T: Majority protein IDs	Entry Name	Protein names	Gene Names	Organism	Gene Ontology (biological process)	Gene Ontology (cellular component)	Gene Ontology (GO)	Gene Ontology (molecular function)	Gene Ontology IDs	T: Peptide sequences	N: Q-value	SH-SY5Y-1	SH-SY5Y-2 	SH-SY5Y-3	Differentiated SH-SY5Y-1	Differentiated SH-SY5Y-2	Differentiated SH-SY5Y3	KLVFF-1	KLVFF-2	KLVFF-3	RGKLVFFGR-1	RGKLVFFGR-2	RGKLVFFGR-3	RIIGL-1	RIIGL-2	RIIGL-3
Q6ZSZ6	TSH1_HUMAN	Teashirt homolog 1 (Antigen NY-CO-33) (Serologically defined colon cancer antigen 33)	TSHZ1 SDCCAG33 TSH1	Homo sapiens (Human)	anterior/posterior pattern specification [GO:0009952]; middle ear morphogenesis [GO:0042474]; regulation of transcription by RNA polymerase II [GO:0006357]; soft palate development [GO:0060023]	chromatin [GO:0000785]; nucleus [GO:0005634]	"chromatin [GO:0000785]; nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; anterior/posterior pattern specification [GO:0009952]; middle ear morphogenesis [GO:0042474]; regulation of transcription by RNA polymerase II [GO:0006357]; soft palate development [GO:0060023]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]"	GO:0000785; GO:0000981; GO:0003677; GO:0005634; GO:0006357; GO:0009952; GO:0042474; GO:0046872; GO:0060023	AANPYVTPNNR	1.0022	19.9851	19.9037	20.1145	19.112	19.4448	19.4281	20.0235	19.8747	20.0832	20.2718	20.5643	20.3496	17.5063	17.4752	20.1268
P55786	PSA_HUMAN	Puromycin-sensitive aminopeptidase (PSA) (EC 3.4.11.14) (Cytosol alanyl aminopeptidase) (AAP-S)	NPEPPS PSA	Homo sapiens (Human)	cellular response to hypoxia [GO:0071456]; peptide catabolic process [GO:0043171]; positive regulation of protein targeting to mitochondrion [GO:1903955]; protein polyubiquitination [GO:0000209]; proteolysis [GO:0006508]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; nucleus [GO:0005634]; aminopeptidase activity [GO:0004177]; metalloaminopeptidase activity [GO:0070006]; peptide binding [GO:0042277]; zinc ion binding [GO:0008270]; cellular response to hypoxia [GO:0071456]; peptide catabolic process [GO:0043171]; positive regulation of protein targeting to mitochondrion [GO:1903955]; protein polyubiquitination [GO:0000209]; proteolysis [GO:0006508]	aminopeptidase activity [GO:0004177]; metalloaminopeptidase activity [GO:0070006]; peptide binding [GO:0042277]; zinc ion binding [GO:0008270]	GO:0000209; GO:0004177; GO:0005634; GO:0005737; GO:0005829; GO:0006508; GO:0008270; GO:0042277; GO:0043171; GO:0070006; GO:0070062; GO:0071456; GO:1903955	AAWKFIK	1.0107	14.1333	13.826	14.0681	18.8741	12.4587	19.0617	20.1154	14.0597	20.0889	20.0771	20.3739	20.1624	20.1539	19.9418	20.1078
P22303	ACES_HUMAN	Acetylcholinesterase (AChE) (EC 3.1.1.7)	ACHE	Homo sapiens (Human)	"acetylcholine catabolic process [GO:0006581]; acetylcholine catabolic process in synaptic cleft [GO:0001507]; acetylcholine receptor signaling pathway [GO:0095500]; amyloid precursor protein metabolic process [GO:0042982]; cell adhesion [GO:0007155]; negative regulation of synaptic transmission, cholinergic [GO:0032223]; nervous system development [GO:0007399]; osteoblast development [GO:0002076]; positive regulation of cold-induced thermogenesis [GO:0120162]; positive regulation of protein secretion [GO:0050714]; receptor internalization [GO:0031623]; regulation of receptor recycling [GO:0001919]; retina development in camera-type eye [GO:0060041]; synapse assembly [GO:0007416]"	anchored component of membrane [GO:0031225]; anchoring junction [GO:0070161]; basement membrane [GO:0005604]; cell surface [GO:0009986]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]; neuromuscular junction [GO:0031594]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; synapse [GO:0045202]; synaptic cleft [GO:0043083]	"anchored component of membrane [GO:0031225]; anchoring junction [GO:0070161]; basement membrane [GO:0005604]; cell surface [GO:0009986]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]; neuromuscular junction [GO:0031594]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; synapse [GO:0045202]; synaptic cleft [GO:0043083]; acetylcholine binding [GO:0042166]; acetylcholinesterase activity [GO:0003990]; amyloid-beta binding [GO:0001540]; cholinesterase activity [GO:0004104]; collagen binding [GO:0005518]; hydrolase activity [GO:0016787]; laminin binding [GO:0043236]; protein homodimerization activity [GO:0042803]; protein self-association [GO:0043621]; serine hydrolase activity [GO:0017171]; acetylcholine catabolic process [GO:0006581]; acetylcholine catabolic process in synaptic cleft [GO:0001507]; acetylcholine receptor signaling pathway [GO:0095500]; amyloid precursor protein metabolic process [GO:0042982]; cell adhesion [GO:0007155]; negative regulation of synaptic transmission, cholinergic [GO:0032223]; nervous system development [GO:0007399]; osteoblast development [GO:0002076]; positive regulation of cold-induced thermogenesis [GO:0120162]; positive regulation of protein secretion [GO:0050714]; receptor internalization [GO:0031623]; regulation of receptor recycling [GO:0001919]; retina development in camera-type eye [GO:0060041]; synapse assembly [GO:0007416]"	acetylcholine binding [GO:0042166]; acetylcholinesterase activity [GO:0003990]; amyloid-beta binding [GO:0001540]; cholinesterase activity [GO:0004104]; collagen binding [GO:0005518]; hydrolase activity [GO:0016787]; laminin binding [GO:0043236]; protein homodimerization activity [GO:0042803]; protein self-association [GO:0043621]; serine hydrolase activity [GO:0017171]	GO:0001507; GO:0001540; GO:0001919; GO:0002076; GO:0003990; GO:0004104; GO:0005518; GO:0005576; GO:0005604; GO:0005615; GO:0005634; GO:0005794; GO:0005886; GO:0006581; GO:0007155; GO:0007399; GO:0007416; GO:0009986; GO:0016020; GO:0016787; GO:0017171; GO:0031225; GO:0031594; GO:0031623; GO:0032223; GO:0042166; GO:0042803; GO:0042982; GO:0043083; GO:0043236; GO:0043621; GO:0045202; GO:0048471; GO:0050714; GO:0060041; GO:0070161; GO:0095500; GO:0120162	AEFHRWSSYMVHWK	0.91371	17.4306	14.4525	18.8827	18.2225	19.2065	16.2594	13.6283	20.0315	19.4454	19.2517	19.1856	20.5005	19.6807	12.7693	17.7011
Q12830	BPTF_HUMAN	Nucleosome-remodeling factor subunit BPTF (Bromodomain and PHD finger-containing transcription factor) (Fetal Alz-50 clone 1 protein) (Fetal Alzheimer antigen)	BPTF FAC1 FALZ	Homo sapiens (Human)	anterior/posterior pattern specification [GO:0009952]; brain development [GO:0007420]; chromatin remodeling [GO:0006338]; embryonic placenta development [GO:0001892]; endoderm development [GO:0007492]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase II [GO:0006357]	ATPase complex [GO:1904949]; chromatin [GO:0000785]; cytoplasm [GO:0005737]; extracellular exosome [GO:0070062]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; NURF complex [GO:0016589]	ATPase complex [GO:1904949]; chromatin [GO:0000785]; cytoplasm [GO:0005737]; extracellular exosome [GO:0070062]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; NURF complex [GO:0016589]; metal ion binding [GO:0046872]; methylated histone binding [GO:0035064]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]; anterior/posterior pattern specification [GO:0009952]; brain development [GO:0007420]; chromatin remodeling [GO:0006338]; embryonic placenta development [GO:0001892]; endoderm development [GO:0007492]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase II [GO:0006357]	metal ion binding [GO:0046872]; methylated histone binding [GO:0035064]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]	GO:0000122; GO:0000785; GO:0000978; GO:0001892; GO:0005634; GO:0005654; GO:0005737; GO:0006338; GO:0006355; GO:0006357; GO:0007420; GO:0007492; GO:0009952; GO:0016589; GO:0035064; GO:0043565; GO:0045944; GO:0046872; GO:0070062; GO:1904949	AADDPENGER	1	15.5321	17.286	16.358	16.8041	16.6664	19.0824	19.9834	14.4	15.5176	20.1421	20.4303	17.0387	16.87	20.0265	19.9822
