic process [GO:0009231]" "6,7-dimethyl-8-ribityllumazine synthase activity [GO:0000906]" FNSFINESLLDGALDALKR 0.94379 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6028 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.4391 0 15.5492 0 0 0 0 0 0 0 0 0 0 12.8398 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9773 0 0 0 0 0 0 0 0 0 R8ANN2 R8ANN2_PLESH Tripeptide transporter permease tppB PLESHI_12455 Plesiomonas shigelloides 302-73 oligopeptide transport [GO:0006857] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; peptide transmembrane transporter activity [GO:1904680]; oligopeptide transport [GO:0006857] peptide transmembrane transporter activity [GO:1904680] GWVKQYGSTPDFAPVNR 0.94425 0 0 0 0 0 0 0 0 0 0 0 0 12.8068 0 0 11.765 11.5555 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17 0 16.2528 0 0 0 0 12.9851 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.6574 12.9021 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.662 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ANS9 R8ANS9_PLESH Uncharacterized protein PLESHI_13588 Plesiomonas shigelloides 302-73 ARYGEPAGEHVHDK 0.94328 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5734 12.0726 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ANT4 R8ANT4_PLESH Uncharacterized protein PLESHI_12640 Plesiomonas shigelloides 302-73 MTEHQATPDLCPCGSQR 0.94534 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.0912 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4967 0 13.6931 15.0532 R8ANU7 R8ANU7_PLESH Uncharacterized protein PLESHI_12650 Plesiomonas shigelloides 302-73 PEVYHNLSLTERDEVQGK 0.9485 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8358 0 0 0 0 0 0 0 17.0313 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.733 0 0 0 0 R8ANV8 R8ANV8_PLESH UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (UDP-glucose pyrophosphorylase) PLESHI_12620 Plesiomonas shigelloides 302-73 biosynthetic process [GO:0009058]; UDP-glucose metabolic process [GO:0006011] UTP:glucose-1-phosphate uridylyltransferase activity [GO:0003983]; biosynthetic process [GO:0009058]; UDP-glucose metabolic process [GO:0006011] UTP:glucose-1-phosphate uridylyltransferase activity [GO:0003983] ALLATAK 0.94632 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3133 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ANX9 R8ANX9_PLESH YcgL domain-containing protein PLESHI_12800 PLESHI_12800 Plesiomonas shigelloides 302-73 PQLVMLFPLDGSKR 0.93623 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4831 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5253 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ANY2 R8ANY2_PLESH Putative inner membrane protein PLESHI_12980 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] ALSQTPQKK 0.9494 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.0362 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6347 0 0 0 0 0 0 15.213 0 0 0 0 0 0 0 0 0 0 0 0 0 15.1778 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.5932 0 0 0 0 0 0 0 0 0 17.3404 0 R8ANZ1 R8ANZ1_PLESH Fatty acid metabolism regulator protein fadR PLESHI_12760 Plesiomonas shigelloides 302-73 fatty acid metabolic process [GO:0006631]; regulation of fatty acid metabolic process [GO:0019217] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; fatty-acyl-CoA binding [GO:0000062]; fatty acid metabolic process [GO:0006631]; regulation of fatty acid metabolic process [GO:0019217] DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; fatty-acyl-CoA binding [GO:0000062] AQSPAGFAEEYIVESIWNNR 0.94919 0 0 0 0 15.875 0 0 0 0 0 0 0 0 14.6548 14.0934 0 0 0 0 0 0 0 0 12.33 16.6687 12.7127 0 14.5113 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0879 0 0 0 0 0 0 0 0 0 10.7209 0 0 0 0 0 15.5356 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.6879 0 0 14.1107 0 10.9219 0 0 0 0 0 0 15.1944 0 0 0 0 0 14.6217 0 R8ANZ9 R8ANZ9_PLESH Uncharacterized protein PLESHI_12965 Plesiomonas shigelloides 302-73 DVPGYLK 0.94978 0 0 0 0 0 0 0 0 15.0362 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AP19 R8AP19_PLESH TetR family transcriptional regulator PLESHI_12995 Plesiomonas shigelloides 302-73 DNA binding [GO:0003677] DNA binding [GO:0003677] ARILDAAER 0.9453 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.1077 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0116 0 0 0 0 0 0 0 0 11.3668 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AP20 R8AP20_PLESH UPF0304 protein PLESHI_12300 PLESHI_12300 Plesiomonas shigelloides 302-73 HFGEISEDDCR 0.94168 0 0 0 0 14.8886 0 0 13.3096 0 0 0 0 0 0 0 10.54 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.1741 0 15.6102 0 0 0 0 0 0 0 0 0 15.0617 0 0 0 0 0 0 0 11.4443 0 0 0 0 0 0 0 13.395 12.835 13.1971 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.7032 0 0 0 0 10.5227 R8AP34 R8AP34_PLESH DNA-binding protein HU-beta PLESHI_12375 Plesiomonas shigelloides 302-73 DNA binding [GO:0003677] DNA binding [GO:0003677] VPAFRPGKALK 0.94283 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1167 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AP41 R8AP41_PLESH Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) adk PLESHI_12420 Plesiomonas shigelloides 302-73 AMP salvage [GO:0044209] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; adenylate kinase activity [GO:0004017]; ATP binding [GO:0005524]; AMP salvage [GO:0044209] adenylate kinase activity [GO:0004017]; ATP binding [GO:0005524] AAVKAGTELGLQAK 0.94269 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.8311 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0347 0 0 0 13.2411 0 9.97871 0 14.3799 14.6254 0 0 0 0 12.5473 12.6766 0 0 0 0 9.54185 13.8708 12.1627 13.5073 0 0 0 13.4061 12.9772 13.5332 0 12.7881 12.8368 12.847 0 0 0 12.7052 11.1778 0 0 0 0 0 0 0 0 0 0 0 14.5221 0 0 14.7448 0 0 0 0 0 0 0 R8AP65 R8AP65_PLESH GNAT family acetyltransferase PLESHI_12210 Plesiomonas shigelloides 302-73 N-acetyltransferase activity [GO:0008080] N-acetyltransferase activity [GO:0008080] ACTFAELSSTELYQLLQLR 0.94673 0 0 0 0 0 0 0 0 0 0 0 12.9995 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.724 14.0327 14.702 0 16.0012 0 0 0 0 0 0 0 R8AP70 R8AP70_PLESH O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26) (Fragment) PLESHI_12220 Plesiomonas shigelloides 302-73 o-succinylbenzoate-CoA ligase activity [GO:0008756] o-succinylbenzoate-CoA ligase activity [GO:0008756] EPCLRDEEVWVR 0.94852 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8197 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2323 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AP98 R8AP98_PLESH Phosphoglycolate phosphatase PLESHI_12170 Plesiomonas shigelloides 302-73 carbohydrate metabolic process [GO:0005975] metal ion binding [GO:0046872]; phosphatase activity [GO:0016791]; carbohydrate metabolic process [GO:0005975] metal ion binding [GO:0046872]; phosphatase activity [GO:0016791] DWDADGVFASVTEFMHWLATHR 0.93957 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.031 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9444 R8APB9 R8APB9_PLESH Tail assembly protein PLESHI_11985 Plesiomonas shigelloides 302-73 metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237] metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237] DPFGGFWARYLHSVWR 0.9443 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0865 0 0 0 14.1355 15.7378 13.243 0 R8APE5 R8APE5_PLESH Lipoprotein-releasing system ATP-binding protein LolD (EC 7.6.2.-) lolD PLESHI_11320 Plesiomonas shigelloides 302-73 lipoprotein localization to membrane [GO:0044873]; lipoprotein transport [GO:0042953] plasma membrane [GO:0005886] plasma membrane [GO:0005886]; ATP binding [GO:0005524]; lipoprotein releasing activity [GO:0140306]; lipoprotein localization to membrane [GO:0044873]; lipoprotein transport [GO:0042953] ATP binding [GO:0005524]; lipoprotein releasing activity [GO:0140306] PLLVCENLVKTYR 0.94431 0 0 0 14.0837 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5187 0 0 13.0662 14.1581 13.8005 13.7738 0 0 13.6208 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0395 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5609 0 13.4272 0 0 0 R8APE6 R8APE6_PLESH Outer membrane-specific lipoprotein transporter subunit LolC PLESHI_11325 Plesiomonas shigelloides 302-73 lipoprotein transport [GO:0042953] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; lipoprotein transport [GO:0042953] LMVTDASQFTPMGR 0.94242 0 0 0 0 0 0 0 0 0 0 0 0 11.7181 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.2966 R8APE7 R8APE7_PLESH Histidine triad (HIT) protein PLESHI_11380 Plesiomonas shigelloides 302-73 catalytic activity [GO:0003824] catalytic activity [GO:0003824] MPEETIFSKIIR 0.94818 0 0 0 16.6422 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7066 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1269 11.3795 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8APG0 R8APG0_PLESH 7-methyl-GTP pyrophosphatase (m(7)GTP pyrophosphatase) (EC 3.6.1.