Majority protein IDs	Entry name	Protein names	Gene names	Organism	Gene ontology (biological process)	Gene ontology (cellular component)	Gene ontology (GO)	Gene ontology (molecular function)	Peptide sequences	Q-value	Intensity ABF group_1_RC4_01_24000	Intensity ABF group_1_RC4_01_24001	Intensity ABF group_1_RC4_01_24002	Intensity ABF group_10_RD5_01_24030	Intensity ABF group_10_RD5_01_24031	Intensity ABF group_10_RD5_01_24032	Intensity ABF group_11_RD6_01_24033	Intensity ABF group_11_RD6_01_24034	Intensity ABF group_11_RD6_01_24035	Intensity ABF group_12_RD7_01_24036	Intensity ABF group_12_RD7_01_24037	Intensity ABF group_12_RD7_01_24038	Intensity ABF group_13_RD8_01_24040	Intensity ABF group_13_RD8_01_24041	Intensity ABF group_13_RD8_01_24042	Intensity ABF group_14_RE1_01_24043	Intensity ABF group_14_RE1_01_24044	Intensity ABF group_14_RE1_01_24045	Intensity ABF group_15_RE2_01_24046	Intensity ABF group_15_RE2_01_24047	Intensity ABF group_15_RE2_01_24048	Intensity ABF group_16_RE3_01_24050	Intensity ABF group_16_RE3_01_24051	Intensity ABF group_16_RE3_01_24052	Intensity ABF group_17_RE4_01_24053	Intensity ABF group_17_RE4_01_24054	Intensity ABF group_17_RE4_01_24055	Intensity ABF group_18_RE5_01_24056	Intensity ABF group_18_RE5_01_24057	Intensity ABF group_18_RE5_01_24058	Intensity ABF group_2_RC5_01_24003	Intensity ABF group_2_RC5_01_24004	Intensity ABF group_2_RC5_01_24005	Intensity ABF group_3_RC6_01_24006	Intensity ABF group_3_RC6_01_24007	Intensity ABF group_3_RC6_01_24008	Intensity ABF group_4_RC7_01_24010	Intensity ABF group_4_RC7_01_24011	Intensity ABF group_4_RC7_01_24012	Intensity ABF group_5_RC8_01_24013	Intensity ABF group_5_RC8_01_24014	Intensity ABF group_5_RC8_01_24015	Intensity ABF group_6_RD1_01_24016	Intensity ABF group_6_RD1_01_24017	Intensity ABF group_6_RD1_01_24018	Intensity ABF group_7_RD2_01_24020	Intensity ABF group_7_RD2_01_24021	Intensity ABF group_7_RD2_01_24022	Intensity ABF group_8_RD3_01_24023	Intensity ABF group_8_RD3_01_24024	Intensity ABF group_8_RD3_01_24025	Intensity ABF group_9_RD4_01_24026	Intensity ABF group_9_RD4_01_24027	Intensity ABF group_9_RD4_01_24028	Intensity Normal group_1_BE6_01_23925	Intensity Normal group_1_BE6_01_23926	Intensity Normal group_1_BE6_01_23927	Intensity Normal group_10_RA7_01_23955	Intensity Normal group_10_RA7_01_23956	Intensity Normal group_10_RA7_01_23957	Intensity Normal group_11_RA8_01_23958	Intensity Normal group_11_RA8_01_23959	Intensity Normal group_11_RA8_01_23960	Intensity Normal group_12_RB1_01_23961	Intensity Normal group_12_RB1_01_23962	Intensity Normal group_12_RB1_01_23963	Intensity Normal group_13_RB2_01_23965	Intensity Normal group_13_RB2_01_23966	Intensity Normal group_13_RB2_01_23967	Intensity Normal group_14_RB3_01_23968	Intensity Normal group_14_RB3_01_23969	Intensity Normal group_14_RB3_01_23970	Intensity Normal group_15_RB4_01_23971	Intensity Normal group_15_RB4_01_23972	Intensity Normal group_15_RB4_01_23973	Intensity Normal group_16_RB5_01_23975	Intensity Normal group_16_RB5_01_23976	Intensity Normal group_16_RB5_01_23977	Intensity Normal group_17_RB6_01_23978	Intensity Normal group_17_RB6_01_23979	Intensity Normal group_17_RB6_01_23980	Intensity Normal group_18_RB7_01_23981	Intensity Normal group_18_RB7_01_23982	Intensity Normal group_18_RB7_01_23983	Intensity Normal group_19_RB8_01_23985	Intensity Normal group_19_RB8_01_23986	Intensity Normal group_19_RB8_01_23987	Intensity Normal group_2_BE7_01_23928	Intensity Normal group_2_BE7_01_23929	Intensity Normal group_2_BE7_01_23930	Intensity Normal group_20_RC1_01_23988	Intensity Normal group_20_RC1_01_23989	Intensity Normal group_20_RC1_01_23990	Intensity Normal group_3_BE8_01_23931	Intensity Normal group_3_BE8_01_23932	Intensity Normal group_3_BE8_01_23933	Intensity Normal group_4_RA1_01_23935	Intensity Normal group_4_RA1_01_23936	Intensity Normal group_4_RA1_01_23937	Intensity Normal group_5_RA2_01_23938	Intensity Normal group_5_RA2_01_23939	Intensity Normal group_5_RA2_01_23940	Intensity Normal group_6_RA3_01_23941	Intensity Normal group_6_RA3_01_23942	Intensity Normal group_6_RA3_01_23943	Intensity Normal group_7_RA4_01_23945	Intensity Normal group_7_RA4_01_23946	Intensity Normal group_7_RA4_01_23947	Intensity Normal group_8_RA5_01_23948	Intensity Normal group_8_RA5_01_23949	Intensity Normal group_8_RA5_01_23950	Intensity Normal group_9_RA6_01_23951	Intensity Normal group_9_RA6_01_23952	Intensity Normal group_9_RA6_01_23953