P11137	MTAP2_HUMAN	Microtubule-associated protein 2 (MAP-2)	MAP2	Homo sapiens (Human)	central nervous system neuron development [GO:0021954]; dendrite development [GO:0016358]; dendrite morphogenesis [GO:0048813]; microtubule bundle formation [GO:0001578]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of axon extension [GO:0030517]; negative regulation of microtubule binding [GO:1904527]; negative regulation of microtubule polymerization [GO:0031115]; neuron projection development [GO:0031175]; positive regulation of anterograde dense core granule transport [GO:1901953]; positive regulation of anterograde synaptic vesicle transport [GO:1903744]; regulation of microtubule polymerization [GO:0031113]; regulation of organelle transport along microtubule [GO:1902513]; regulation of protein localization [GO:0032880]	apical distal dendrite [GO:0150014]; axon hillock [GO:0043203]; axon initial segment [GO:0043194]; basal dendrite [GO:0097441]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendrite cytoplasm [GO:0032839]; dendritic branch [GO:0044307]; dendritic filopodium [GO:1902737]; dendritic growth cone [GO:0044294]; dendritic shaft [GO:0043198]; distal dendrite [GO:0150002]; microtubule [GO:0005874]; microtubule associated complex [GO:0005875]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; primary dendrite [GO:0150001]; proximal dendrite [GO:1990635]; proximal neuron projection [GO:1990769]	apical distal dendrite [GO:0150014]; axon hillock [GO:0043203]; axon initial segment [GO:0043194]; basal dendrite [GO:0097441]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendrite cytoplasm [GO:0032839]; dendritic branch [GO:0044307]; dendritic filopodium [GO:1902737]; dendritic growth cone [GO:0044294]; dendritic shaft [GO:0043198]; distal dendrite [GO:0150002]; microtubule [GO:0005874]; microtubule associated complex [GO:0005875]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; primary dendrite [GO:0150001]; proximal dendrite [GO:1990635]; proximal neuron projection [GO:1990769]; calmodulin binding [GO:0005516]; dystroglycan binding [GO:0002162]; microtubule binding [GO:0008017]; structural molecule activity [GO:0005198]; tau protein binding [GO:0048156]; central nervous system neuron development [GO:0021954]; dendrite development [GO:0016358]; dendrite morphogenesis [GO:0048813]; microtubule bundle formation [GO:0001578]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of axon extension [GO:0030517]; negative regulation of microtubule binding [GO:1904527]; negative regulation of microtubule polymerization [GO:0031115]; neuron projection development [GO:0031175]; positive regulation of anterograde dense core granule transport [GO:1901953]; positive regulation of anterograde synaptic vesicle transport [GO:1903744]; regulation of microtubule polymerization [GO:0031113]; regulation of organelle transport along microtubule [GO:1902513]; regulation of protein localization [GO:0032880]	calmodulin binding [GO:0005516]; dystroglycan binding [GO:0002162]; microtubule binding [GO:0008017]; structural molecule activity [GO:0005198]; tau protein binding [GO:0048156]	GO:0000226; GO:0001578; GO:0002162; GO:0005198; GO:0005516; GO:0005737; GO:0005829; GO:0005874; GO:0005875; GO:0008017; GO:0016358; GO:0021954; GO:0030425; GO:0030517; GO:0031113; GO:0031115; GO:0031175; GO:0032839; GO:0032880; GO:0043005; GO:0043025; GO:0043194; GO:0043198; GO:0043203; GO:0044294; GO:0044307; GO:0048156; GO:0048813; GO:0097441; GO:0150001; GO:0150002; GO:0150014; GO:1901953; GO:1902513; GO:1902737; GO:1903744; GO:1904527; GO:1990635; GO:1990769	ADEGKKETSPESSLIQDEIAVK	1.0047	17.3117	16.9213	16.9993	16.4902	16.4812	16.4076	17.0793	17.4477	17.4566	16.5456	17.5295	17.593	16.7722	17.1894	17.4359
Q8IZY2	ABCA7_HUMAN	Phospholipid-transporting ATPase ABCA7 (EC 7.6.2.1) (ABCA-SSN) (ATP-binding cassette sub-family A member 7) (Autoantigen SS-N) (Macrophage ABC transporter)	ABCA7	Homo sapiens (Human)	amyloid-beta clearance by cellular catabolic process [GO:0150094]; amyloid-beta formation [GO:0034205]; apolipoprotein A-I-mediated signaling pathway [GO:0038027]; cholesterol efflux [GO:0033344]; high-density lipoprotein particle assembly [GO:0034380]; lipid transport [GO:0006869]; memory [GO:0007613]; negative regulation of amyloid precursor protein biosynthetic process [GO:0042985]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of endocytosis [GO:0045806]; negative regulation of MAPK cascade [GO:0043409]; negative regulation of PERK-mediated unfolded protein response [GO:1903898]; peptide cross-linking [GO:0018149]; phagocytosis [GO:0006909]; phospholipid efflux [GO:0033700]; phospholipid translocation [GO:0045332]; plasma membrane raft organization [GO:0044857]; positive regulation of amyloid-beta clearance [GO:1900223]; positive regulation of cholesterol efflux [GO:0010875]; positive regulation of engulfment of apoptotic cell [GO:1901076]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of phagocytosis [GO:0050766]; positive regulation of phospholipid efflux [GO:1902995]; positive regulation of protein localization to cell surface [GO:2000010]; protein localization to nucleus [GO:0034504]; regulation of amyloid precursor protein catabolic process [GO:1902991]; regulation of lipid metabolic process [GO:0019216]; visual learning [GO:0008542]	cell junction [GO:0030054]; cell surface [GO:0009986]; early endosome membrane [GO:0031901]; endoplasmic reticulum [GO:0005783]; glial cell projection [GO:0097386]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; phagocytic cup [GO:0001891]; plasma membrane [GO:0005886]; ruffle membrane [GO:0032587]	cell junction [GO:0030054]; cell surface [GO:0009986]; early endosome membrane [GO:0031901]; endoplasmic reticulum [GO:0005783]; glial cell projection [GO:0097386]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; phagocytic cup [GO:0001891]; plasma membrane [GO:0005886]; ruffle membrane [GO:0032587]; ABC-type transporter activity [GO:0140359]; apolipoprotein A-I receptor activity [GO:0034188]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; floppase activity [GO:0140328]; lipid transporter activity [GO:0005319]; phosphatidylcholine floppase activity [GO:0090554]; phosphatidylserine floppase activity [GO:0090556]; phospholipid transporter activity [GO:0005548]; amyloid-beta clearance by cellular catabolic process [GO:0150094]; amyloid-beta formation [GO:0034205]; apolipoprotein A-I-mediated signaling pathway [GO:0038027]; cholesterol efflux [GO:0033344]; high-density lipoprotein particle assembly [GO:0034380]; lipid transport [GO:0006869]; memory [GO:0007613]; negative regulation of amyloid precursor protein biosynthetic process [GO:0042985]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of endocytosis [GO:0045806]; negative regulation of MAPK cascade [GO:0043409]; negative regulation of PERK-mediated unfolded protein response [GO:1903898]; peptide cross-linking [GO:0018149]; phagocytosis [GO:0006909]; phospholipid efflux [GO:0033700]; phospholipid translocation [GO:0045332]; plasma membrane raft organization [GO:0044857]; positive regulation of amyloid-beta clearance [GO:1900223]; positive regulation of cholesterol efflux [GO:0010875]; positive regulation of engulfment of apoptotic cell [GO:1901076]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of phagocytosis [GO:0050766]; positive regulation of phospholipid efflux [GO:1902995]; positive regulation of protein localization to cell surface [GO:2000010]; protein localization to nucleus [GO:0034504]; regulation of amyloid precursor protein catabolic process [GO:1902991]; regulation of lipid metabolic process [GO:0019216]; visual learning [GO:0008542]	ABC-type transporter activity [GO:0140359]; apolipoprotein A-I receptor activity [GO:0034188]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; floppase activity [GO:0140328]; lipid transporter activity [GO:0005319]; phosphatidylcholine floppase activity [GO:0090554]; phosphatidylserine floppase activity [GO:0090556]; phospholipid transporter activity [GO:0005548]	GO:0000139; GO:0001891; GO:0005319; GO:0005524; GO:0005548; GO:0005783; GO:0005794; GO:0005886; GO:0006869; GO:0006909; GO:0007613; GO:0008542; GO:0009986; GO:0010875; GO:0016021; GO:0018149; GO:0019216; GO:0030054; GO:0031901; GO:0032587; GO:0033344; GO:0033700; GO:0034188; GO:0034205; GO:0034380; GO:0034504; GO:0038027; GO:0042626; GO:0042985; GO:0043231; GO:0043409; GO:0044857; GO:0045332; GO:0045806; GO:0050766; GO:0070374; GO:0090554; GO:0090556; GO:0097386; GO:0140328; GO:0140359; GO:0150094; GO:1900223; GO:1901076; GO:1902430; GO:1902991; GO:1902995; GO:1903898; GO:2000010	AARSTAQPQPTK	1.0096	17.2831	17.1104	17.1946	16.0364	16.1537	16.0464	16.5095	16.8867	16.783	17.593	17.6496	17.619	17.1747	16.6995	17.1668
P53804	TTC3_HUMAN	E3 ubiquitin-protein ligase TTC3 (EC 2.3.2.27) (Protein DCRR1) (RING finger protein 105) (RING-type E3 ubiquitin transferase TTC3) (TPR repeat protein D) (Tetratricopeptide repeat protein 3) (TPR repeat protein 3)	TTC3 DCRR1 RNF105 TPRD	Homo sapiens (Human)	protein K48-linked ubiquitination [GO:0070936]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]; protein K48-linked ubiquitination [GO:0070936]; ubiquitin-dependent protein catabolic process [GO:0006511]	metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]	GO:0004842; GO:0005634; GO:0005654; GO:0005730; GO:0005794; GO:0005829; GO:0006511; GO:0046872; GO:0070936	AAHQDFANIMK	1	17.9039	17.8511	16.3014	17.1029	17.2456	15.6628	17.7034	14.7722	15.2794	15.0248	16.0887	15.8788	17.2966	17.4118	16.7958
P49756	RBM25_HUMAN	RNA-binding protein 25 (Arg/Glu/Asp-rich protein of 120 kDa) (RED120) (Protein S164) (RNA-binding motif protein 25) (RNA-binding region-containing protein 7)	RBM25 RNPC7	Homo sapiens (Human)	"mRNA processing [GO:0006397]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]; regulation of apoptotic process [GO:0042981]; RNA splicing [GO:0008380]"	cytoplasm [GO:0005737]; nuclear speck [GO:0016607]	"cytoplasm [GO:0005737]; nuclear speck [GO:0016607]; mRNA binding [GO:0003729]; RNA binding [GO:0003723]; mRNA processing [GO:0006397]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]; regulation of apoptotic process [GO:0042981]; RNA splicing [GO:0008380]"	mRNA binding [GO:0003729]; RNA binding [GO:0003723]	GO:0000381; GO:0003723; GO:0003729; GO:0005737; GO:0006397; GO:0008380; GO:0016607; GO:0042981	ALRLLHDLQIGEK	1.0031	16.9273	16.8509	16.5345	10.1792	16.5864	16.543	16.6683	17.6538	16.0851	16.6968	16.9946	17.4001	17.2517	17.311	17.311
Q9P0L2	MARK1_HUMAN	Serine/threonine-protein kinase MARK1 (EC 2.7.11.1) (EC 2.7.11.26) (MAP/microtubule affinity-regulating kinase 1) (PAR1 homolog c) (Par-1c) (Par1c)	MARK1 KIAA1477 MARK	Homo sapiens (Human)	cytoskeleton organization [GO:0007010]; establishment of mitochondrion localization [GO:0051654]; intracellular signal transduction [GO:0035556]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of epithelial to mesenchymal transition [GO:0010719]; negative regulation of gene expression [GO:0010629]; neuron migration [GO:0001764]; peptidyl-serine phosphorylation [GO:0018105]; positive regulation of gene expression [GO:0010628]; protein phosphorylation [GO:0006468]; regulation of dendrite development [GO:0050773]; regulation of neuron projection development [GO:0010975]; Wnt signaling pathway [GO:0016055]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; dendrite [GO:0030425]; microtubule cytoskeleton [GO:0015630]; plasma membrane [GO:0005886]	"cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; dendrite [GO:0030425]; microtubule cytoskeleton [GO:0015630]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]; phosphatidic acid binding [GO:0070300]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]; phosphatidylserine binding [GO:0001786]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]; cytoskeleton organization [GO:0007010]; establishment of mitochondrion localization [GO:0051654]; intracellular signal transduction [GO:0035556]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of epithelial to mesenchymal transition [GO:0010719]; negative regulation of gene expression [GO:0010629]; neuron migration [GO:0001764]; peptidyl-serine phosphorylation [GO:0018105]; positive regulation of gene expression [GO:0010628]; protein phosphorylation [GO:0006468]; regulation of dendrite development [GO:0050773]; regulation of neuron projection development [GO:0010975]; Wnt signaling pathway [GO:0016055]"	"ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]; phosphatidic acid binding [GO:0070300]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]; phosphatidylserine binding [GO:0001786]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]"	GO:0000226; GO:0000287; GO:0001764; GO:0001786; GO:0004674; GO:0005524; GO:0005546; GO:0005737; GO:0005856; GO:0005886; GO:0006468; GO:0007010; GO:0010628; GO:0010629; GO:0010719; GO:0010975; GO:0015630; GO:0016055; GO:0018105; GO:0030425; GO:0035556; GO:0048156; GO:0050321; GO:0050773; GO:0051654; GO:0070300; GO:0106310	AENLLLDGDMNIK	1.0047	14.5916	16.4677	16.3452	19.1194	14.3468	14.908	16.746	16.5998	13.9335	14.7915	16.9281	17.1333	14.1187	19.7026	14.0554