-) PLESHI_11465 Plesiomonas shigelloides 302-73 nucleotide metabolic process [GO:0009117] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; nucleoside-triphosphate diphosphatase activity [GO:0047429]; nucleotide metabolic process [GO:0009117] nucleoside-triphosphate diphosphatase activity [GO:0047429] LILASTSPFRK 0.94018 0 0 0 12.2115 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.1354 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5929 0 14.8467 0 0 11.6999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8APG7 R8APG7_PLESH Uncharacterized protein PLESHI_11480 Plesiomonas shigelloides 302-73 HPKSLSLPALLLSLK 0.94488 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.3926 0 0 11.9614 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8API3 R8API3_PLESH Fumarate hydratase class I (EC 4.2.1.2) PLESHI_11615 Plesiomonas shigelloides 302-73 generation of precursor metabolites and energy [GO:0006091] "4 iron, 4 sulfur cluster binding [GO:0051539]; fumarate hydratase activity [GO:0004333]; metal ion binding [GO:0046872]; generation of precursor metabolites and energy [GO:0006091]" "4 iron, 4 sulfur cluster binding [GO:0051539]; fumarate hydratase activity [GO:0004333]; metal ion binding [GO:0046872]" AAVMAKEALMESCDIQDLMAR 0.94067 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3809 13.3879 0 0 0 0 0 0 0 14.9572 12.9682 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8359 0 14.101 0 0 0 0 0 0 0 0 0 0 0 0 16.885 0 R8APJ1 R8APJ1_PLESH Paraquat-inducible protein B PLESHI_11575 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] FNPGTEK 0.94111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.4233 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.1848 0 0 0 0 R8APJ9 R8APJ9_PLESH Xanthine/uracil/vitamin C permease PLESHI_11605 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; nucleobase transmembrane transporter activity [GO:0015205] nucleobase transmembrane transporter activity [GO:0015205] AHGTNPQK 0.92174 0 0 0 0 0 15.2951 11.6631 0 14.4136 0 14.9279 0 13.4846 0 0 0 11.3287 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.1754 0 11.6471 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.4487 0 0 0 0 0 0 0 0 0 0 0 11.1549 0 0 0 0 0 0 0 0 0 0 0 0 13.5298 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8APK8 R8APK8_PLESH NUDIX hydrolase PLESHI_11625 Plesiomonas shigelloides 302-73 nucleoside diphosphate metabolic process [GO:0009132] CoA pyrophosphatase activity [GO:0010945]; magnesium ion binding [GO:0000287]; manganese ion binding [GO:0030145]; nucleoside diphosphate metabolic process [GO:0009132] CoA pyrophosphatase activity [GO:0010945]; magnesium ion binding [GO:0000287]; manganese ion binding [GO:0030145] HHPGQIAFPGGRAEAQDR 0.94892 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.0666 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1338 0 0 0 0 0 15.3336 0 0 0 0 0 0 0 0 0 15.615 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8APK9 R8APK9_PLESH Thioesterase superfamily protein PLESHI_11765 Plesiomonas shigelloides 302-73 thiolester hydrolase activity [GO:0016790] thiolester hydrolase activity [GO:0016790] VVTVAVDGITFLK 0.94808 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4892 0 0 0 0 0 0 0 12.9451 0 13.1934 0 13.3081 0 12.9582 13.3771 11.8125 13.5274 14.143 0 0 0 0 13.85 0 R8APL4 R8APL4_PLESH NADH:ubiquinone oxidoreductase subunit L PLESHI_11790 Plesiomonas shigelloides 302-73 ATP synthesis coupled electron transport [GO:0042773] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]; ATP synthesis coupled electron transport [GO:0042773] NADH dehydrogenase (ubiquinone) activity [GO:0008137] NGAAAMK 0.94717 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0956 0 0 15.0147 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7894 15.566 14.5503 13.3805 15.9196 0 12.4754 13.4271 14.0993 0 0 13.8327 15.3139 15.4025 13.3018 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4805 14.4152 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.4878 0 15.471 13.4667 16.2401 R8APM6 R8APM6_PLESH Putative RNA binding protein PLESHI_11695 Plesiomonas shigelloides 302-73 double-stranded RNA binding [GO:0003725] double-stranded RNA binding [GO:0003725] EGAVVVYPTDSGYAMGCMLGDK 0.94112 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.2003 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8APN7 R8APN7_PLESH Surface protein PLESHI_11072 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; L-lysine efflux transmembrane transporter activity [GO:0015661] L-lysine efflux transmembrane transporter activity [GO:0015661] LHQQKLPSRLR 0.94272 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.2037 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8APQ3 R8APQ3_PLESH Uncharacterized protein PLESHI_11845 Plesiomonas shigelloides 302-73 ACEVFSGCFGEVK 0.94737 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7391 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.1528 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8APS7 R8APS7_PLESH Cbb3-type cytochrome c oxidase subunit PLESHI_11187 Plesiomonas shigelloides 302-73 ion transport [GO:0006811]; oxidative phosphorylation [GO:0006119] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; respirasome [GO:0070469] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; respirasome [GO:0070469]; electron transfer activity [GO:0009055]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; ion transport [GO:0006811]; oxidative phosphorylation [GO:0006119] electron transfer activity [GO:0009055]; heme binding [GO:0020037]; iron ion binding [GO:0005506] AKAAGQYVQYDQEK 0.66667 0 0 0 0 0 0 0 19.6542 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8APV1 R8APV1_PLESH "Phosphoesterase, PA-phosphatase-like protein" PLESHI_10840 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; undecaprenyl-diphosphatase activity [GO:0050380] undecaprenyl-diphosphatase activity [GO:0050380] LACYLCPPRRTPPQR 0.93382 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9015 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8APV8 R8APV8_PLESH Cyclic-guanylate-specific phosphodiesterase (EC 3.1.4.52) PLESHI_10845 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; cyclic-guanylate-specific phosphodiesterase activity [GO:0071111] cyclic-guanylate-specific phosphodiesterase activity [GO:0071111] DDAEAER 0.45455 0 0 0 0 0 0 0 0 13.5465 12.2755 0 0 0 12.7077 0 0 0 0 12.1771 0 0 0 0 0 0 0 0 0 0 0 0 0 10.223 0 0 0 0 0 11.069 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.4826 16.3196 16.6918 15.0295 17.4872 14.9644 13.0122 14.8286 17.2739 17.5536 18.3066 0 14.5745 13.9449 14.8358 11.0585 14.5164 0 0 0 14.3698 13.5104 13.7654 0 0 0 0 0 12.8305 0 0 12.7406 0 0 0 0 0 0 0 0 0 15.442 0 14.7686 R8APW1 R8APW1_PLESH Ydii hotdog fold superfamily protein PLESHI_10890 Plesiomonas shigelloides 302-73 ALHAGRR 0.93671 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.2875 15.7162 0 12.6415 0 0 13.9833 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8772 0 0 0 0 0 11.9522 0 0 17.5406 0 0 0 0 12.6 0 0 0 0 0 10.8593 16.1502 0 12.0552 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8237 0 0 0 0 0 0 15.1005 0 12.9914 0 14.3593 0 14.9369 14.9918 0 13.5495 0 0 15.6735 15.868 16.043 15.4555 15.9208 0 0 0 0 14.1557 0 15.7434 0 0 0 R8APZ9 R8APZ9_PLESH "DNA replication protein P, putative" PLESHI_10735 Plesiomonas shigelloides 302-73 DNA replication initiation [GO:0006270] DNA replication initiation [GO:0006270] DWLELCLEQQVSGLPDVESVMACFHRYSADR 0.94705 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4804 0 13.8675 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7543 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.466 R8AQ31 R8AQ31_PLESH Uncharacterized protein PLESHI_10435 Plesiomonas shigelloides 302-73 ALAGLPIETAWQR 0.94214 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.515 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2554 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1182 0 0 0 0 0 0 0 12.9523 0 0 0 0 0 R8AQ44 R8AQ44_PLESH EAL domain-containing protein PLESHI_10520 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] DLNLYNSQFR 0.94676 0 0 0 0 0 0 0 0 14.0219 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0047 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2873 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AQ59 R8AQ59_PLESH Diguanylate cyclase PLESHI_10585 Plesiomonas shigelloides 302-73 HTGKNGILYEQYMCAPK 0.94747 0 0 0 0 0 13.434 0 13.5997 0 0 13.3786 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AQ65 R8AQ65_PLESH RNA_pol_A_CTD domain-containing protein (Fragment) PLESHI_10034 Plesiomonas shigelloides 302-73 "transcription, DNA-templated [GO:0006351]" "DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; transcription, DNA-templated [GO:0006351]" DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899] ECRQAAA 0.82278 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.9331 0 0 0 0 0 0 0 0 R8AQ70 R8AQ70_PLESH Uncharacterized protein PLESHI_10635 Plesiomonas shigelloides 302-73 DSLSFSKK 