A0A1H9P5L0	A0A1H9P5L0_9FIRM	Uncharacterized protein	SAMN02910429_00102	Lachnobacterium bovis		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		KKMLGFLNK	0.94624	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.9688	14.0224	0	0	0	11.9512	12.3606	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9P958	A0A1H9P958_9FIRM	Uncharacterized protein	SAMN02910429_00136	Lachnobacterium bovis					ECWCCKWSNFR	0.9489	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.5248	0	0	13.8747	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.6558	15.464	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9PBL8	A0A1H9PBL8_9FIRM	Putative fluoride ion transporter CrcB	crcB SAMN02910429_00182	Lachnobacterium bovis		integral component of plasma membrane [GO:0005887]	integral component of plasma membrane [GO:0005887]; fluoride transmembrane transporter activity [GO:1903425]	fluoride transmembrane transporter activity [GO:1903425]	IAMYSRR	0.625	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.8652	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9PEH6	A0A1H9PEH6_9FIRM	Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase)	def SAMN02910429_00198	Lachnobacterium bovis	translation [GO:0006412]		metal ion binding [GO:0046872]; peptide deformylase activity [GO:0042586]; translation [GO:0006412]	metal ion binding [GO:0046872]; peptide deformylase activity [GO:0042586]	AQFYDEEMNLCEIEGTELLAR	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.9163	13.4093	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9PXX2	A0A1H9PXX2_9FIRM	Uncharacterized membrane protein	SAMN02910429_00365	Lachnobacterium bovis		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		FTNRLSYHILSR	0.93023	0	0	0	0	0	0	0	0	0	15.5473	15.6565	14.8462	0	0	15.6628	0	0	0	17.0372	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.5813	0	14.8297	17.5483	15.7418	0	0	14.9353	16.391	17.213	0	0	0	0	0	0	0	0	0	0	0	13.5708	13.5497	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10.0185	0	0	0	0	0	0	0	0	16.3582	0	0	14.8799	0	0	0	15.0074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.5464	14.5155	0	0
A0A1H9QMU6	A0A1H9QMU6_9FIRM	Heptaprenyl diphosphate synthase	SAMN02910429_00616	Lachnobacterium bovis		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		TMSVFKD	0.75	0	0	0	14.2361	0	0	13.3571	0	0	0	0	0	0	0	0	0	0	0	0	12.057	0	0	0	0	0	0	0	0	11.8001	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.4836	14.8304	0	0	0	0	14.8845	0	0	0	0	0	0	0
A0A1H9QRA3	A0A1H9QRA3_9FIRM	Putative HD superfamily hydrolase of NAD metabolism	SAMN02910429_00658	Lachnobacterium bovis			hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	DADVEIAPVEIQNPFLLHSK	0.94882	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.5789	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.861	17.1364	17.5632	0	0	15.6276	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.5169	0	0	0	0	0	11.933	0	15.4203	0
A0A1H9RD91	A0A1H9RD91_9FIRM	Uncharacterized protein	SAMN02910429_00824	Lachnobacterium bovis					EASEVFELPDGR	0.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.1401	0	12.5994	0	0	0	0	0	0	0	13.7759	0	0	0	0	0	0	0	0	0	0
A0A1H9RV24	A0A1H9RV24_9FIRM	50S ribosomal protein L24	rplX SAMN02910429_00996	Lachnobacterium bovis	translation [GO:0006412]	ribosome [GO:0005840]	ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]	YTNQEGK	0.6	0	0	0	11.6629	0	0	0	0	0	0	0	11.1979	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.5215	0	0	11.392	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9S0C4	A0A1H9S0C4_9FIRM	Uncharacterized protein	SAMN02910429_01078	Lachnobacterium bovis					EPIFDGK	0.94751	0	0	0	0	0	0	0	12.771	0	0	0	13.2107	13.0829	0	0	14.1979	12.2875	12.8487	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.5925	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.7974	12.1737	12.4675	14.8037	14.9561	0	13.4747	0	0	0	11.1388	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9S9Z0	A0A1H9S9Z0_9FIRM	Isopentenyldiphosphate isomerase	SAMN02910429_01157	Lachnobacterium bovis			isomerase activity [GO:0016853]	isomerase activity [GO:0016853]	HCIDIEELNLIKAYLLQNM	0.9473	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.4955	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.2392	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.8378	0	0
A0A1H9SEH1	A0A1H9SEH1_9FIRM	Uncharacterized protein	SAMN02910429_01198	Lachnobacterium bovis		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VLRVELNK	0.94979	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.6437	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.3755	0	12.545	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9SFD2	A0A1H9SFD2_9FIRM	Preprotein translocase subunit SecE	SAMN02910429_01235	Lachnobacterium bovis	protein secretion [GO:0009306]; protein targeting [GO:0006605]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; protein transmembrane transporter activity [GO:0008320]; protein secretion [GO:0009306]; protein targeting [GO:0006605]	protein transmembrane transporter activity [GO:0008320]	TLTRQTTAVIVISIIAGAIIALMDR	0.82857	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.3172	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9SSW2	A0A1H9SSW2_9FIRM	Uncharacterized protein	SAMN02910429_01346	Lachnobacterium bovis					NVVAQCVKNEGK	0.89091	0	0	0	0	0	0	15.5565	15.0885	14.5789	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9SWU6	A0A1H9SWU6_9FIRM	Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase)	coaX SAMN02910429_01398	Lachnobacterium bovis	