O00429	DNM1L_HUMAN	Dynamin-1-like protein (EC 3.6.5.5) (Dnm1p/Vps1p-like protein) (DVLP) (Dynamin family member proline-rich carboxyl-terminal domain less) (Dymple) (Dynamin-like protein) (Dynamin-like protein 4) (Dynamin-like protein IV) (HdynIV) (Dynamin-related protein 1)	DNM1L DLP1 DRP1	Homo sapiens (Human)	calcium ion transport [GO:0006816]; dynamin family protein polymerization involved in mitochondrial fission [GO:0003374]; endocytosis [GO:0006897]; heart contraction [GO:0060047]; intracellular distribution of mitochondria [GO:0048312]; localization [GO:0051179]; membrane fusion [GO:0061025]; mitochondrial fission [GO:0000266]; mitochondrial fragmentation involved in apoptotic process [GO:0043653]; mitochondrial membrane fission [GO:0090149]; mitochondrion morphogenesis [GO:0070584]; mitochondrion organization [GO:0007005]; necroptotic process [GO:0070266]; peroxisome fission [GO:0016559]; positive regulation of apoptotic process [GO:0043065]; positive regulation of intrinsic apoptotic signaling pathway [GO:2001244]; positive regulation of mitochondrial fission [GO:0090141]; positive regulation of neutrophil chemotaxis [GO:0090023]; positive regulation of protein secretion [GO:0050714]; positive regulation of release of cytochrome c from mitochondria [GO:0090200]; protein complex oligomerization [GO:0051259]; protein localization to mitochondrion [GO:0070585]; protein-containing complex assembly [GO:0065003]; regulation of ATP metabolic process [GO:1903578]; regulation of autophagy of mitochondrion [GO:1903146]; regulation of gene expression [GO:0010468]; regulation of mitochondrion organization [GO:0010821]; regulation of peroxisome organization [GO:1900063]; regulation of ubiquitin protein ligase activity [GO:1904666]; release of cytochrome c from mitochondria [GO:0001836]; rhythmic process [GO:0048511]	anchoring junction [GO:0070161]; brush border [GO:0005903]; clathrin-coated pit [GO:0005905]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; microtubule [GO:0005874]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; perinuclear region of cytoplasm [GO:0048471]; peroxisome [GO:0005777]; protein-containing complex [GO:0032991]; synaptic vesicle membrane [GO:0030672]	anchoring junction [GO:0070161]; brush border [GO:0005903]; clathrin-coated pit [GO:0005905]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; microtubule [GO:0005874]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; perinuclear region of cytoplasm [GO:0048471]; peroxisome [GO:0005777]; protein-containing complex [GO:0032991]; synaptic vesicle membrane [GO:0030672]; GTP binding [GO:0005525]; GTP-dependent protein binding [GO:0030742]; GTPase activator activity [GO:0005096]; GTPase activity [GO:0003924]; identical protein binding [GO:0042802]; lipid binding [GO:0008289]; microtubule binding [GO:0008017]; molecular adaptor activity [GO:0060090]; protein homodimerization activity [GO:0042803]; small GTPase binding [GO:0031267]; ubiquitin protein ligase binding [GO:0031625]; calcium ion transport [GO:0006816]; dynamin family protein polymerization involved in mitochondrial fission [GO:0003374]; endocytosis [GO:0006897]; heart contraction [GO:0060047]; intracellular distribution of mitochondria [GO:0048312]; localization [GO:0051179]; membrane fusion [GO:0061025]; mitochondrial fission [GO:0000266]; mitochondrial fragmentation involved in apoptotic process [GO:0043653]; mitochondrial membrane fission [GO:0090149]; mitochondrion morphogenesis [GO:0070584]; mitochondrion organization [GO:0007005]; necroptotic process [GO:0070266]; peroxisome fission [GO:0016559]; positive regulation of apoptotic process [GO:0043065]; positive regulation of intrinsic apoptotic signaling pathway [GO:2001244]; positive regulation of mitochondrial fission [GO:0090141]; positive regulation of neutrophil chemotaxis [GO:0090023]; positive regulation of protein secretion [GO:0050714]; positive regulation of release of cytochrome c from mitochondria [GO:0090200]; protein complex oligomerization [GO:0051259]; protein localization to mitochondrion [GO:0070585]; protein-containing complex assembly [GO:0065003]; regulation of ATP metabolic process [GO:1903578]; regulation of autophagy of mitochondrion [GO:1903146]; regulation of gene expression [GO:0010468]; regulation of mitochondrion organization [GO:0010821]; regulation of peroxisome organization [GO:1900063]; regulation of ubiquitin protein ligase activity [GO:1904666]; release of cytochrome c from mitochondria [GO:0001836]; rhythmic process [GO:0048511]	GTP binding [GO:0005525]; GTP-dependent protein binding [GO:0030742]; GTPase activator activity [GO:0005096]; GTPase activity [GO:0003924]; identical protein binding [GO:0042802]; lipid binding [GO:0008289]; microtubule binding [GO:0008017]; molecular adaptor activity [GO:0060090]; protein homodimerization activity [GO:0042803]; small GTPase binding [GO:0031267]; ubiquitin protein ligase binding [GO:0031625]	GO:0000266; GO:0001836; GO:0003374; GO:0003924; GO:0005096; GO:0005525; GO:0005737; GO:0005739; GO:0005741; GO:0005777; GO:0005783; GO:0005789; GO:0005794; GO:0005829; GO:0005874; GO:0005903; GO:0005905; GO:0006816; GO:0006897; GO:0007005; GO:0008017; GO:0008289; GO:0010468; GO:0010821; GO:0016020; GO:0016559; GO:0030672; GO:0030742; GO:0031267; GO:0031625; GO:0032991; GO:0042802; GO:0042803; GO:0043065; GO:0043231; GO:0043653; GO:0048312; GO:0048471; GO:0048511; GO:0050714; GO:0051179; GO:0051259; GO:0060047; GO:0060090; GO:0061025; GO:0065003; GO:0070161; GO:0070266; GO:0070584; GO:0070585; GO:0090023; GO:0090141; GO:0090149; GO:0090200; GO:1900063; GO:1903146; GO:1903578; GO:1904666; GO:2001244	AEELLAEEK	1	15.8451	16.0877	15.9909	15.2568	15.0452	14.9668	16.3646	15.9127	16.0563	16.4942	16.2268	16.9098	15.9051	15.7373	15.8244
P02545	LMNA_HUMAN	Prelamin-A/C [Cleaved into: Lamin-A/C (70 kDa lamin) (Renal carcinoma antigen NY-REN-32)]	LMNA LMN1	Homo sapiens (Human)	cellular response to hypoxia [GO:0071456]; cellular senescence [GO:0090398]; DNA double-strand break attachment to nuclear envelope [GO:1990683]; establishment or maintenance of microtubule cytoskeleton polarity [GO:0030951]; heterochromatin assembly [GO:0031507]; muscle organ development [GO:0007517]; negative regulation of cardiac muscle hypertrophy in response to stress [GO:1903243]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of extrinsic apoptotic signaling pathway [GO:2001237]; negative regulation of mesenchymal cell proliferation [GO:0072201]; negative regulation of release of cytochrome c from mitochondria [GO:0090201]; nuclear envelope organization [GO:0006998]; nuclear migration [GO:0007097]; nuclear pore localization [GO:0051664]; positive regulation of gene expression [GO:0010628]; positive regulation of histone H3-K9 trimethylation [GO:1900114]; protein import into nucleus [GO:0006606]; protein localization [GO:0008104]; protein localization to nuclear envelope [GO:0090435]; protein localization to nucleus [GO:0034504]; regulation of cell migration [GO:0030334]; regulation of protein localization to nucleus [GO:1900180]; regulation of protein stability [GO:0031647]; regulation of telomere maintenance [GO:0032204]; ventricular cardiac muscle cell development [GO:0055015]	cytosol [GO:0005829]; intermediate filament [GO:0005882]; lamin filament [GO:0005638]; nuclear envelope [GO:0005635]; nuclear lamina [GO:0005652]; nuclear matrix [GO:0016363]; nuclear membrane [GO:0031965]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; site of double-strand break [GO:0035861]	cytosol [GO:0005829]; intermediate filament [GO:0005882]; lamin filament [GO:0005638]; nuclear envelope [GO:0005635]; nuclear lamina [GO:0005652]; nuclear matrix [GO:0016363]; nuclear membrane [GO:0031965]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; site of double-strand break [GO:0035861]; identical protein binding [GO:0042802]; structural constituent of cytoskeleton [GO:0005200]; structural molecule activity [GO:0005198]; cellular response to hypoxia [GO:0071456]; cellular senescence [GO:0090398]; DNA double-strand break attachment to nuclear envelope [GO:1990683]; establishment or maintenance of microtubule cytoskeleton polarity [GO:0030951]; heterochromatin assembly [GO:0031507]; muscle organ development [GO:0007517]; negative regulation of cardiac muscle hypertrophy in response to stress [GO:1903243]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of extrinsic apoptotic signaling pathway [GO:2001237]; negative regulation of mesenchymal cell proliferation [GO:0072201]; negative regulation of release of cytochrome c from mitochondria [GO:0090201]; nuclear envelope organization [GO:0006998]; nuclear migration [GO:0007097]; nuclear pore localization [GO:0051664]; positive regulation of gene expression [GO:0010628]; positive regulation of histone H3-K9 trimethylation [GO:1900114]; protein import into nucleus [GO:0006606]; protein localization [GO:0008104]; protein localization to nuclear envelope [GO:0090435]; protein localization to nucleus [GO:0034504]; regulation of cell migration [GO:0030334]; regulation of protein localization to nucleus [GO:1900180]; regulation of protein stability [GO:0031647]; regulation of telomere maintenance [GO:0032204]; ventricular cardiac muscle cell development [GO:0055015]	identical protein binding [GO:0042802]; structural constituent of cytoskeleton [GO:0005200]; structural molecule activity [GO:0005198]	GO:0005198; GO:0005200; GO:0005634; GO:0005635; GO:0005638; GO:0005652; GO:0005654; GO:0005829; GO:0005882; GO:0006606; GO:0006998; GO:0007097; GO:0007517; GO:0008104; GO:0008285; GO:0010628; GO:0016363; GO:0016607; GO:0030334; GO:0030951; GO:0031507; GO:0031647; GO:0031965; GO:0032204; GO:0034504; GO:0035861; GO:0042802; GO:0048471; GO:0051664; GO:0055015; GO:0071456; GO:0072201; GO:0090201; GO:0090398; GO:0090435; GO:1900114; GO:1900180; GO:1903243; GO:1990683; GO:2001237	AAYEAELGDAR	1.0079	16.0868	17.4312	16.6249	13.7576	12.3978	11.1638	16.2361	16.3479	17.1412	16.6036	17.773	16.3359	15.8827	13.9215	20.0491
Q9NRE2	TSH2_HUMAN	Teashirt homolog 2 (Ovarian cancer-related protein 10-2) (OVC10-2) (Zinc finger protein 218)	TSHZ2 C20orf17 TSH2 ZNF218	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]; nucleus [GO:0005634]	"chromatin [GO:0000785]; nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; regulation of transcription by RNA polymerase II [GO:0006357]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]"	GO:0000785; GO:0000981; GO:0003677; GO:0005634; GO:0006357; GO:0046872	AAGYAQEEQLK	1.0033	17.2299	17.2866	15.3649	16.428	13.7161	13.8054	16.6154	13.9202	15.6675	15.6894	15.7803	15.9788	17.0791	15.4652	15.3879
P20810	ICAL_HUMAN	Calpastatin (Calpain inhibitor) (Sperm BS-17 component)	CAST	Homo sapiens (Human)	inhibition of cysteine-type endopeptidase activity [GO:0097340]; negative regulation of type B pancreatic cell apoptotic process [GO:2000675]; presynaptic active zone organization [GO:1990709]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; membrane [GO:0016020]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; membrane [GO:0016020]; cadherin binding [GO:0045296]; calcium-dependent cysteine-type endopeptidase inhibitor activity [GO:0010859]; endopeptidase inhibitor activity [GO:0004866]; RNA binding [GO:0003723]; inhibition of cysteine-type endopeptidase activity [GO:0097340]; negative regulation of type B pancreatic cell apoptotic process [GO:2000675]; presynaptic active zone organization [GO:1990709]	cadherin binding [GO:0045296]; calcium-dependent cysteine-type endopeptidase inhibitor activity [GO:0010859]; endopeptidase inhibitor activity [GO:0004866]; RNA binding [GO:0003723]	GO:0003723; GO:0004866; GO:0005737; GO:0005783; GO:0005829; GO:0010859; GO:0016020; GO:0045296; GO:0097340; GO:1990709; GO:2000675	AAAPAPVSEAVCR	0.98586	15.5091	15.2133	16.5753	14.8279	14.2662	14.7455	15.5783	16.0535	16.0259	16.2712	16.0243	15.8404	15.8833	16.1097	15.9067
Q63HK5	TSH3_HUMAN	Teashirt homolog 3 (Zinc finger protein 537)	TSHZ3 KIAA1474 TSH3 ZNF537	Homo sapiens (Human)	"long-term synaptic potentiation [GO:0060291]; negative regulation of DNA-templated transcription [GO:0045892]; positive regulation of synaptic transmission, glutamatergic [GO:0051968]; regulation of respiratory gaseous exchange by nervous system process [GO:0002087]; regulation of transcription by RNA polymerase II [GO:0006357]"	chromatin [GO:0000785]; growth cone [GO:0030426]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	"chromatin [GO:0000785]; growth cone [GO:0030426]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; long-term synaptic potentiation [GO:0060291]; negative regulation of DNA-templated transcription [GO:0045892]; positive regulation of synaptic transmission, glutamatergic [GO:0051968]; regulation of respiratory gaseous exchange by nervous system process [GO:0002087]; regulation of transcription by RNA polymerase II [GO:0006357]"	"chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]"	GO:0000785; GO:0000981; GO:0002087; GO:0003677; GO:0003682; GO:0005634; GO:0005654; GO:0005886; GO:0006357; GO:0030426; GO:0045892; GO:0046872; GO:0051968; GO:0060291	AAAYVSEELK	0.48404	15.1533	15.8995	15.6087	14.8631	15.0193	14.9329	15.7051	14.5386	15.8041	15.4957	15.56	15.7156	14.6695	15.5362	16.0336
A8K0N9	A8K0N9_HUMAN	Bardet-Biedl syndrome 2 protein homolog		Homo sapiens (Human)	non-motile cilium assembly [GO:1905515]	BBSome [GO:0034464]; ciliary membrane [GO:0060170]; cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]	BBSome [GO:0034464]; ciliary membrane [GO:0060170]; cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]; non-motile cilium assembly [GO:1905515]		GO:0005737; GO:0005815; GO:0034464; GO:0060170; GO:1905515	AELASPLNEADGHR	1.0092	14.3582	15.5301	15.6637	15.3629	15.2026	15.2626	15.3669	15.3725	15.2197	15.8008	15.7896	14.9299	15.3607	15.4851	15.7791