0.94142 0 0 0 0 14.3261 0 0 13.343 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5799 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1963 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AQ74 R8AQ74_PLESH Sulfatase PLESHI_10099 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] "integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; sulfuric ester hydrolase activity [GO:0008484]; transferase activity, transferring phosphorus-containing groups [GO:0016772]" "sulfuric ester hydrolase activity [GO:0008484]; transferase activity, transferring phosphorus-containing groups [GO:0016772]" AGINVTWLENDGGCK 0.94262 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4163 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.9331 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AQG4 R8AQG4_PLESH Uncharacterized protein PLESHI_09864 Plesiomonas shigelloides 302-73 AYMRDADDTANSAR 0.94966 0 0 0 0 0 12.0721 17.8632 0 0 0 0 0 0 0 0 10.7655 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.3737 0 0 0 R8AQH7 R8AQH7_PLESH Uncharacterized protein PLESHI_09909 Plesiomonas shigelloides 302-73 ARLQEETQAHNEARR 0.94451 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4103 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5537 0 0 15.3591 0 0 0 0 0 0 0 R8AQH9 R8AQH9_PLESH Small subunit bacteriophage terminase PLESHI_09904 Plesiomonas shigelloides 302-73 AEADNIER 0.94195 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0125 0 0 0 0 0 0 0 11.695 0 0 0 0 0 0 0 0 0 0 0 10.6663 0 0 0 0 0 13.3233 0 0 0 0 0 0 0 12.7882 0 11.9411 0 0 0 0 14.5477 0 0 12.8622 0 0 0 0 0 0 R8AQK2 R8AQK2_PLESH Uncharacterized protein PLESHI_09494 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] KNLLTFRGIFALITFVLAVFFFVLLVLQLQK 0.9413 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5587 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5764 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0636 0 11.6137 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AQK5 R8AQK5_PLESH Uncharacterized protein PLESHI_09629 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] LPKVMLMR 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.2246 15.8944 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6325 0 0 0 13.4672 14.408 13.3455 0 13.694 13.4404 0 0 0 16.6528 16.7575 0 0 0 0 18.8871 17.2874 18.9386 0 0 0 R8AQK6 R8AQK6_PLESH Periplasmic binding protein PLESHI_09649 Plesiomonas shigelloides 302-73 ADTATNDKQTR 0.94385 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7046 0 0 0 0 0 0 0 0 0 0 13.4061 0 0 0 0 0 0 0 0 13.1046 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0339 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0128 0 0 0 0 0 0 0 0 0 0 R8AQL8 R8AQL8_PLESH Arginine/ornithine antiporter PLESHI_09689 Plesiomonas shigelloides 302-73 amino acid transport [GO:0006865] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transporter activity [GO:0022857]; amino acid transport [GO:0006865] transmembrane transporter activity [GO:0022857] AEVAELRNPSMAGMLDLMIGPMGK 0.94704 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4828 12.9237 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6464 0 0 0 0 0 0 0 0 0 R8AQM0 R8AQM0_PLESH LysR family transcriptional regulator PLESHI_09569 Plesiomonas shigelloides 302-73 DNA-binding transcription factor activity [GO:0003700] DNA-binding transcription factor activity [GO:0003700] DYRLLRAFTAVFEEK 0.93859 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6092 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.3373 0 0 11.7124 0 0 0 14.4229 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2271 0 0 0 0 0 0 0 0 0 13.6115 13.391 13.1133 0 0 0 0 0 0 13.3801 0 0 0 0 0 0 0 12.6093 0 0 0 0 0 0 0 12.5724 0 0 0 0 0 0 0 0 0 0 14.7634 13.1595 0 0 14.1396 12.9059 R8AQM2 R8AQM2_PLESH Nickel-responsive regulator nikR PLESHI_09709 Plesiomonas shigelloides 302-73 response to nickel cation [GO:0010045] DNA-binding transcription factor activity [GO:0003700]; nickel cation binding [GO:0016151]; sequence-specific DNA binding [GO:0043565]; response to nickel cation [GO:0010045] DNA-binding transcription factor activity [GO:0003700]; nickel cation binding [GO:0016151]; sequence-specific DNA binding [GO:0043565] FTVSLPKQLNDILDVKLQR 0.94688 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.5738 0 0 0 0 0 0 0 0 0 0 0 0 0 12.2236 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AQN2 R8AQN2_PLESH Vtamin B12-transporter permease PLESHI_09759 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] MPFYQLVLAQQQR 0.94595 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5575 0 0 0 0 12.9421 10.9659 0 0 0 12.7721 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6874 12.6673 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AQN3 R8AQN3_PLESH Succinylglutamate desuccinylase (EC 3.5.1.96) astE PLESHI_09764 Plesiomonas shigelloides 302-73 arginine catabolic process to glutamate [GO:0019544]; arginine catabolic process to succinate [GO:0019545] "hydrolase activity, acting on ester bonds [GO:0016788]; succinylglutamate desuccinylase activity [GO:0009017]; zinc ion binding [GO:0008270]; arginine catabolic process to glutamate [GO:0019544]; arginine catabolic process to succinate [GO:0019545]" "hydrolase activity, acting on ester bonds [GO:0016788]; succinylglutamate desuccinylase activity [GO:0009017]; zinc ion binding [GO:0008270]" AAKLEAYVDRFFR 0.94637 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.2957 0 17.4598 0 14.8256 0 14.136 13.8602 0 17.1734 0 17.2937 18.1658 18.2458 14.7898 0 0 0 0 0 0 14.3656 14.6197 14.763 12.7793 12.4925 0 0 0 0 0 0 0 0 0 0 0 13.1935 0 0 0 0 15.3429 16.6648 17.5926 0 14.8558 15.8115 0 0 14.4748 14.5541 0 0 0 0 0 0 0 0 0 0 0 0 0 20.1981 18.0915 17.8529 19.0933 R8AQN7 R8AQN7_PLESH 50S ribosomal protein L20 rplT PLESHI_09784 Plesiomonas shigelloides 302-73 ribosomal large subunit assembly [GO:0000027]; translation [GO:0006412] cytoplasm [GO:0005737]; ribosome [GO:0005840] cytoplasm [GO:0005737]; ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; ribosomal large subunit assembly [GO:0000027]; translation [GO:0006412] rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735] AAFAALVEKAKAALA 0.94831 0 0 0 0 0 13.5121 0 0 0 13.6119 14.6131 13.0784 13.3044 0 0 12.7983 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9303 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8956 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.4046 15.0124 0 0 0 R8AQQ1 R8AQQ1_PLESH Uncharacterized protein (Fragment) PLESHI_09379 Plesiomonas shigelloides 302-73 FDVEIYCDESGR 0.94607 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6537 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3213 0 0 0 0 0 0 0 0 0 14.4932 0 0 0 0 0 0 0 0 R8AQQ9 R8AQQ9_PLESH Integration host factor subunit alpha (IHF-alpha) ihfA himA PLESHI_09769 Plesiomonas shigelloides 302-73 "DNA recombination [GO:0006310]; regulation of transcription, DNA-templated [GO:0006355]; regulation of translation [GO:0006417]" "DNA binding [GO:0003677]; DNA recombination [GO:0006310]; regulation of transcription, DNA-templated [GO:0006355]; regulation of translation [GO:0006417]" DNA binding [GO:0003677] DLVEAFFEEIRK 0.94867 0 0 0 0 0 16.1691 0 15.1709 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AQR9 R8AQR9_PLESH N-acetyltransferase GCN5 PLESHI_09474 Plesiomonas shigelloides 302-73 N-acetyltransferase activity [GO:0008080] N-acetyltransferase activity [GO:0008080] KVVHHVMSAHGK 0.94487 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4579 0 0 0 0 0 0 0 14.333 16.8114 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.0705 13.9355 16.8296 0 0 0 0 14.506 0 12.5286 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AQT3 R8AQT3_PLESH Iso-IS1 ORF1 PLESHI_09414 Plesiomonas shigelloides 302-73 AVVRDTARTLK 0.9399 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1093 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AQT9 R8AQT9_PLESH Uncharacterized protein (Fragment) PLESHI_09252 Plesiomonas shigelloides 302-73 IIIPSYQSGRIITGSSR 0.94759 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6371 14.3008 15.0535 0 0 0 0 0 0 0 0 0 0 11.2143 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0618 15.2188 15.169 0 0 0 0 0 0 14.428 0 14.6439 0 14.5089 15.0984 0 0 0 15.2249 16.3559 14.6407 13.6704 14.7993 15.8799 16.5803 14.9622 16.2709 13.5396 13.3351 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AQV3 R8AQV3_PLESH Uncharacterized protein (Fragment) PLESHI_09183 Plesiomonas shigelloides 302-73 KWLMKLCGIDLAWQGVK 0.94022 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.1845 0 0 R8AQW5 R8AQW5_PLESH Uncharacterized protein (Fragment) PLESHI_09109 Plesiomonas shigelloides 302-73 KNKIIIPSYQSGR 0.949 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9533 0 13.0588 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.0966 0 0 0 0 R8AR09 R8AR09_PLESH Amidohydrolase (Fragment) PLESHI_08939 Plesiomonas shigelloides 302-73 nitrogen compound metabolic process [GO:0006807] hydrolase