coenzyme A biosynthetic process [GO:0015937]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; pantothenate kinase activity [GO:0004594]; coenzyme A biosynthetic process [GO:0015937]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; pantothenate kinase activity [GO:0004594]	ITTKMPR	0.71429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.9717	0	13.8433	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9SX24	A0A1H9SX24_9FIRM	Uncharacterized protein	SAMN02910429_01406	Lachnobacterium bovis		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		NELIKRYLLFIIGLFFAAIGVAFTK	0.85294	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.3659	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9SYD1	A0A1H9SYD1_9FIRM	Methionyl-tRNA synthetase	SAMN02910429_01423	Lachnobacterium bovis			aminoacyl-tRNA ligase activity [GO:0004812]; tRNA binding [GO:0000049]	aminoacyl-tRNA ligase activity [GO:0004812]; tRNA binding [GO:0000049]	SMMGVESCGMLMSAIHEEDGEEK	0.94934	0	0	0	0	0	0	12.6583	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.9134	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.4267	0	0	0	0	0	0	0	0	0	0
A0A1H9TDE7	A0A1H9TDE7_9FIRM	PTS HPr component phosphorylation site	SAMN02910429_01583	Lachnobacterium bovis					CDFDIDVIYNR	0.90196	0	0	0	12.317	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.0197	0	13.4047	0	14.0767	0	0	0	0	0	0	0	0	0	0	15.0915	15.1724	15.3804	15.2102	0	15.7933	13.6642	0	0	0	0	0	0	0	14.6516	0	0	0	16.2174	15.5967	14.8193	0	0	15.4149	0	0	12.0805	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.2796	0	0	0	0
A0A1H9TGD9	A0A1H9TGD9_9FIRM	Uncharacterized protein	SAMN02910429_01609	Lachnobacterium bovis		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		ILALATAVVVSIFGNSTVFAANLPK	0.94772	0	0	0	0	0	0	14.0618	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.5347	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9.96708	0	0	0	0	0	0	0	0	11.2488	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.2085	0	0	0	0	0	0	11.5734	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9TIJ3	A0A1H9TIJ3_9FIRM	Energy-coupling factor transporter ATP-binding protein EcfA2 (EC 3.6.3.-)	SAMN02910429_01662	Lachnobacterium bovis		plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; transmembrane transporter activity [GO:0022857]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; transmembrane transporter activity [GO:0022857]	NQGLDKKTVELR	0.83333	0	0	10.4935	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.7636	0	0	0	0	0	0	0	0	10.2369	0	0	0	0	0	12.5163	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.7201	0	0	0	0	0	0	0	0	0	11.4713	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9TJ92	A0A1H9TJ92_9FIRM	Aminotransferase (EC 2.6.1.-)	SAMN02910429_01659	Lachnobacterium bovis	biosynthetic process [GO:0009058]		pyridoxal phosphate binding [GO:0030170]; transaminase activity [GO:0008483]; biosynthetic process [GO:0009058]	pyridoxal phosphate binding [GO:0030170]; transaminase activity [GO:0008483]	EFNMTSEEFATEFLKNK	0.94723	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.9925	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.9912	0	0	0	0	0	12.8131	0	0	0	0	0	0	0	0	0	0	0	0	0	10.1734	0	0	11.7923	11.7289	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.6765	0
A0A1H9TNC8	A0A1H9TNC8_9FIRM	"Type I restriction enzyme, S subunit"	SAMN02910429_01711	Lachnobacterium bovis			DNA binding [GO:0003677]	DNA binding [GO:0003677]	ALSDIATIK	0.94656	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.0956	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9TYT7	A0A1H9TYT7_9FIRM	ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein)	atpE SAMN02910429_01829	Lachnobacterium bovis		"integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; proton-transporting ATP synthase complex, coupling factor F(o) [GO:0045263]"	"integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; proton-transporting ATP synthase complex, coupling factor F(o) [GO:0045263]; lipid binding [GO:0008289]; proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]"	"lipid binding [GO:0008289]; proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]"	NPGASGK	0.81818	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.4149	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9.69709	0	0	0	0	0	0	0	0	13.1174	0	0	0	0	14.7101	0	0	0	0	0	0	0	0	0	0	0	0	0	13.1398	12.5933	0	13.3071	12.3079	15.1086	14.5933	14.2932	14.3132	0	0	0	11.6793	11.0478	0	0	0	0	0	0	0	0	11.6274	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9U2J0	A0A1H9U2J0_9FIRM	CYTH domain-containing protein	SAMN02910429_01885	Lachnobacterium bovis					YTLTYKGEGLMAR	0.78378	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.3531	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.0909	13.9329	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.0913	0	0	0	0	0	0	0	0	0	11.7802	0	0	0	0	0	0	11.7857	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9U3P2	A0A1H9U3P2_9FIRM	Uncharacterized protein	SAMN02910429_01915	Lachnobacterium bovis		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		HHKTYQSSYVEGK	0.94727	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.4881	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.2013	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10.4918	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.8133