P14136	GFAP_HUMAN	Glial fibrillary acidic protein (GFAP)	GFAP	Homo sapiens (Human)	astrocyte development [GO:0014002]; Bergmann glial cell differentiation [GO:0060020]; D-aspartate import across plasma membrane [GO:0070779]; extracellular matrix organization [GO:0030198]; gene expression [GO:0010467]; intermediate filament organization [GO:0045109]; intracellular protein transport [GO:0006886]; long-term synaptic potentiation [GO:0060291]; negative regulation of neuron projection development [GO:0010977]; neuron projection regeneration [GO:0031102]; positive regulation of Schwann cell proliferation [GO:0010625]; regulation of chaperone-mediated autophagy [GO:1904714]; regulation of neurotransmitter uptake [GO:0051580]; regulation of protein-containing complex assembly [GO:0043254]; response to wounding [GO:0009611]; Schwann cell proliferation [GO:0014010]	astrocyte end-foot [GO:0097450]; cell body [GO:0044297]; cell projection [GO:0042995]; cytoplasm [GO:0005737]; cytoplasmic side of lysosomal membrane [GO:0098574]; cytosol [GO:0005829]; intermediate filament [GO:0005882]; intermediate filament cytoskeleton [GO:0045111]	astrocyte end-foot [GO:0097450]; cell body [GO:0044297]; cell projection [GO:0042995]; cytoplasm [GO:0005737]; cytoplasmic side of lysosomal membrane [GO:0098574]; cytosol [GO:0005829]; intermediate filament [GO:0005882]; intermediate filament cytoskeleton [GO:0045111]; identical protein binding [GO:0042802]; integrin binding [GO:0005178]; kinase binding [GO:0019900]; structural constituent of cytoskeleton [GO:0005200]; astrocyte development [GO:0014002]; Bergmann glial cell differentiation [GO:0060020]; D-aspartate import across plasma membrane [GO:0070779]; extracellular matrix organization [GO:0030198]; gene expression [GO:0010467]; intermediate filament organization [GO:0045109]; intracellular protein transport [GO:0006886]; long-term synaptic potentiation [GO:0060291]; negative regulation of neuron projection development [GO:0010977]; neuron projection regeneration [GO:0031102]; positive regulation of Schwann cell proliferation [GO:0010625]; regulation of chaperone-mediated autophagy [GO:1904714]; regulation of neurotransmitter uptake [GO:0051580]; regulation of protein-containing complex assembly [GO:0043254]; response to wounding [GO:0009611]; Schwann cell proliferation [GO:0014010]	identical protein binding [GO:0042802]; integrin binding [GO:0005178]; kinase binding [GO:0019900]; structural constituent of cytoskeleton [GO:0005200]	GO:0005178; GO:0005200; GO:0005737; GO:0005829; GO:0005882; GO:0006886; GO:0009611; GO:0010467; GO:0010625; GO:0010977; GO:0014002; GO:0014010; GO:0019900; GO:0030198; GO:0031102; GO:0042802; GO:0042995; GO:0043254; GO:0044297; GO:0045109; GO:0045111; GO:0051580; GO:0060020; GO:0060291; GO:0070779; GO:0097450; GO:0098574; GO:1904714	AEMMELNDR	1.0118	14.1127	15.0826	15.9416	12.9464	14.7044	15.0312	16.9328	14.3991	16.0519	16.2282	16.5411	16.4413	14.1163	16.0003	15.8308
Q96L34	MARK4_HUMAN	MAP/microtubule affinity-regulating kinase 4 (EC 2.7.11.1) (MAP/microtubule affinity-regulating kinase-like 1)	MARK4 KIAA1860 MARKL1	Homo sapiens (Human)	cell cycle [GO:0007049]; cell division [GO:0051301]; cilium organization [GO:0044782]; intracellular signal transduction [GO:0035556]; microtubule bundle formation [GO:0001578]; microtubule cytoskeleton organization [GO:0000226]; nervous system development [GO:0007399]; positive regulation of cell cycle [GO:0045787]; positive regulation of cilium assembly [GO:0045724]; positive regulation of programmed cell death [GO:0043068]; positive regulation of protein localization to centrosome [GO:1904781]; protein phosphorylation [GO:0006468]; regulation of centrosome cycle [GO:0046605]	centrosome [GO:0005813]; ciliary basal body [GO:0036064]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; gamma-tubulin complex [GO:0000930]; microtubule cytoskeleton [GO:0015630]; microtubule organizing center [GO:0005815]; midbody [GO:0030496]; neuron projection [GO:0043005]	centrosome [GO:0005813]; ciliary basal body [GO:0036064]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; gamma-tubulin complex [GO:0000930]; microtubule cytoskeleton [GO:0015630]; microtubule organizing center [GO:0005815]; midbody [GO:0030496]; neuron projection [GO:0043005]; ATP binding [GO:0005524]; gamma-tubulin binding [GO:0043015]; microtubule binding [GO:0008017]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]; ubiquitin binding [GO:0043130]; cell cycle [GO:0007049]; cell division [GO:0051301]; cilium organization [GO:0044782]; intracellular signal transduction [GO:0035556]; microtubule bundle formation [GO:0001578]; microtubule cytoskeleton organization [GO:0000226]; nervous system development [GO:0007399]; positive regulation of cell cycle [GO:0045787]; positive regulation of cilium assembly [GO:0045724]; positive regulation of programmed cell death [GO:0043068]; positive regulation of protein localization to centrosome [GO:1904781]; protein phosphorylation [GO:0006468]; regulation of centrosome cycle [GO:0046605]	ATP binding [GO:0005524]; gamma-tubulin binding [GO:0043015]; microtubule binding [GO:0008017]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]; ubiquitin binding [GO:0043130]	GO:0000226; GO:0000930; GO:0001578; GO:0004674; GO:0005524; GO:0005737; GO:0005813; GO:0005815; GO:0005829; GO:0006468; GO:0007049; GO:0007399; GO:0008017; GO:0015630; GO:0030425; GO:0030496; GO:0035556; GO:0036064; GO:0043005; GO:0043015; GO:0043068; GO:0043130; GO:0044782; GO:0045724; GO:0045787; GO:0046605; GO:0048156; GO:0050321; GO:0051301; GO:0106310; GO:1904781	AEIPERRK	0.92771	15.2158	15.4031	15.2145	14.4053	14.3214	14.5085	15.622	15.1894	15.5556	15.5502	16.4228	15.9578	15.6087	15.4587	15.4638
Q5KU26	COL12_HUMAN	Collectin-12 (Collectin placenta protein 1) (CL-P1) (hCL-P1) (Nurse cell scavenger receptor 2) (Scavenger receptor class A member 4) (Scavenger receptor with C-type lectin)	COLEC12 CLP1 NSR2 SCARA4 SRCL	Homo sapiens (Human)	"carbohydrate mediated signaling [GO:0009756]; cellular response to exogenous dsRNA [GO:0071360]; defense response [GO:0006952]; defense response to bacterium [GO:0042742]; innate immune response [GO:0045087]; phagocytosis, recognition [GO:0006910]; plasma membrane raft organization [GO:0044857]; toll-like receptor 3 signaling pathway [GO:0034138]"	collagen trimer [GO:0005581]; endocytic vesicle membrane [GO:0030666]; extracellular matrix [GO:0031012]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	"collagen trimer [GO:0005581]; endocytic vesicle membrane [GO:0030666]; extracellular matrix [GO:0031012]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; galactose binding [GO:0005534]; low-density lipoprotein particle binding [GO:0030169]; metal ion binding [GO:0046872]; pattern recognition receptor activity [GO:0038187]; scavenger receptor activity [GO:0005044]; carbohydrate mediated signaling [GO:0009756]; cellular response to exogenous dsRNA [GO:0071360]; defense response [GO:0006952]; defense response to bacterium [GO:0042742]; innate immune response [GO:0045087]; phagocytosis, recognition [GO:0006910]; plasma membrane raft organization [GO:0044857]; toll-like receptor 3 signaling pathway [GO:0034138]"	galactose binding [GO:0005534]; low-density lipoprotein particle binding [GO:0030169]; metal ion binding [GO:0046872]; pattern recognition receptor activity [GO:0038187]; scavenger receptor activity [GO:0005044]	GO:0005044; GO:0005534; GO:0005581; GO:0005615; GO:0005886; GO:0006910; GO:0006952; GO:0009756; GO:0016021; GO:0030169; GO:0030666; GO:0031012; GO:0034138; GO:0038187; GO:0042742; GO:0044857; GO:0045087; GO:0046872; GO:0071360	AISTNSELSTFR	0.99843	12.6731	13.7849	13.7566	13.1936	13.3005	13.2392	19.9133	13.8127	13.6816	20.0632	13.7607	14.7283	19.9372	19.9516	13.893