activity [GO:0016787]; nitrogen compound metabolic process [GO:0006807] hydrolase activity [GO:0016787] ARVIIIAGIPLANDGR 0.94702 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8864 0 0 0 0 0 0 0 0 R8AR20 R8AR20_PLESH Uncharacterized protein (Fragment) PLESHI_08804 Plesiomonas shigelloides 302-73 ENLVYEFEDTTK 0.94373 0 0 0 0 0 0 12.2559 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.7512 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AR22 R8AR22_PLESH Uncharacterized protein (Fragment) PLESHI_08844 Plesiomonas shigelloides 302-73 "regulation of transcription, DNA-templated [GO:0006355]" "regulation of transcription, DNA-templated [GO:0006355]" GGNNEGSAEGLK 0.9407 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4394 0 0 0 0 0 0 0 13.5161 0 0 0 0 0 0 0 0 0 0 13.3305 0 0 0 0 13.3142 R8AR26 R8AR26_PLESH Uncharacterized protein (Fragment) PLESHI_08879 Plesiomonas shigelloides 302-73 ESVLRQINEGK 0.94916 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5626 14.1534 15.8946 0 13.8181 13.7036 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9695 14.5913 0 0 0 16.6828 16.3512 16.3169 16.3889 16.8298 16.9429 16.5538 16.7815 17.2482 15.8679 16.4247 16.9242 14.6308 16.0922 13.2007 0 0 0 13.6313 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.9921 17.2025 0 13.869 13.2218 0 0 0 0 0 0 0 0 0 0 0 0 0 16.7312 16.0541 16.687 R8AR31 R8AR31_PLESH Uncharacterized protein (Fragment) PLESHI_08829 Plesiomonas shigelloides 302-73 IAMEEEMK 0.76364 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.614 0 15.4715 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AR49 R8AR49_PLESH Major tail tube protein PLESHI_08574 Plesiomonas shigelloides 302-73 LENGKTVFHVDR 0.9442 0 0 0 0 0 15.5811 0 14.1866 0 13.7778 13.664 13.4971 0 0 0 0 0 0 14.5871 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6338 0 0 0 0 0 0 0 0 12.1091 0 0 0 12.7212 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5149 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.7616 0 13.5913 0 0 0 0 R8AR68 R8AR68_PLESH Uncharacterized protein PLESHI_08579 Plesiomonas shigelloides 302-73 AEYGLVDGASDGASDAVLMK 0.91667 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0181 0 0 0 0 13.379 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AR69 R8AR69_PLESH Uncharacterized protein PLESHI_08569 Plesiomonas shigelloides 302-73 ASGGNLLNR 0.94472 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9689 0 0 0 0 0 0 0 0 0 0 0 0 13.7047 14.2159 0 0 R8AR72 R8AR72_PLESH Tail assembly chaperone gp38 PLESHI_08559 Plesiomonas shigelloides 302-73 LCIEPDSGVVR 0.94946 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0979 0 0 0 12.9496 0 0 0 0 0 0 0 R8AR99 R8AR99_PLESH Lipoprotein PLESHI_08719 Plesiomonas shigelloides 302-73 FSVTMQGIWSSPEK 0.94045 0 0 0 0 0 0 15.0002 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.5142 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ARA6 R8ARA6_PLESH Cyclopropane-fatty-acyl-phospholipid synthase PLESHI_08734 Plesiomonas shigelloides 302-73 lipid biosynthetic process [GO:0008610] lipid biosynthetic process [GO:0008610] DQRYQVYRSQTDFIR 0.94204 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3638 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ARA9 R8ARA9_PLESH N-acetylmannosamine kinase (EC 2.7.1.60) PLESHI_08094 Plesiomonas shigelloides 302-73 N-acylmannosamine kinase activity [GO:0009384] N-acylmannosamine kinase activity [GO:0009384] GCVEAIASGR 0.94383 0 0 0 0 13.025 0 12.1178 0 14.4191 0 0 11.1878 0 0 0 0 0 0 0 12.3658 0 15.5278 14.5274 0 0 0 14.6545 14.2511 15.7065 15.9237 0 0 0 0 0 0 0 0 0 0 0 0 0 15.0639 15.2712 0 13.9877 12.6248 14.1509 15.698 0 0 0 15.3166 0 0 13.1819 0 0 0 13.9215 14.8944 14.8116 15.6528 0 0 0 0 0 0 15.0715 14.6528 0 0 0 0 14.1805 0 0 13.2101 12.4737 0 0 0 0 0 0 13.8811 0 14.5385 0 0 0 0 0 14.0091 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8046 13.1615 0 R8ARB1 R8ARB1_PLESH Na+/H+ antiporter NhaC PLESHI_08189 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; antiporter activity [GO:0015297] antiporter activity [GO:0015297] ILLLLALTFTVLIAMLDGWR 0.93902 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9447 12.9123 0 13.4628 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ARC5 R8ARC5_PLESH Oxidoreductase PLESHI_08169 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] EAQPTTQVSTQAS 0.93869 0 0 0 14.6684 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.8102 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1721 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7148 0 0 R8ARD1 R8ARD1_PLESH Putative alkaline protease secretion ATP-binding protein PLESHI_08209 Plesiomonas shigelloides 302-73 protein secretion by the type I secretion system [GO:0030253] integral component of membrane [GO:0016021]; type I protein secretion system complex [GO:0030256] integral component of membrane [GO:0016021]; type I protein secretion system complex [GO:0030256]; ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; peptidase activity [GO:0008233]; protein secretion by the type I secretion system [GO:0030253] ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; peptidase activity [GO:0008233] PAFVLLLVFSCVINLLMLAPAIYMLQVYDRVLVSK 0.9432 0 0 0 0 16.9465 16.9232 15.702 0 0 0 0 0 0 0 0 0 0 12.5476 14.9232 0 0 0 11.933 0 13.5613 11.3829 0 0 0 12.0381 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.1685 0 0 0 0 0 0 0 0 0 13.9439 14.7677 0 0 13.0893 0 13.7812 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.0112 15.2047 16.6427 0 14.5593 14.4526 R8ARE3 R8ARE3_PLESH Uncharacterized protein PLESHI_08269 Plesiomonas shigelloides 302-73 RLNNAWIVANK 0.93927 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.0677 0 0 0 0 0 0 0 R8ARH5 R8ARH5_PLESH Uncharacterized protein PLESHI_08404 Plesiomonas shigelloides 302-73 ANADTSR 0.93871 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5935 0 12.7063 0 0 0 11.9507 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ARK0 R8ARK0_PLESH Diguanylate cyclase PLESHI_07370 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] ALTSVLEQLQTVIRALRWR 0.94789 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3727 13.6446 0 0 0 0 0 0 R8ARL2 R8ARL2_PLESH Lipid A core-O-antigen ligase PLESHI_07505 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; ligase activity [GO:0016874] ligase activity [GO:0016874] AGKWDRLLGFAGFIVNLLAIVATQSR 0.94975 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.8867 11.7667 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ARR3 R8ARR3_PLESH DUF4123 domain-containing protein PLESHI_07755 Plesiomonas shigelloides 302-73 AAQLAEIQNKIGIEQ 0.94401 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5495 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7438 0 0 R8ARS0 R8ARS0_PLESH ABC transporter permease PLESHI_07725 Plesiomonas shigelloides 302-73 transmembrane transport [GO:0055085] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transport [GO:0055085] ALLQRTQRWR 0.93936 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.7861 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ARU0 R8ARU0_PLESH Endonuclease/exonuclease/phosphatase PLESHI_07825 Plesiomonas shigelloides 302-73 endonuclease activity [GO:0004519]; exonuclease activity [GO:0004527] endonuclease activity [GO:0004519]; exonuclease activity [GO:0004527] EIVQLPSGNREQR 0.93617 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.5123 0 0 0 0 R8ARU4 R8ARU4_PLESH Uncharacterized protein PLESHI_07820 Plesiomonas shigelloides 302-73 transmembrane transport [GO:0055085] integral component of plasma membrane [GO:0005887] integral component of plasma membrane [GO:0005887]; transmembrane transport [GO:0055085] DYLLLAIGLVLLVVGADGLVKGAAR 0.94043 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.828 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8345 0 0 0 0 0 R8ARV3 R8ARV3_PLESH Alpha-galactosidase (EC 3.2.1.22) PLESHI_07990 Plesiomonas shigelloides 302-73 carbohydrate catabolic process [GO:0016052] raffinose alpha-galactosidase activity [GO:0052692]; carbohydrate catabolic process [GO:0016052] raffinose alpha-galactosidase activity [GO:0052692] AGLALQTELQLDTHDVVK 0.94876 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1606 0 0 0 0 0 R8ARX4 R8ARX4_PLESH Putative ArsR family transcriptional regulator PLESHI_08030 Plesiomonas shigelloides 302-73 DNA-binding transcription factor activity [GO:0003700] DNA-binding transcription factor activity [GO:0003700] AECCVNSKQH 0.94584 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3819 0 13.4547 0 0 0 0 0 0 0 0 0 0 0 R8ARY1 R8ARY1_PLESH Uncharacterized protein PLESHI_08035 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] ALTSSTNAISLQTDANCCVRDENK 0.94868 0 0 0 13.0032 0 0 0 0 0 0 0 0 0 0 12.0044 0 0 0 0 0 0 0 0 0 0 0 10.7548 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8677 0 0 13.643 0 0 0 0 14.6355 14.579 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7841 0 0 0 0 0 12.2827 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ARY7 R8ARY7_PLESH