A0A1H9U9D6	A0A1H9U9D6_9FIRM	Galactoside O-acetyltransferase	SAMN02910429_01997	Lachnobacterium bovis			transferase activity [GO:0016740]	transferase activity [GO:0016740]	MATSFYSEDELKK	0.72727	0	0	0	0	0	16.0842	16.4129	0	0	0	0	0	0	0	0	0	0	0	0	0	14.0618	0	0	0	15.5392	0	15.0787	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.7935	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9U9M4	A0A1H9U9M4_9FIRM	Uncharacterized protein	SAMN02910429_02004	Lachnobacterium bovis					SHKRQIIGVAFK	0.94681	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.3626	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.6883	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.9913	0	15.6424
A0A1H9UEM2	A0A1H9UEM2_9FIRM	Ribose 5-phosphate isomerase B	SAMN02910429_02065	Lachnobacterium bovis	carbohydrate metabolic process [GO:0005975]		"intramolecular oxidoreductase activity, interconverting aldoses and ketoses [GO:0016861]; carbohydrate metabolic process [GO:0005975]"	"intramolecular oxidoreductase activity, interconverting aldoses and ketoses [GO:0016861]"	DMVKAYLDAEFLGARHAMR	0.93443	0	0	0	14.4422	12.5646	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18.4708	17.2666	0	0	15.1596	12.7294	0	14.4065	0	0	0	0	13.8194	0	0	13.6452	0	0	0	0	0	0	0	0	0	0	12.2213	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.3195	0
A0A1H9UIH8	A0A1H9UIH8_9FIRM	Uncharacterized protein	SAMN02910429_02123	Lachnobacterium bovis		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LQKNIFLLCTAIIGIALLALIIR	0.94894	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10.692	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9UNG9	A0A1H9UNG9_9FIRM	IstB_IS21 domain-containing protein (Fragment)	SAMN02910429_01684 SAMN02910429_02186	Lachnobacterium bovis			ATP binding [GO:0005524]	ATP binding [GO:0005524]	NMIFTSNKSPDK	0.90741	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.9002	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H9UXZ4	A0A1H9UXZ4_9FIRM	"Molecular chaperone IbpA, HSP20 family"	SAMN02910429_02293	Lachnobacterium bovis					FNNGILTLDIAKVK	0.73077	0	0	0	0	0	0	12.9827	13.3548	0	14.5402	13.6585	15.7325	0	0	0	0	0	0	0	13.6585	0	0	0	0	0	12.6547	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.6666	0	12.4491	0	0	0	12.2745	0	0	0	10.9557	0	0	0	11.2768	0	0	0	0	12.3098	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9.98271	0	0	0	0	0	0	0	13.3718	0	0	0	0	0	14.8689	0	13.0426	0
A0A1H9UZL5	A0A1H9UZL5_9FIRM	"Resolvase, N terminal domain"	SAMN02910429_02319	Lachnobacterium bovis			DNA binding [GO:0003677]; DNA strand exchange activity [GO:0000150]	DNA binding [GO:0003677]; DNA strand exchange activity [GO:0000150]	YAEYQEMEIAHEYSDEGFSGK	0.94186	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.354	0	0	0	0	0	0	0	0	14.5921	14.5537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.3547	14.5581	13.8446	13.4553	0	0	12.1093	13.497	0	13.5252	0	11.8279	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.1775	0	0	0	0	0	0	13.2274	0	0	0
A0A1H3EWZ1	A0A1H3EWZ1_9FIRM	Flagellar basal body rod protein FlgB	SAMN02910414_00036	Lachnobacterium bovis DSM 14045	bacterial-type flagellum-dependent cell motility [GO:0071973]	"bacterial-type flagellum basal body, rod [GO:0030694]"	"bacterial-type flagellum basal body, rod [GO:0030694]; bacterial-type flagellum-dependent cell motility [GO:0071973]"		AADASNR	0.64286	0	11.6035	0	0	0	0	0	0	0	0	0	0	0	0	0	11.8324	0	0	0	0	0	0	0	0	11.9665	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9.6215	0	13.4306	0	0	15.3901	0	0	0	0	0	13.1147	0	0	0	11.5867	0	0	0	11.8145	0	0	14.8923	12.5186	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.4109	0	0	0	0	0	0	0	14.9554	0	13.4017	14.6709	0	0	0	0	0	0
A0A1H3EY27	A0A1H3EY27_9FIRM	Flagellar protein FliL	SAMN02910414_00051	Lachnobacterium bovis DSM 14045	bacterial-type flagellum-dependent cell motility [GO:0071973]; chemotaxis [GO:0006935]	bacterial-type flagellum basal body [GO:0009425]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	bacterial-type flagellum basal body [GO:0009425]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; bacterial-type flagellum-dependent cell motility [GO:0071973]; chemotaxis [GO:0006935]		DGDKTTMTINLAK	0.92453	0	0	0	0	0	0	18.6719	18.6707	18.7915	0	0	0	0	0	0	0	0	0	0	13.9015	0	0	0	11.1915	0	0	0	13.2216	0	0	0	0	0	0	0	0	0	0	0	0	11.1103	0	0	0	0	0	0	0	0	0	0	0	11.6133	13.1798	10.8814	0	0	12.5996	12.5388	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10.499	0	0	0	0	0	0	0	0	13.7084	0	0	0	0	0	13.8332	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3EYT1	A0A1H3EYT1_9FIRM	Purine-binding chemotaxis protein CheW	SAMN02910414_00066	Lachnobacterium