B4DFL1	B4DFL1_HUMAN	Dihydrolipoyl dehydrogenase (EC 1.8.1.4)		Homo sapiens (Human)	cell redox homeostasis [GO:0045454]	acrosomal vesicle [GO:0001669]; motile cilium [GO:0031514]	acrosomal vesicle [GO:0001669]; motile cilium [GO:0031514]; dihydrolipoyl dehydrogenase activity [GO:0004148]; flavin adenine dinucleotide binding [GO:0050660]; cell redox homeostasis [GO:0045454]	dihydrolipoyl dehydrogenase activity [GO:0004148]; flavin adenine dinucleotide binding [GO:0050660]	GO:0001669; GO:0004148; GO:0031514; GO:0045454; GO:0050660	AAQLGFK	1.0153	15.2509	15.0986	15.0487	14.4761	14.0694	14.1201	15.4851	15.5651	15.6527	15.638	15.7146	15.6881	15.1611	15.273	15.373
P53355	DAPK1_HUMAN	Death-associated protein kinase 1 (DAP kinase 1) (EC 2.7.11.1)	DAPK1 DAPK	Homo sapiens (Human)	apoptotic process [GO:0006915]; apoptotic signaling pathway [GO:0097190]; cellular response to hydroperoxide [GO:0071447]; cellular response to interferon-gamma [GO:0071346]; defense response to tumor cell [GO:0002357]; extrinsic apoptotic signaling pathway via death domain receptors [GO:0008625]; intracellular signal transduction [GO:0035556]; negative regulation of apoptotic process [GO:0043066]; negative regulation of translation [GO:0017148]; positive regulation of apoptotic process [GO:0043065]; positive regulation of autophagic cell death [GO:1904094]; positive regulation of autophagy [GO:0010508]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of apoptotic process [GO:0042981]; regulation of autophagy [GO:0010506]; regulation of NMDA receptor activity [GO:2000310]; regulation of response to tumor cell [GO:0002834]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; DAPK1-calmodulin complex [GO:1990722]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; DAPK1-calmodulin complex [GO:1990722]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; calmodulin-dependent protein kinase activity [GO:0004683]; GTP binding [GO:0005525]; identical protein binding [GO:0042802]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; syntaxin-1 binding [GO:0017075]; apoptotic process [GO:0006915]; apoptotic signaling pathway [GO:0097190]; cellular response to hydroperoxide [GO:0071447]; cellular response to interferon-gamma [GO:0071346]; defense response to tumor cell [GO:0002357]; extrinsic apoptotic signaling pathway via death domain receptors [GO:0008625]; intracellular signal transduction [GO:0035556]; negative regulation of apoptotic process [GO:0043066]; negative regulation of translation [GO:0017148]; positive regulation of apoptotic process [GO:0043065]; positive regulation of autophagic cell death [GO:1904094]; positive regulation of autophagy [GO:0010508]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of apoptotic process [GO:0042981]; regulation of autophagy [GO:0010506]; regulation of NMDA receptor activity [GO:2000310]; regulation of response to tumor cell [GO:0002834]	ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; calmodulin-dependent protein kinase activity [GO:0004683]; GTP binding [GO:0005525]; identical protein binding [GO:0042802]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; syntaxin-1 binding [GO:0017075]	GO:0002357; GO:0002834; GO:0004672; GO:0004674; GO:0004683; GO:0005516; GO:0005524; GO:0005525; GO:0005634; GO:0005737; GO:0005886; GO:0006468; GO:0006915; GO:0008625; GO:0010506; GO:0010508; GO:0015629; GO:0017075; GO:0017148; GO:0035556; GO:0042802; GO:0042981; GO:0043065; GO:0043066; GO:0043280; GO:0046777; GO:0071346; GO:0071447; GO:0097190; GO:0106310; GO:1904094; GO:1990722; GO:2000310	ALCEAGCNVNIK	1.0033	16.108	16.1028	12.4422	15.6385	13.3581	15.1085	13.0545	15.9708	13.7347	16.6288	16.4322	16.6611	13.0887	16.4192	16.4064
Q5S007	LRRK2_HUMAN	Leucine-rich repeat serine/threonine-protein kinase 2 (EC 2.7.11.1) (EC 3.6.5.-) (Dardarin)	LRRK2 PARK8	Homo sapiens (Human)	"autophagy [GO:0006914]; calcium-mediated signaling [GO:0019722]; canonical Wnt signaling pathway [GO:0060070]; cellular response to dopamine [GO:1903351]; cellular response to manganese ion [GO:0071287]; cellular response to organic cyclic compound [GO:0071407]; cellular response to oxidative stress [GO:0034599]; cellular response to starvation [GO:0009267]; determination of adult lifespan [GO:0008340]; endocytosis [GO:0006897]; endoplasmic reticulum organization [GO:0007029]; excitatory postsynaptic potential [GO:0060079]; exploration behavior [GO:0035640]; Golgi organization [GO:0007030]; GTP metabolic process [GO:0046039]; intracellular distribution of mitochondria [GO:0048312]; intracellular signal transduction [GO:0035556]; JNK cascade [GO:0007254]; locomotory exploration behavior [GO:0035641]; lysosome organization [GO:0007040]; MAPK cascade [GO:0000165]; mitochondrion localization [GO:0051646]; mitochondrion organization [GO:0007005]; negative regulation of autophagosome assembly [GO:1902902]; negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [GO:1902236]; negative regulation of excitatory postsynaptic potential [GO:0090394]; negative regulation of GTPase activity [GO:0034260]; negative regulation of hydrogen peroxide-induced cell death [GO:1903206]; negative regulation of late endosome to lysosome transport [GO:1902823]; negative regulation of macroautophagy [GO:0016242]; negative regulation of neuron death [GO:1901215]; negative regulation of neuron projection development [GO:0010977]; negative regulation of protein binding [GO:0032091]; negative regulation of protein phosphorylation [GO:0001933]; negative regulation of protein processing [GO:0010955]; negative regulation of protein processing involved in protein targeting to mitochondrion [GO:1903217]; negative regulation of protein targeting to mitochondrion [GO:1903215]; negative regulation of thioredoxin peroxidase activity by peptidyl-threonine phosphorylation [GO:1903125]; neuromuscular junction development [GO:0007528]; neuron death [GO:0070997]; neuron projection arborization [GO:0140058]; neuron projection morphogenesis [GO:0048812]; olfactory bulb development [GO:0021772]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; phosphorylation [GO:0016310]; positive regulation of autophagy [GO:0010508]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of dopamine receptor signaling pathway [GO:0060161]; positive regulation of histone deacetylase activity [GO:1901727]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of microglial cell activation [GO:1903980]; positive regulation of nitric-oxide synthase biosynthetic process [GO:0051770]; positive regulation of programmed cell death [GO:0043068]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein autoubiquitination [GO:1902499]; positive regulation of protein binding [GO:0032092]; positive regulation of protein kinase activity [GO:0045860]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein ubiquitination [GO:0031398]; positive regulation