Autolysin sensor kinase PLESHI_08045 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; phosphorelay sensor kinase activity [GO:0000155] phosphorelay sensor kinase activity [GO:0000155] HRQTEQDK 0.94444 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7533 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ARZ2 R8ARZ2_PLESH Thioredoxin PLESHI_07176 Plesiomonas shigelloides 302-73 glycerol ether metabolic process [GO:0006662] isomerase activity [GO:0016853]; protein-disulfide reductase activity [GO:0015035]; glycerol ether metabolic process [GO:0006662] isomerase activity [GO:0016853]; protein-disulfide reductase activity [GO:0015035] ATGPVLVDFWAEWCGPCKMIAPILDEIATEYQGK 0.94938 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0988 0 0 0 0 0 0 16.4642 0 0 0 0 0 0 0 0 R8AS44 R8AS44_PLESH Flagellar FliJ protein PLESHI_06764 Plesiomonas shigelloides 302-73 bacterial-type flagellum-dependent cell motility [GO:0071973]; bacterial-type flagellum organization [GO:0044781]; chemotaxis [GO:0006935]; protein transport [GO:0015031] bacterial-type flagellum [GO:0009288]; plasma membrane [GO:0005886] bacterial-type flagellum [GO:0009288]; plasma membrane [GO:0005886]; bacterial-type flagellum organization [GO:0044781]; bacterial-type flagellum-dependent cell motility [GO:0071973]; chemotaxis [GO:0006935]; protein transport [GO:0015031] LQQQQLQREAKR 0.91129 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5304 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7367 R8AS48 R8AS48_PLESH Flagellar P-ring protein (Basal body P-ring protein) flgI PLESHI_06709 Plesiomonas shigelloides 302-73 bacterial-type flagellum-dependent cell motility [GO:0071973] "bacterial-type flagellum basal body, distal rod, P ring [GO:0009428]; outer membrane-bounded periplasmic space [GO:0030288]" "bacterial-type flagellum basal body, distal rod, P ring [GO:0009428]; outer membrane-bounded periplasmic space [GO:0030288]; structural molecule activity [GO:0005198]; bacterial-type flagellum-dependent cell motility [GO:0071973]" structural molecule activity [GO:0005198] LKNVAAVAVSATLPPLAAK 0.94618 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.2983 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3214 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5074 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AS64 R8AS64_PLESH Flagellar biosynthesis protein FlhA flhA PLESHI_06824 Plesiomonas shigelloides 302-73 bacterial-type flagellum assembly [GO:0044780]; protein secretion [GO:0009306] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; bacterial-type flagellum assembly [GO:0044780]; protein secretion [GO:0009306] CALRRPLLYQLVGNR 0.94572 11.0751 0 11.103 15.1638 16.622 0 15.674 0 15.2341 14.3985 14.5935 15.6196 0 16.5179 16.7646 0 0 0 10.4952 0 0 0 0 0 0 14.9906 15.5839 15.1744 0 15.9786 0 0 0 0 0 0 0 0 12.0265 0 0 14.1811 14.2443 0 14.4197 0 0 0 11.7145 13.5983 13.6372 11.7237 12.8263 15.2015 15.2447 16.1515 16.3626 0 14.6184 14.9968 0 0 14.5926 0 0 14.0232 0 0 0 13.9584 0 0 0 0 0 0 0 0 15.1644 0 0 0 0 13.8409 14.6885 15.2524 14.6965 14.7809 16.8492 15.1035 15.6348 0 14.5555 0 13.1325 0 0 13.8122 0 0 0 0 0 0 0 14.5042 0 0 0 10.6554 11.118 11.6926 12.6742 14.7245 R8ASA4 R8ASA4_PLESH tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (Glucose-inhibited division protein A) mnmG gidA PLESHI_06919 Plesiomonas shigelloides 302-73 tRNA wobble uridine modification [GO:0002098] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; flavin adenine dinucleotide binding [GO:0050660]; tRNA wobble uridine modification [GO:0002098] flavin adenine dinucleotide binding [GO:0050660] EDNADLRLTETGR 0.9477 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17.92 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ASB0 R8ASB0_PLESH GDT1 family protein PLESHI_07009 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] AAAMVFAALGIITLLW 0.94309 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5122 12.2197 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.6289 0 0 R8ASC4 R8ASC4_PLESH Uncharacterized protein PLESHI_07019 Plesiomonas shigelloides 302-73 ILSATIYLK 0.94199 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3883 16.1899 0 16.0697 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.9215 15.7167 0 R8ASH5 R8ASH5_PLESH Uncharacterized protein PLESHI_06334 Plesiomonas shigelloides 302-73 transposition [GO:0032196] transposition [GO:0032196] LVCDAAVRNAFAEAK 0.9461 0 0 0 12.9621 0 0 0 0 0 0 0 0 0 14.8679 0 0 0 0 0 16.2441 16.3358 0 13.4458 0 0 16.4129 0 15.6577 16.6612 16.4972 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.325 14.4823 0 0 0 13.3257 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.2207 0 0 0 0 0 0 0 0 13.579 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 19.1459 0 0 0 0 R8ASL5 R8ASL5_PLESH Aspartate--ammonia ligase (EC 6.3.1.1) (Asparagine synthetase A) asnA PLESHI_06222 Plesiomonas shigelloides 302-73 L-asparagine biosynthetic process [GO:0070981] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; aspartate-ammonia ligase activity [GO:0004071]; ATP binding [GO:0005524]; L-asparagine biosynthetic process [GO:0070981] aspartate-ammonia ligase activity [GO:0004071]; ATP binding [GO:0005524] LTMLLLQR 0.68627 0 0 0 0 0 0 0 15.4362 0 0 0 0 0 14.0078 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.9365 14.739 0 14.7627 14.8013 14.3869 13.7186 14.6755 15.1501 13.2539 14.112 0 14.1217 13.8421 13.0099 0 0 0 0 0 11.6401 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ASM0 R8ASM0_PLESH SWI/SNF family helicase PLESHI_06242 Plesiomonas shigelloides 302-73 ATP binding [GO:0005524]; helicase activity [GO:0004386] ATP binding [GO:0005524]; helicase activity [GO:0004386] ALYEQAR 0.94211 0 0 0 0 0 0 0 0 12.0492 0 10.9718 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5942 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.6157 0 0 0 0 0 0 0 14.897 0 0 0 12.733 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5525 12.2337 0 0 13.2897 0 0 13.9929 0 0 0 R8ASN7 R8ASN7_PLESH Uncharacterized protein PLESHI_05832 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] MTTSQQYARCSR 0.94856 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.272 15.2973 15.4893 0 0 0 R8ASR4 R8ASR4_PLESH Chorismate pyruvate-lyase (CL) (CPL) (EC 4.1.3.40) ubiC PLESHI_05957 Plesiomonas shigelloides 302-73 pyruvate biosynthetic process [GO:0042866]; ubiquinone biosynthetic process [GO:0006744] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; chorismate lyase activity [GO:0008813]; pyruvate biosynthetic process [GO:0042866]; ubiquinone biosynthetic process [GO:0006744] chorismate lyase activity [GO:0008813] EVILCGDGEPWIYAR 0.94835 0 0 0 0 0 0 0 13.6705 0 0 0 0 0 0 0 0 0 12.2119 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.7411 0 0 0 0 0 0 0 0 11.2825 0 12.9871 0 11.4084 0 13.6876 12.497 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ASS4 R8ASS4_PLESH Inner-membrane translocator PLESHI_06007 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transporter activity [GO:0022857] transmembrane transporter activity [GO:0022857] DVMAFALLISVLLFMPSGILGR 0.94866 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8239 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ASS9 R8ASS9_PLESH Flagellar protein FliL PLESHI_05962 Plesiomonas shigelloides 302-73 bacterial-type flagellum-dependent cell motility [GO:0071973]; chemotaxis [GO:0006935] bacterial-type flagellum basal body [GO:0009425]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] bacterial-type flagellum basal body [GO:0009425]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; bacterial-type flagellum-dependent cell motility [GO:0071973]; chemotaxis [GO:0006935] EATRKACLEK 0.94187 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.888 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AST8 R8AST8_PLESH Leucine/isoleucine/valine transporter ATP-binding subunit livG PLESHI_05997 Plesiomonas shigelloides 302-73 ATP binding [GO:0005524] ATP binding [GO:0005524] HHPDVIRAYLGEA 0.9474 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1938 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2658 0 0 0 0 R8ASU3 R8ASU3_PLESH Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) PLESHI_05602 Plesiomonas shigelloides 302-73 peptidyl-prolyl cis-trans isomerase activity [GO:0003755] peptidyl-prolyl cis-trans isomerase activity [GO:0003755] IAKDVVVSLAYQVR 0.91034 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.469 0 0 0 0 0 0 0 12.4567 0 0 0 0 0 0 15.0533 0 0 0 0 0 0 0 0 0 0 R8ASU6 R8ASU6_PLESH Sulfur relay protein TusC PLESHI_05572 Plesiomonas shigelloides 302-73 KRIAFVFTHAPHGR 0.94719 0 0 0 0 0 0 0 0 0 0 0 15.2269 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.8056 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8941 0 0 0 0 0 0 0 0 0 0 0 0 0 16.6796 18.3079 14.5571 0 15.0091 14.4091 0 0 0 0 0 17.194 0 0 0 0 0 0 0 13.3509 0 0 0 0 0 0 0 0 0 0 0 0 12.2589 0 0 0 0 0 0 0 0 0 0 0 R8ASV6 R8ASV6_PLESH ABC transporter ATP-binding