bovis DSM 14045	chemotaxis [GO:0006935]; signal transduction [GO:0007165]		chemotaxis [GO:0006935]; signal transduction [GO:0007165]		EVITLSEDDIEK	0.90244	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.0944	0	0	0	0	0	11.1709	0	12.3478	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3F0R1	A0A1H3F0R1_9FIRM	Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit)	xseB SAMN02910414_00088	Lachnobacterium bovis DSM 14045	DNA catabolic process [GO:0006308]	cytoplasm [GO:0005737]; exodeoxyribonuclease VII complex [GO:0009318]	cytoplasm [GO:0005737]; exodeoxyribonuclease VII complex [GO:0009318]; exodeoxyribonuclease VII activity [GO:0008855]; DNA catabolic process [GO:0006308]	exodeoxyribonuclease VII activity [GO:0008855]	KEEIESK	0.5625	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.907	0	0	12.3231	0	13.8193	0	0	0	15.7524	15.7351	15.9775	0	0	0	0	0	0	0	0	0	0	14.051	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3F1W3	A0A1H3F1W3_9FIRM	Simple sugar transport system permease protein	SAMN02910414_00104	Lachnobacterium bovis DSM 14045	carbohydrate transport [GO:0008643]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transporter activity [GO:0022857]; carbohydrate transport [GO:0008643]	transmembrane transporter activity [GO:0022857]	ADQTIGGTALNILATAIALVVVK	0.94737	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.5757	0	0	11.3297	0	0	0	0	13.0366	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3F2E8	A0A1H3F2E8_9FIRM	Uridine kinase (EC 2.7.1.48) (Cytidine monophosphokinase) (Uridine monophosphokinase)	udk SAMN02910414_00110	Lachnobacterium bovis DSM 14045	CTP salvage [GO:0044211]; UMP salvage [GO:0044206]	cytoplasm [GO:0005737]	"cytoplasm [GO:0005737]; ATP binding [GO:0005524]; phosphotransferase activity, alcohol group as acceptor [GO:0016773]; uridine kinase activity [GO:0004849]; CTP salvage [GO:0044211]; UMP salvage [GO:0044206]"	"ATP binding [GO:0005524]; phosphotransferase activity, alcohol group as acceptor [GO:0016773]; uridine kinase activity [GO:0004849]"	IVRDVKER	0.94737	0	0	0	17.5141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.4028	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.054	0	0	0	13.9258	0	0	0	0	0	0	0	0	0	0	0	0	0	11.926	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.5836	0	0	0	0	12.6364	0	0	0	14.7016	0	0	0	0	0	0	0	0	0	0	12.1549	0	0	0	13.1325	0	0	0	0	0	0	0	14.2879	0	0	0	0	0
A0A1H3F456	A0A1H3F456_9FIRM	VTC domain-containing protein	SAMN02910414_00133	Lachnobacterium bovis DSM 14045					IRLRIYHTDAK	0.91358	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.6978	0	0	0	16.086	0	0	0	0	0	0	0	0	0	0	0	0	17.1044	0	16.2385	15.7636	13.9412	16.0284	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.1498	0	0	16.2349
A0A1H3F6D6	A0A1H3F6D6_9FIRM	Rod shape determining protein RodA	SAMN02910414_00168	Lachnobacterium bovis DSM 14045	cell division [GO:0051301]; regulation of cell shape [GO:0008360]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; cell division [GO:0051301]; regulation of cell shape [GO:0008360]		IKNYNFK	0.94879	0	0	0	0	0	15.9054	0	0	0	0	0	0	13.4701	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.2085	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.0919	0	0	0	0	0	0	11.7365	0	14.9147	0	0	0	0	13.7701	0	0	0	0	0	0	0	0	0	0	0	0	0	15.0265	14.7325	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3F705	A0A1H3F705_9FIRM	Cell shape-determining protein MreB	mreB SAMN02910414_00172	Lachnobacterium bovis DSM 14045	cell morphogenesis [GO:0000902]; regulation of cell shape [GO:0008360]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; cell morphogenesis [GO:0000902]; regulation of cell shape [GO:0008360]	ATP binding [GO:0005524]	EFNLVIGKKTGK	0.88158	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.8274	0	0	0	0	0	0	0	14.5764	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.3375	0	11.8667	0	0	0	0	0	0	0	0	0	0	0
A0A1H3F9R9	A0A1H3F9R9_9FIRM	Chemotaxis phosphatase CheX	SAMN02910414_00210	Lachnobacterium bovis DSM 14045	chemotaxis [GO:0006935]		chemotaxis [GO:0006935]		QLFEAMQKQSNGR	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.0322	0	0	0	0	0	0	14.6683	0	0	0	0	0
A0A1H3FQK6	A0A1H3FQK6_9FIRM	Glutamate 5-kinase (EC 2.7.2.11) (Gamma-glutamyl kinase) (GK)	proB SAMN02910414_00321	Lachnobacterium bovis DSM 14045	L-proline biosynthetic process [GO:0055129]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; glutamate 5-kinase activity [GO:0004349]; L-proline biosynthetic process [GO:0055129]	ATP binding [GO:0005524]; glutamate 5-kinase activity [GO:0004349]	IGSSSLTHEETGNQDFIK	0.78947	0	0	11.7774	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.6423	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3FU49	A0A1H3FU49_9FIRM	"DNA-binding transcriptional regulator, ArsR family"	SAMN02910414_00379	Lachnobacterium bovis DSM 14045			DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	TFGEGTR	0.69231	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.7553	0	0	0	0	0	0	0	0	0	0