protein PLESHI_05622 Plesiomonas shigelloides 302-73 ATP binding [GO:0005524] ATP binding [GO:0005524] AKASKAK 0.94776 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.1265 17.1807 14.6709 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.0106 0 0 14.1467 0 14.564 13.8127 0 0 0 R8AT48 R8AT48_PLESH DNA topoisomerase (ATP-hydrolyzing) (EC 5.6.2.2) PLESHI_04827 Plesiomonas shigelloides 302-73 DNA topological change [GO:0006265] chromosome [GO:0005694] "chromosome [GO:0005694]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity [GO:0003918]; DNA topological change [GO:0006265]" "ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity [GO:0003918]" DGQIYSIVFADGEK 0.94391 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.4748 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4734 0 0 0 0 0 0 0 11.6982 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8653 0 14.7609 13.3726 0 R8AT74 R8AT74_PLESH SecA regulator SecM PLESHI_04937 Plesiomonas shigelloides 302-73 MSILIRCVQFGR 0.94714 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.8394 0 0 0 0 0 16.292 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.6122 15.4965 0 0 0 0 0 0 0 13.1569 0 0 0 0 0 0 0 0 0 0 0 12.7184 0 12.6319 0 0 0 0 0 0 13.0371 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AT77 R8AT77_PLESH Cell division protein FtsQ ftsQ PLESHI_04962 Plesiomonas shigelloides 302-73 cell septum assembly [GO:0090529]; FtsZ-dependent cytokinesis [GO:0043093] cell division site [GO:0032153]; integral component of plasma membrane [GO:0005887] cell division site [GO:0032153]; integral component of plasma membrane [GO:0005887]; cell septum assembly [GO:0090529]; FtsZ-dependent cytokinesis [GO:0043093] ANPVTTNQANTKSG 0.81707 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4141 0 12.1094 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0479 0 12.4037 0 0 0 0 0 14.6847 0 0 0 0 0 0 0 0 12.9843 0 0 R8AT89 R8AT89_PLESH Serine endoprotease PLESHI_05107 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; serine-type endopeptidase activity [GO:0004252] serine-type endopeptidase activity [GO:0004252] DGKEMTLPVTITEYPIH 0.94737 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4622 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.128 0 0 0 0 0 0 R8ATA2 R8ATA2_PLESH Cell division protein ZapE (Z ring-associated protein ZapE) zapE PLESHI_05092 Plesiomonas shigelloides 302-73 cell cycle [GO:0007049]; cell division [GO:0051301] cytoplasm [GO:0005737] cytoplasm [GO:0005737]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cell cycle [GO:0007049]; cell division [GO:0051301] ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887] ARFLPAIAQIK 0.94923 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1789 13.6139 14.7382 0 13.0158 0 13.7194 13.7103 12.7911 14.449 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.2452 0 R8ATB9 R8ATB9_PLESH Peptidase PmbA PLESHI_05202 Plesiomonas shigelloides 302-73 metallopeptidase activity [GO:0008237] metallopeptidase activity [GO:0008237] DAADLMSPQWVGEECARR 0.94733 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0918 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7712 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0753 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4519 R8ATD3 R8ATD3_PLESH "Glutamate-1-semialdehyde 2,1-aminomutase (GSA) (EC 5.4.3.8) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT)" hemL PLESHI_04677 Plesiomonas shigelloides 302-73 protoporphyrinogen IX biosynthetic process [GO:0006782] cytoplasm [GO:0005737] "cytoplasm [GO:0005737]; glutamate-1-semialdehyde 2,1-aminomutase activity [GO:0042286]; pyridoxal phosphate binding [GO:0030170]; transaminase activity [GO:0008483]; protoporphyrinogen IX biosynthetic process [GO:0006782]" "glutamate-1-semialdehyde 2,1-aminomutase activity [GO:0042286]; pyridoxal phosphate binding [GO:0030170]; transaminase activity [GO:0008483]" LARGFTNRDK 0.94261 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6221 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7869 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5149 0 0 0 0 0 0 R8ATF6 R8ATF6_PLESH Methyl-accepting chemotaxis protein PLESHI_04565 Plesiomonas shigelloides 302-73 chemotaxis [GO:0006935]; signal transduction [GO:0007165] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane signaling receptor activity [GO:0004888]; chemotaxis [GO:0006935]; signal transduction [GO:0007165] transmembrane signaling receptor activity [GO:0004888] AGEQGRGFAVVADEVRQLAQR 0.70213 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3297 0 0 0 0 0 0 0 13.4525 0 0 0 0 0 0 0 0 0 0 0 R8ATG1 R8ATG1_PLESH Phosphate transporter PLESHI_04590 Plesiomonas shigelloides 302-73 phosphate ion transport [GO:0006817] integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; inorganic phosphate transmembrane transporter activity [GO:0005315]; phosphate ion transport [GO:0006817] inorganic phosphate transmembrane transporter activity [GO:0005315] FAAKAESENGFAGVER 0.94796 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5158 0 0 14.3403 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.9646 0 0 0 0 0 0 0 0 0 14.7589 0 0 10.7352 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.04 R8ATH3 R8ATH3_PLESH Uncharacterized protein PLESHI_04580 Plesiomonas shigelloides 302-73 triphosphatase activity [GO:0050355] triphosphatase activity [GO:0050355] CPRLPAFTLQRK 0.91447 0 0 0 0 0 0 0 13.9963 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3068 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ATI2 R8ATI2_PLESH Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) plsY PLESHI_04630 Plesiomonas shigelloides 302-73 phospholipid biosynthetic process [GO:0008654] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; acyl-phosphate glycerol-3-phosphate acyltransferase activity [GO:0043772]; phospholipid biosynthetic process [GO:0008654] acyl-phosphate glycerol-3-phosphate acyltransferase activity [GO:0043772] LAGLPDPRETGSGNPGATNVLR 0.94919 0 0 0 0 0 0 0 0 0 0 12.6739 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.3463 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3746 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ATI4 R8ATI4_PLESH Bifunctional glutamine synthetase adenylyltransferase/adenylyl-removing enzyme (ATP:glutamine synthetase adenylyltransferase) (ATase) [Includes: Glutamine synthetase adenylyl-L-tyrosine phosphorylase (EC 2.7.7.89) (Adenylyl removase) (AR) (AT-N); Glutamine synthetase adenylyl transferase (EC 2.7.7.42) (Adenylyl transferase) (AT) (AT-C)] glnE PLESHI_04560 Plesiomonas shigelloides 302-73 metabolic process [GO:0008152]; regulation of glutamine family amino acid metabolic process [GO:0000820] [glutamate-ammonia-ligase] adenylyltransferase activity [GO:0008882]; [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [GO:0047388]; ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]; metabolic process [GO:0008152]; regulation of glutamine family amino acid metabolic process [GO:0000820] [glutamate-ammonia-ligase] adenylyltransferase activity [GO:0008882]; [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [GO:0047388]; ATP binding [GO:0005524]; magnesium ion binding [GO:0000287] ALDNAQFFTRLGQR 0.94087 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.0037 0 0 0 R8ATL8 R8ATL8_PLESH Ancillary SecYEG translocon subunit PLESHI_03962 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; protein-containing complex binding [GO:0044877] protein-containing complex binding [GO:0044877] GDILLSK 0.9485 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9088 0 12.7686 0 12.7051 14.4057 0 13.5757 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.2435 0 0 0 0 0 0 0 0 13.925 13.8908 14.9665 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6057 0 0 0 0 0 0 0 0 R8ATM4 R8ATM4_PLESH Glucosamine-link cellobiase PLESHI_04433 Plesiomonas shigelloides 302-73 polysaccharide catabolic process [GO:0000272] cellulase activity [GO:0008810]; polysaccharide catabolic process [GO:0000272] cellulase activity [GO:0008810] GGVCNGITAGFEDEADLDFK 0.92949 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4196 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0904 0 15.5747 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3935 0 0 R8ATU0 R8ATU0_PLESH PTS permease protein PLESHI_04312 Plesiomonas shigelloides 302-73 phosphoenolpyruvate-dependent sugar phosphotransferase system [GO:0009401] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; phosphoenolpyruvate-dependent sugar phosphotransferase system [GO:0009401] AGTAAMVNMSASTEKLAK 0.94772 0 0 0 0 0 0 0 12.0423 0 0 0 0 0 0 0 0 0 0 0 0 0 11.7124 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.0512 0 0 0 0 0 0 0 0 15.1785 0 15.2998 0 0 0 0 0 0 0 0 0 0 0 14.5981 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8ATW8 R8ATW8_PLESH N-acetylglucosamine-6-phosphate deacetylase PLESHI_04302 Plesiomonas shigelloides 302-73 carbohydrate metabolic process [GO:0005975]; N-acetylglucosamine metabolic process [GO:0006044] metal ion binding [GO:0046872]; N-acetylglucosamine-6-phosphate deacetylase activity [GO:0008448]; carbohydrate metabolic process [GO:0005975]; N-acetylglucosamine metabolic process [GO:0006044] metal ion binding [GO:0046872]; N-acetylglucosamine-6-phosphate deacetylase activity [GO:0008448] AGHDVMDASPEALQK 0.94954 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7773 13.4823 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7124 0 0 14.4611 0 0 0 R8ATX0 R8ATX0_PLESH Protein lysine acetyltransferase PLESHI_03805 Plesiomonas shigelloides 302-73 ATP binding [GO:0005524]; metal ion binding [GO:0046872]; N-acetyltransferase activity [GO:0008080] ATP binding [GO:0005524]; metal ion binding [GO:0046872]; N-acetyltransferase activity [GO:0008080] AGYLMMR 0.93824 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.9793 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0563 0 0 0 0 0 0 0 0 0 0 0 0 R8AU17 R8AU17_PLESH Phosphate-binding protein PLESHI_03721 Plesiomonas shigelloides 302-73 cell adhesion [GO:0007155]; phosphate ion transport [GO:0006817] extracellular region [GO:0005576]; periplasmic space [GO:0042597] extracellular region [GO:0005576]; periplasmic space [GO:0042597]; phosphate ion binding [GO:0042301]; cell adhesion [GO:0007155]; phosphate ion transport [GO:0006817] phosphate ion binding [GO:0042301] DNPIKGLNFEQLDAIYSTTLKCGANEQVTR 0.94801 0 0 0 0 10.0434 14.1437 0 0 15.3698 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7088 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2711 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.5816 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AU31 R8AU31_PLESH Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) purN PLESHI_03661 Plesiomonas shigelloides 302-73 'de novo' IMP biosynthetic process [GO:0006189] phosphoribosylglycinamide formyltransferase activity [GO:0004644]; 'de novo' IMP biosynthetic process [GO:0006189] phosphoribosylglycinamide formyltransferase activity [GO:0004644] LQYQNQQALMDGEPLPAQGYAAE 0.94698 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7839 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AU53 R8AU53_PLESH L-fuculose phosphate aldolase (EC 4.1.2.17) (D-ribulose-phosphate aldolase) (L-fuculose-1-phosphate aldolase) fucA PLESHI_03276 Plesiomonas shigelloides 302-73 arabinose catabolic process [GO:0019568]; L-fucose catabolic process [GO:0042355] L-fuculose-phosphate aldolase activity [GO:0008738]; zinc ion binding [GO:0008270]; arabinose catabolic process [GO:0019568]; L-fucose catabolic process [GO:0042355] L-fuculose-phosphate aldolase activity [GO:0008738]; zinc ion binding [GO:0008270] LPSSEWRFHLAAYQTR 0.94346 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.2021 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8774 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3949 15.0541 0 R8AU73 R8AU73_PLESH "Type VI secretion protein, VC_A0107 family" PLESHI_03376 Plesiomonas shigelloides 302-73 EALVALK 0.93892 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0381 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AUA6 R8AUA6_PLESH Nicotinamidase-like amidase PLESHI_03069 Plesiomonas shigelloides 302-73 TFADSFVKTTLEQVLSERGVSR 0.94595 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3161 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.4247 0 0 0 R8AUE0 R8AUE0_PLESH RNA polymerase sigma factor FliA (RNA polymerase sigma factor for flagellar operon) (Sigma F) (Sigma-28) fliA PLESHI_02729 Plesiomonas shigelloides 302-73 "DNA-templated transcription, initiation [GO:0006352]" cytoplasm [GO:0005737] "cytoplasm [GO:0005737]; DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; sigma factor activity [GO:0016987]; DNA-templated transcription, initiation [GO:0006352]" DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; sigma factor activity [GO:0016987] EALVLSLYYDEELNLK 0.94988 0 0 0 0 0 0 14.8771 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3741 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AUE8 R8AUE8_PLESH Chemotaxis protein CheA (Fragment) PLESHI_02714 Plesiomonas shigelloides 302-73 phosphorelay signal transduction system [GO:0000160] protein kinase activity [GO:0004672]; phosphorelay signal transduction system [GO:0000160] protein kinase activity [GO:0004672] GFHTVKGGAGFLSLTSLVDTCHGAENVFDVLR 0.058824 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.752 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 19.1082 19.3972 18.4735 17.5217 17.6822 14.5472 16.442 17.8952 16.6058 19.2103 18.7789 18.5847 16.3044 15.2632 15.68 0 0 0 13.3997 14.4816 12.4201 13.1954 0 12.5631 0 0 0 0 0 0 14.4138 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 18.647 18.9541 21.1707 17.5761 15.2828 0 R8AUF1 R8AUF1_PLESH Acetyltransferase PLESHI_02859 Plesiomonas shigelloides 302-73 "acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]" "acyltransferase activity, transferring groups other than amino-acyl groups [GO:0016747]" LIKRLIFFWSAPR 0.93617 0 0 0 14.3934 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.4919 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.0487 0 0 0 0 17.9042 0 16.097 0 14.1671 0 0 14.8875 14.7928 0 13.9566 0 0 0 0 R8AUG8 R8AUG8_PLESH Putative aminotransferase PLESHI_02899 Plesiomonas shigelloides 302-73 transaminase activity [GO:0008483] transaminase activity [GO:0008483] EPEYAHSNYWLNAVICPDK 0.9474 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.5381 0 15.0381 0 0 0 0 13.4672 12.5764 0 15.5012 15.1902 13.2189 0 0 0 13.1736 0 0 0 0 0 0 0 0 0 0 0 0 0 12.5749 12.5595 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1562 0 0 0 0 0 17.3163 17.6728 17.0088 16.5584 14.4027 0 R8AUS5 R8AUS5_PLESH Aromatic amino acid permease PLESHI_01062 Plesiomonas shigelloides 302-73 integral component of plasma membrane [GO:0005887] integral component of plasma membrane [GO:0005887]; aromatic amino acid transmembrane transporter activity [GO:0015173] aromatic amino acid transmembrane transporter activity [GO:0015173] FDDSLLGRTK 0.73333 0 0 0 0 0 0 0 14.876 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AUS8 R8AUS8_PLESH "Transcriptional regulator, LacI family protein" PLESHI_01097 Plesiomonas shigelloides 302-73 "regulation of transcription, DNA-templated [GO:0006355]" "DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]" DNA binding [GO:0003677] GYQTMLAHYGYSPQMEEQR 0.94923 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.338 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1553 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15.6851 0 0 13.531 0 0 0 0 0 0 0 0 R8AUW4 R8AUW4_PLESH Probable phosphatase PLESHI_01302 (EC 3.1.3.-) PLESHI_01302 Plesiomonas shigelloides 302-73 phosphatase activity [GO:0016791]; zinc ion binding [GO:0008270] phosphatase activity [GO:0016791]; zinc ion binding [GO:0008270] GIEANIRNRQGEIDCSEK 0.94853 0 0 12.0341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4849 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.7787 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1284 0 14.985 13.9873 0 0 0 0 0 0 0 0 R8AUY0 R8AUY0_PLESH Phage shock protein C PLESHI_01217 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] LEGYVTSETFK 0.9451 0 0 0 0 13.1293 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0128 0 0 12.3119 13.2309 0 0 0 0 12.1679 0 13.9634 14.3311 14.1205 0 0 0 0 13.9286 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6654 0 0 0 12.8013 12.4309 0 0 0 0 0 0 0 0 12.9243 0 0 13.4376 0 0 0 0 0 0 0 0 0 0 0 14.5829 15.0796 0 12.0719 0 12.4457 R8AV09 R8AV09_PLESH Ribosomal-protein-S5-alanine N-acetyltransferase PLESHI_01547 Plesiomonas shigelloides 302-73 N-acetyltransferase activity [GO:0008080] N-acetyltransferase activity [GO:0008080] AYLKPWEPARDESHFR 0.94435 0 0 0 0 0 0 16.2032 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.2699 0 0 0 0 0 11.2089 0 15.5393 0 0 14.5493 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.9083 0 0 0 0 0 0 0 0 13.6095 0 0 15.7988 0 0 0 0 0 0 R8AV34 R8AV34_PLESH Methylglyoxal synthase (MGS) (EC 4.2.3.3) mgsA PLESHI_01672 Plesiomonas shigelloides 302-73 methylglyoxal biosynthetic process [GO:0019242] methylglyoxal synthase activity [GO:0008929]; methylglyoxal biosynthetic process [GO:0019242] methylglyoxal synthase activity [GO:0008929] IDVLFFFWDPLNAVPHDPDVK 0.94991 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.9342 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3453 0 0 0 0 10.8339 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AV37 R8AV37_PLESH Uncharacterized protein PLESHI_01492 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] ISALYAVLGALLLIK 0.94526 0 0 0 0 0 11.3782 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.315 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.6116 0 0 0 0 0 12.0967 12.4592 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.6281 0 0 0 0 R8AV51 R8AV51_PLESH Uncharacterized protein PLESHI_01567 Plesiomonas shigelloides 302-73 VKYNATTLKILK 0.94781 