A0A1H3FUU1	A0A1H3FUU1_9FIRM	Uncharacterized protein	SAMN02910414_00387	Lachnobacterium bovis DSM 14045					FLEDNLLSGMPCDR	0.875	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.3308	0	0	0	0	0	0	0	0	0
A0A1H3GBZ8	A0A1H3GBZ8_9FIRM	Uncharacterized protein	SAMN02910414_00513	Lachnobacterium bovis DSM 14045					VAEFFRR	0.44444	0	0	0	0	0	0	0	0	10.8067	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.5706	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3GED1	A0A1H3GED1_9FIRM	Sodium/proline symporter (Proline permease)	SAMN02910414_00548	Lachnobacterium bovis DSM 14045	proline transport [GO:0015824]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; proline:sodium symporter activity [GO:0005298]; sodium ion binding [GO:0031402]; proline transport [GO:0015824]	proline:sodium symporter activity [GO:0005298]; sodium ion binding [GO:0031402]	IALSRRVASIWAFISMAVSIVIGVIGLSMSK	0.9434	0	0	0	0	0	0	0	0	0	0	0	0	0	15.1023	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.5598	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.1802	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3GQ75	A0A1H3GQ75_9FIRM	Histidinol-phosphatase (HolPase) (EC 3.1.3.15)	SAMN02910414_00601	Lachnobacterium bovis DSM 14045	histidine biosynthetic process [GO:0000105]		histidinol-phosphatase activity [GO:0004401]; histidine biosynthetic process [GO:0000105]	histidinol-phosphatase activity [GO:0004401]	FSTFKDKYK	0.94851	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.6822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3GT20	A0A1H3GT20_9FIRM	Threonine ammonia-lyase (EC 4.3.1.19)	SAMN02910414_00642	Lachnobacterium bovis DSM 14045	threonine catabolic process [GO:0006567]		L-threonine ammonia-lyase activity [GO:0004794]; threonine catabolic process [GO:0006567]	L-threonine ammonia-lyase activity [GO:0004794]	AVIVMPTTTPLIK	0.90411	0	0	0	15.6256	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3H530	A0A1H3H530_9FIRM	Permease of the drug/metabolite transporter (DMT) superfamily	SAMN02910414_00736	Lachnobacterium bovis DSM 14045		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		ASIIEGISGFVAIVLSAIILK	0.94746	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.8251	0	0	0	0	0	0	0	0	13.9583	0	0	0	0	0	0	12.4178	0	0	0	0	0	0	0	0	0	11.5918	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.7188	13.0447	0	0	0
A0A1H3H6A1	A0A1H3H6A1_9FIRM	50S ribosomal protein L2	rplB SAMN02910414_00744	Lachnobacterium bovis DSM 14045	translation [GO:0006412]	large ribosomal subunit [GO:0015934]	large ribosomal subunit [GO:0015934]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; transferase activity [GO:0016740]; translation [GO:0006412]	rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; transferase activity [GO:0016740]	GSVMNPNDHPHGGGEGK	0.80556	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.333	16.3464	17.801	0	15.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.698	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.7405	0	0	0	0
A0A1H3HJH7	A0A1H3HJH7_9FIRM	Uracil-DNA glycosylase (UDG) (EC 3.2.2.27)	ung SAMN02910414_00870	Lachnobacterium bovis DSM 14045	base-excision repair [GO:0006284]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; uracil DNA N-glycosylase activity [GO:0004844]; base-excision repair [GO:0006284]	uracil DNA N-glycosylase activity [GO:0004844]	ELNSDLGCYIPNNGFLEK	0.94939	0	0	0	13.2436	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10.7964	0	0	13.9326	14.5119	13.649	12.7133	0	0	0	0	0	0	12.7524	0	15.9379	0	0	0	15.6902	13.1766	0	0	12.4555	12.9641	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.9566	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.2516	0	0	0	0	14.1154	0	0	0	16.1948
A0A1H3HLP4	A0A1H3HLP4_9FIRM	Small conductance mechanosensitive channel	SAMN02910414_00895	Lachnobacterium bovis DSM 14045	transmembrane transport [GO:0055085]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transport [GO:0055085]		EEGTVHEITIFYTK	0.75	0	0	0	0	0	0	0	0	0	0	17.2228	0	0	0	15.6048	15.9809	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.8616	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.9145	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3HM52	A0A1H3HM52_9FIRM	Stage 0 sporulation protein A homolog	SAMN02910414_00874	Lachnobacterium bovis DSM 14045	chemotaxis [GO:0006935]; phosphorelay signal transduction system [GO:0000160]		chemotaxis [GO:0006935]; phosphorelay signal transduction system [GO:0000160]		EGGVAEK	0.25	0	0	0	0	0	0	0	0	0	0	0	0	11.382	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.5448	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.4201	0	0	0	0	0	0	0	0	0	0	0	0	11.9743	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3HN32	A0A1H3HN32_9FIRM	Putative pre-16S rRNA nuclease (EC 3.1.-.