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8398 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.4757 15.2975 13.9387 13.0933 13.1376 0 0 0 0 0 14.7308 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AV68 R8AV68_PLESH Thioredoxin domain-containing protein PLESHI_01827 Plesiomonas shigelloides 302-73 DILERAQHTPVVFDFWAEWCSHCK 0.93871 0 0 0 0 14.0528 0 0 13.9128 0 0 0 0 11.0588 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8897 0 0 0 0 0 0 9.26177 0 0 0 0 0 0 0 0 0 0 11.4483 13.8537 0 0 0 0 13.9626 0 0 0 13.7258 0 0 0 0 10.9024 0 0 0 10.649 0 0 0 12.3814 0 0 0 0 0 0 0 0 0 0 10.2098 0 0 11.019 0 0 0 0 0 11.9096 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.2835 0 14.8901 0 0 0 0 0 0 0 R8AV87 R8AV87_PLESH Carboxypeptidase PLESHI_02007 Plesiomonas shigelloides 302-73 metallocarboxypeptidase activity [GO:0004181] metallocarboxypeptidase activity [GO:0004181] NLLLPLIR 0.82812 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 18.0168 0 0 0 0 0 0 0 0 R8AVB2 R8AVB2_PLESH Uncharacterized protein PLESHI_01987 Plesiomonas shigelloides 302-73 ADVNIGWLHKTFAAGESR 0.94997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.047 0 0 0 0 0 R8AVH6 R8AVH6_PLESH Acetyltransferase PLESHI_02357 Plesiomonas shigelloides 302-73 N-acetyltransferase activity [GO:0008080] N-acetyltransferase activity [GO:0008080] IDTVRNDYLPASSTWVYCEDDEVKGFYSLLENK 0.93695 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.3966 0 0 0 13.569 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16.7095 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.1399 0 0 0 0 0 0 R8AVI6 R8AVI6_PLESH MORN repeat-containing protein PLESHI_02247 Plesiomonas shigelloides 302-73 ALRTLQPQDYR 0.94591 0 0 0 0 0 0 0 0 0 0 11.7575 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8166 0 0 0 0 0 0 0 0 0 0 0 0 13.6001 0 0 12.9078 0 0 0 0 0 0 0 0 0 13.1153 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AVJ0 R8AVJ0_PLESH Uncharacterized protein PLESHI_02272 Plesiomonas shigelloides 302-73 ALAWKVPAR 0.94155 0 0 0 0 0 0 13.8392 0 0 14.9656 0 14.647 0 0 0 0 0 0 0 0 0 0 0 0 0 13.013 12.9784 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.8192 0 0 0 14.6414 0 0 0 0 0 0 0 0 0 0 R8AVJ6 R8AVJ6_PLESH Uncharacterized protein PLESHI_02442 Plesiomonas shigelloides 302-73 DEQEGEQRYLDQFSHSADTLR 0.94593 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9401 0 0 12.5542 0 11.9817 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.098 0 0 0 0 0 0 0 13.0575 0 0 0 0 0 0 0 0 0 0 0 12.9111 0 0 0 0 13.8924 0 0 0 0 13.4441 13.9987 0 0 0 R8AVN0 R8AVN0_PLESH Myo-inositol catabolism IolB domain-containing protein PLESHI_02617 Plesiomonas shigelloides 302-73 inositol catabolic process [GO:0019310] glucuronate isomerase activity [GO:0008880]; inositol catabolic process [GO:0019310] glucuronate isomerase activity [GO:0008880] GRGHNRR 0.94499 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.5205 0 0 0 0 0 0 0 0 0 0 0 0 12.28 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.9629 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AVN5 R8AVN5_PLESH Cyclic nucleotide binding protein PLESHI_02642 Plesiomonas shigelloides 302-73 [protein-PII] uridylyltransferase activity [GO:0008773] [protein-PII] uridylyltransferase activity [GO:0008773] AVELMMQHNVR 0.94078 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0961 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3001 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AVN6 R8AVN6_PLESH tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC (tRNA mnm(5)s(2)U biosynthesis bifunctional protein) [Includes: tRNA (mnm(5)s(2)U34)-methyltransferase (EC 2.1.1.61); FAD-dependent cmnm(5)s(2)U34 oxidoreductase (EC 1.5.-.-)] mnmC PLESHI_02497 Plesiomonas shigelloides 302-73 tRNA wobble base modification [GO:0002097] cytoplasm [GO:0005737] "cytoplasm [GO:0005737]; flavin adenine dinucleotide binding [GO:0050660]; oxidoreductase activity, acting on the CH-NH group of donors [GO:0016645]; tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity [GO:0004808]; tRNA wobble base modification [GO:0002097]" "flavin adenine dinucleotide binding [GO:0050660]; oxidoreductase activity, acting on the CH-NH group of donors [GO:0016645]; tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity [GO:0004808]" DSDQQENLAK 0.9473 0 0 0 16.9872 0 0 0 15.4777 0 0 0 0 0 12.677 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3908 0 0 0 0 0 0 0 0 11.9969 0 0 0 0 0 0 0 0 0 14.905 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0904 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4463 0 0 0 0 0 0 R8AVQ7 R8AVQ7_PLESH Uncharacterized protein PLESHI_00400 Plesiomonas shigelloides 302-73 GDGACRHYDDQTRLCIIYNSR 0.94795 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0731 13.1125 0 0 0 13.2573 0 0 13.498 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5981 0 12.3673 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.0964 12.4279 0 0 0 0 0 16.2534 0 0 0 0 0 0 R8AVS5 R8AVS5_PLESH Transporter PLESHI_00405 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021]; secondary active sulfate transmembrane transporter activity [GO:0008271] secondary active sulfate transmembrane transporter activity [GO:0008271] AEQDSHSL 0.94395 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.3372 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AVS6 R8AVS6_PLESH Uncharacterized protein PLESHI_00270 Plesiomonas shigelloides 302-73 IEEHLHAFRLFSEDKIFSSCR 0.93718 0 0 0 0 0 0 0 0 0 13.7113 0 0 13.8683 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8959 0 0 0 0 0 0 0 14.3854 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AVV0 R8AVV0_PLESH Ion-translocating oxidoreductase complex subunit A (EC 7.-.-.-) (Rnf electron transport complex subunit A) rnfA PLESHI_00625 Plesiomonas shigelloides 302-73 electron transport chain [GO:0022900] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886] integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; electron transport chain [GO:0022900] FLGLCPFMGVSK 0.94599 0 0 0 0 0 0 0 0 0 0 0 0 0 11.8738 0 0 0 13.5264 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10.9725 0 13.1222 0 0 0 0 0 0 0 0 0 0 0 12.446 0 0 13.8383 0 0 0 0 12.5059 0 0 0 0 0 0 0 0 0 0 0 14.8155 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.4029 0 12.9295 0 R8AVX0 R8AVX0_PLESH Uncharacterized protein PLESHI_00210 Plesiomonas shigelloides 302-73 integral component of membrane [GO:0016021] integral component of membrane [GO:0016021] EAEYLAIR 0.94648 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.0312 0 13.3396 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.3086 R8AVX3 R8AVX3_PLESH Ion-translocating oxidoreductase complex subunit B (EC 7.-.-.-) (Rnf electron transport complex subunit B) rnfB PLESHI_00630 Plesiomonas shigelloides 302-73 plasma membrane [GO:0005886] "plasma membrane [GO:0005886]; 4 iron, 4 sulfur cluster binding [GO:0051539]; electron transfer activity [GO:0009055]; metal ion binding [GO:0046872]" "4 iron, 4 sulfur cluster binding [GO:0051539]; electron transfer activity [GO:0009055]; metal ion binding [GO:0046872]" PYAEAVSNGEQINK 0.93808 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.6422 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.4434 0 0 0 0 0 0 0 0 0 0 0 0 0 14.3926 0 14.1629 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R8AVX4 R8AVX4_PLESH Uncharacterized protein PLESHI_00170 Plesiomonas shigelloides 302-73 CNIDNLADFEFAHIQSVVTNPR 0.94388 0 0 0 0 0 0 13.1945 0 0 0 0 0 0 0 0 0 0 11.8235 12.4642 0 0 0 0 0 0 14.4237 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.5045 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.9335 14.3268 0 14.7015 15.2718 15.6636 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.2706 0 0 9.82029 0 0 0 13.9941 0 0 14.3465 15.2578 R8AVX5 R8AVX5_PLESH NAD-dependent malic enzyme (NAD-ME) (EC 1.1.1.38) maeA PLESHI_00520 Plesiomonas shigelloides 302-73 malate dehydrogenase (decarboxylating) (NAD+) activity [GO:0004471]; metal ion binding [GO:0046872]; NAD binding [GO:0051287]; oxaloacetate decarboxylase activity [GO:0008948] malate dehydrogenase (decarboxylating) (NAD+) activity [GO:0004471]; metal ion binding [GO:0046872]; NAD binding [GO:0051287]; oxaloacetate decarboxylase activity [GO:0008948] AEGLSDEEARAQVFMVDR 0.94337 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.8723 0 0 0 0 0 R8AVY2 R8AVY2_PLESH Cupin_2 domain-containing protein (Fragment) PLESHI_00120 Plesiomonas shigelloides 302-73 PLHGIHIPAK 0.94444 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11.6766 0 14.3151 0 12.8038 0 13.2046 0 0 0 0 0 0 0 0 0 0 R8AVZ9 R8AVZ9_PLESH Uncharacterized protein PLESHI_00260 Plesiomonas shigelloides 302-73 FFIEERAISDIEMLHGVNQFK 0.94418 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.7148 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12.9514 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 14.1705 0 0 0 0 0 0 0 0 0 0 17.1354 16.9715 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13.2988 0 0 0 12.9611