-)	SAMN02910414_00917	Lachnobacterium bovis DSM 14045	rRNA 5'-end processing [GO:0000967]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; nuclease activity [GO:0004518]; rRNA 5'-end processing [GO:0000967]	nuclease activity [GO:0004518]	ELADEYEVDTIVLGYPK	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.7538	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.6717	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3I044	A0A1H3I044_9FIRM	DUF6472 domain-containing protein	SAMN02910414_01027	Lachnobacterium bovis DSM 14045					FMQSSYKNCPFYK	0.92308	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.7684	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3I1F3	A0A1H3I1F3_9FIRM	UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase)	murB SAMN02910414_01021	Lachnobacterium bovis DSM 14045	cell cycle [GO:0007049]; cell division [GO:0051301]; cell wall organization [GO:0071555]; peptidoglycan biosynthetic process [GO:0009252]; regulation of cell shape [GO:0008360]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; FAD binding [GO:0071949]; UDP-N-acetylmuramate dehydrogenase activity [GO:0008762]; cell cycle [GO:0007049]; cell division [GO:0051301]; cell wall organization [GO:0071555]; peptidoglycan biosynthetic process [GO:0009252]; regulation of cell shape [GO:0008360]	FAD binding [GO:0071949]; UDP-N-acetylmuramate dehydrogenase activity [GO:0008762]	EVKKIIEVCNELEVPYHVVGNGSNLLVSDQGLNGVVISVR	0.89189	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.0995	0	0	0	0	0	0	0	0	0	0	0	0	13.7876	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.0432	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.946	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3I328	A0A1H3I328_9FIRM	PAP2 superfamily protein	SAMN02910414_01047	Lachnobacterium bovis DSM 14045		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		FVIAEMLSKIICGLCFILIPTTNVR	0.94854	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.0401	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.4726	11.9241	0	0	0	12.4624	11.7837	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3ISL6	A0A1H3ISL6_9FIRM	Uncharacterized protein	SAMN02910414_01235	Lachnobacterium bovis DSM 14045					FNLLLSKLADAFLAINGVK	0.94918	0	0	0	0	0	0	0	0	11.2425	0	0	0	0	0	0	0	0	0	0	0	19.505	12.2517	0	0	0	16.2164	16.8612	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.1058	16.7947	15.9578	15.9227	17.8646	19.4411	19.6539	19.6522	18.0743	17.9283	18.3309	17.2227	16.8945	17.0004	16.3628	0	0	0	0	0	0	0	0	0	0	0	0	13.5134	0	0	0	0	16.7563	18.1993	16.0774	0	0	0	12.326	0	0	0	0	0	0	0	0	17.3925	18.3294	18.3314	0	0	18.9131	22.3288	22.5034	19.338	0	0	0
A0A1H3IXU2	A0A1H3IXU2_9FIRM	PGAP1-like protein	SAMN02910414_01276	Lachnobacterium bovis DSM 14045	lipid metabolic process [GO:0006629]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; lipid metabolic process [GO:0006629]		AIQEYVPK	0.94631	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.613	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.7172	0	0	0	0	14.0949	0	0
A0A1H3J4C2	A0A1H3J4C2_9FIRM	Muramoyltetrapeptide carboxypeptidase LdcA (Peptidoglycan recycling)	SAMN02910414_01321	Lachnobacterium bovis DSM 14045			carboxypeptidase activity [GO:0004180]	carboxypeptidase activity [GO:0004180]	DSLDILSGKINK	0	12.5758	14.3466	0	0	0	14.5358	19.8451	19.6494	18.7906	16.8046	17.0678	17.5926	18.5803	18.202	18.6015	17.0756	17.3665	18.1142	11.875	0	0	0	0	0	0	0	0	0	0	0	14.39	14.5273	13.1949	16.4986	14.9654	16.9872	0	16.876	16.9452	12.5989	12.2844	15.402	15.197	17.9697	18.901	18.571	18.2775	17.3357	0	0	0	0	16.4569	16.7444	19.8163	19.6761	0	0	0	0	0	0	0	0	0	0	18.6653	18.0783	19.1003	0	17.8128	19.1141	19.3861	19.1172	18.4939	18.3753	17.1137	0	17.5598	0	0	18.1955	0	14.4631	0	0	0	0	0	0	16.9665	16.2918	16.3132	0	0	0	0	0	0	12.6955	0	0	0	0	0	0	0	0	0	0	17.6978	14.7263	19.8021	16.2358
A0A1H3K1U8	A0A1H3K1U8_9FIRM	Uncharacterized protein	SAMN02910414_01609	Lachnobacterium bovis DSM 14045					IPEGAEIYSMCEHSFR	0.94602	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10.8108	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.6257	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.4033	0	0	0	0	0	0	0	0	0	13.7116	13.3807	0	0	0	0	0	0	0
A0A1H3K246	A0A1H3K246_9FIRM	Histidine triad (HIT) family protein	SAMN02910414_01622	Lachnobacterium bovis DSM 14045			catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	DDNCIFCK	0.94986	0	0	0	0	0	0	0	0	0	10.4756	0	0	0	0	0	0	10.9375	0	0	0	0	10.3414	0	0	0	10.3048	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10.3569	0	0	0	11.1035	0	0	0	0	0	0	10.5253	0	0	0	0	0	0	0	10.4071	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3KIP2	A0A1H3KIP2_9FIRM	Transposase IS116/IS110/IS902 family protein	SAMN02910414_01743	Lachnobacterium bovis DSM 14045	"transposition, DNA-mediated [GO:0006313]"		"DNA binding [GO:0003677]; transposase activity [GO:0004803]; transposition, DNA-mediated [GO:0006313]"	DNA binding [GO:0003677]; transposase activity [GO:0004803]	RGSRYLR	0.94932	0	0	13.5317	0	0	0	0	0	0	0	0	0	0	0	12.4839	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.1431	0	0	0	0	0	0	0	0	0	12.3857	0	0	11.9139	0	0	0	0	0	0	0	0	0	12.5907	0
A0A1H3KQX7	A0A1H3KQX7_9FIRM	ABC-2 type transport system ATP-binding protein	SAMN02910414_01804	Lachnobacterium bovis DSM 14045			ATP binding [GO:0005524]	ATP binding [GO:0005524]	DISFPPSVGIIIENMELLPKLTAK	0.84615	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.3212	14.2618	14.3678	0	0	12.865	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3KR68	A0A1H3KR68_9FIRM	Leucine rich repeat-containing protein	SAMN02910414_01803	Lachnobacterium bovis DSM 14045					ILFKGDVKQVSK	0.9125	0	0	0	0	16.6661	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3KZ74	A0A1H3KZ74_9FIRM	"Chromosome partitioning protein, ParB family"	SAMN02910414_01859	Lachnobacterium bovis DSM 14045			DNA binding [GO:0003677]	DNA binding [GO:0003677]	ADEELAKQTGESAR	0.74074	0	0	0	0	0	16.3129	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3L2P1	A0A1H3L2P1_9FIRM	Acetyltransferase (GNAT) domain-containing protein	SAMN02910414_01878	Lachnobacterium bovis DSM 14045	UDP-N-acetylglucosamine biosynthetic process [GO:0006048]		glucosamine 6-phosphate N-acetyltransferase activity [GO:0004343]; UDP-N-acetylglucosamine biosynthetic process [GO:0006048]	glucosamine 6-phosphate N-acetyltransferase activity [GO:0004343]	NFNTVFSAYDGDK	0.90909	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.8233	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.896	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.64	16.6089	0	0	0	0
A0A1H3LAE5	A0A1H3LAE5_9FIRM	Uncharacterized membrane protein	SAMN02910414_01967	Lachnobacterium bovis DSM 14045		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GSMGFLAAILLRKECCK	0.85714	0	0	0	16.9872	16.7138	16.7295	15.4316	0	0	0	15.4679	0	0	0	0	0	0	0	15.9801	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.0556	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3LKD5	A0A1H3LKD5_9FIRM	Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase)	coaE SAMN02910414_02043	Lachnobacterium bovis DSM 14045	coenzyme A biosynthetic process [GO:0015937]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; dephospho-CoA kinase activity [GO:0004140]; coenzyme A biosynthetic process [GO:0015937]	ATP binding [GO:0005524]; dephospho-CoA kinase activity [GO:0004140]	EYVKEQFALEKER	0.94505	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18.9955	0	0	0	0	0	0	0	0	14.0582	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3LLG2	A0A1H3LLG2_9FIRM	"Phosphoribosyl 1,2-cyclic phosphodiesterase"	SAMN02910414_02045	Lachnobacterium bovis DSM 14045					ADDFPIK	0.76316	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.9912	0	0	0	0	0	0	0	0	0	0	0	13.9541	13.8848	13.4256	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.9005	0	0
A0A1H3LXW9	A0A1H3LXW9_9FIRM	Uncharacterized protein	SAMN02910414_02156	Lachnobacterium bovis DSM 14045					ATVDWINTEFEKNPLFYDKK	0.91139	0	0	0	0	0	0	0	0	0	0	0	0	0	12.3306	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.1418	0	0	0	0	0
A0A1H3LZN9	A0A1H3LZN9_9FIRM	Six-cysteine peptide SCIFF	SAMN02910414_02176	Lachnobacterium bovis DSM 14045					GGCGECQTSCQSACK	0.94728	0	0	0	0	0	9.59582	12.4511	0	0	0	0	0	0	0	0	11.796	0	0	0	0	13.9207	0	0	12.9358	0	16.1872	18.1508	14.4396	16.4621	0	0	0	0	0	0	0	0	0	0	0	0	15.1658	14.8801	0	0	0	0	15.8083	0	0	13.6913	0	0	0	0	0	0	0	0	0	17.3385	0	0	0	17.6384	0	0	0	0	0	0	0	0	14.9674	0	13.793	0	14.6725	0	0	15.304	14.6469	0	15.763	0	0	0	0	0	16.5243	0	0	0	16.8896	0	14.3925	15.0338	0	0	0	0	0	0	15.7408	0	0	0	0	0	0	17.2385	0	15.4318	15.6169
A0A1H3M1Q4	A0A1H3M1Q4_9FIRM	"Transcriptional regulator, DeoR family"	SAMN02910414_02185	Lachnobacterium bovis DSM 14045			DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	EEKSIISK	0.94618	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.0775	0	0	0	0	0	0	0	0	0	0	0	13.5687	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3M6A7	A0A1H3M6A7_9FIRM	"Chromosome partitioning protein, ParB family"	SAMN02910414_02228	Lachnobacterium bovis DSM 14045			DNA binding [GO:0003677]	DNA binding [GO:0003677]	ETEKLVK	0.9498	0	0	0	0	0	13.8597	0	0	0	16.4637	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.8477	0	0	0	0	12.4709	0	0	0	13.974	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.1968	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.3811	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3MWC2	A0A1H3MWC2_9FIRM	Ribosome hibernation promoting factor (HPF)	hpf SAMN02910414_02421	Lachnobacterium bovis DSM 14045	primary metabolic process [GO:0044238]; regulation of translation [GO:0006417]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; primary metabolic process [GO:0044238]; regulation of translation [GO:0006417]		ERQIIEVTIPVKGSVIR	0.94875	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.0431	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H3N518	A0A1H3N518_9FIRM	Accessory gene regulator B	SAMN02910414_02483	Lachnobacterium bovis DSM 14045		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		ILAIELWVIISLFMLGVKETYLTYMSIGVILCAILMSLAK	0.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.057	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0