of synaptic vesicle endocytosis [GO:1900244]; positive regulation of tumor necrosis factor production [GO:0032760]; protein autophosphorylation [GO:0046777]; protein import into nucleus [GO:0006606]; protein localization [GO:0008104]; protein localization to endoplasmic reticulum exit site [GO:0070973]; protein localization to mitochondrion [GO:0070585]; protein phosphorylation [GO:0006468]; reactive oxygen species metabolic process [GO:0072593]; regulation of autophagy [GO:0010506]; regulation of branching morphogenesis of a nerve [GO:2000172]; regulation of CAMKK-AMPK signaling cascade [GO:1905289]; regulation of canonical Wnt signaling pathway [GO:0060828]; regulation of dendritic spine morphogenesis [GO:0061001]; regulation of dopamine receptor signaling pathway [GO:0060159]; regulation of ER to Golgi vesicle-mediated transport [GO:0060628]; regulation of kidney size [GO:0035564]; regulation of locomotion [GO:0040012]; regulation of lysosomal lumen pH [GO:0035751]; regulation of membrane potential [GO:0042391]; regulation of mitochondrial depolarization [GO:0051900]; regulation of mitochondrial fission [GO:0090140]; regulation of neuroblast proliferation [GO:1902692]; regulation of neuron death [GO:1901214]; regulation of neuron maturation [GO:0014041]; regulation of protein kinase A signaling [GO:0010738]; regulation of protein stability [GO:0031647]; regulation of retrograde transport, endosome to Golgi [GO:1905279]; regulation of synaptic transmission, glutamatergic [GO:0051966]; regulation of synaptic vesicle exocytosis [GO:2000300]; regulation of synaptic vesicle transport [GO:1902803]; response to oxidative stress [GO:0006979]; signal transduction [GO:0007165]; spermatogenesis [GO:0007283]; striatum development [GO:0021756]; tangential migration from the subventricular zone to the olfactory bulb [GO:0022028]; Wnt signalosome assembly [GO:1904887]"	"amphisome [GO:0044753]; anchoring junction [GO:0070161]; autolysosome [GO:0044754]; axon [GO:0030424]; caveola neck [GO:0099400]; cytoplasm [GO:0005737]; cytoplasmic side of mitochondrial outer membrane [GO:0032473]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendrite cytoplasm [GO:0032839]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum exit site [GO:0070971]; endoplasmic reticulum membrane [GO:0005789]; endosome [GO:0005768]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; Golgi-associated vesicle [GO:0005798]; growth cone [GO:0030426]; inclusion body [GO:0016234]; intracellular membrane-bounded organelle [GO:0043231]; lysosome [GO:0005764]; membrane raft [GO:0045121]; microvillus [GO:0005902]; mitochondrial inner membrane [GO:0005743]; mitochondrial matrix [GO:0005759]; mitochondrial membrane [GO:0031966]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; multivesicular body, internal vesicle [GO:0097487]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; presynaptic cytosol [GO:0099523]; ribonucleoprotein complex [GO:1990904]; synaptic vesicle membrane [GO:0030672]; terminal bouton [GO:0043195]; trans-Golgi network [GO:0005802]; Wnt signalosome [GO:1990909]"	"amphisome [GO:0044753]; anchoring junction [GO:0070161]; autolysosome [GO:0044754]; axon [GO:0030424]; caveola neck [GO:0099400]; cytoplasm [GO:0005737]; cytoplasmic side of mitochondrial outer membrane [GO:0032473]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendrite cytoplasm [GO:0032839]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum exit site [GO:0070971]; endoplasmic reticulum membrane [GO:0005789]; endosome [GO:0005768]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; Golgi-associated vesicle [GO:0005798]; growth cone [GO:0030426]; inclusion body [GO:0016234]; intracellular membrane-bounded organelle [GO:0043231]; lysosome [GO:0005764]; membrane raft [GO:0045121]; microvillus [GO:0005902]; mitochondrial inner membrane [GO:0005743]; mitochondrial matrix [GO:0005759]; mitochondrial membrane [GO:0031966]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; multivesicular body, internal vesicle [GO:0097487]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; presynaptic cytosol [GO:0099523]; ribonucleoprotein complex [GO:1990904]; synaptic vesicle membrane [GO:0030672]; terminal bouton [GO:0043195]; trans-Golgi network [GO:0005802]; Wnt signalosome [GO:1990909]; actin binding [GO:0003779]; ATP binding [GO:0005524]; beta-catenin destruction complex binding [GO:1904713]; clathrin binding [GO:0030276]; co-receptor binding [GO:0039706]; GTP binding [GO:0005525]; GTP-dependent protein kinase activity [GO:0034211]; GTPase activator activity [GO:0005096]; GTPase activity [GO:0003924]; identical protein binding [GO:0042802]; JUN kinase kinase kinase activity [GO:0004706]; kinase activity [GO:0016301]; magnesium ion binding [GO:0000287]; MAP kinase kinase kinase activity [GO:0004709]; microtubule binding [GO:0008017]; peroxidase inhibitor activity [GO:0036479]; protein homodimerization activity [GO:0042803]; protein kinase A binding [GO:0051018]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; protein serine/threonine phosphatase activity [GO:0004722]; signaling receptor complex adaptor activity [GO:0030159]; small GTPase binding [GO:0031267]; SNARE binding [GO:0000149]; syntaxin-1 binding [GO:0017075]; transmembrane transporter binding [GO:0044325]; tubulin binding [GO:0015631]; autophagy [GO:0006914]; calcium-mediated signaling [GO:0019722]; canonical Wnt signaling pathway [GO:0060070]; cellular response to dopamine [GO:1903351]; cellular response to manganese ion [GO:0071287]; cellular response to organic cyclic compound [GO:0071407]; cellular response to oxidative stress [GO:0034599]; cellular response to starvation [GO:0009267]; determination of adult lifespan [GO:0008340]; endocytosis [GO:0006897]; endoplasmic reticulum organization [GO:0007029]; excitatory postsynaptic potential [GO:0060079]; exploration behavior [GO:0035640]; Golgi organization [GO:0007030]; GTP metabolic process [GO:0046039]; intracellular distribution of mitochondria [GO:0048312]; intracellular signal transduction [GO:0035556]; JNK cascade [GO:0007254]; locomotory exploration behavior [GO:0035641]; lysosome organization [GO:0007040]; MAPK cascade [GO:0000165]; mitochondrion localization [GO:0051646]; mitochondrion organization [GO:0007005]; negative regulation of autophagosome assembly [GO:1902902]; negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [GO:1902236]; negative regulation of excitatory postsynaptic potential [GO:0090394]; negative regulation of GTPase activity [GO:0034260]; negative regulation of hydrogen peroxide-induced cell death [GO:1903206]; negative regulation of late endosome to lysosome transport [GO:1902823]; negative regulation of macroautophagy [GO:0016242]; negative regulation of neuron death [GO:1901215]; negative regulation of neuron projection development [GO:0010977]; negative regulation of protein binding [GO:0032091]; negative regulation of protein phosphorylation [GO:0001933]; negative regulation of protein processing [GO:0010955]; negative regulation of protein processing involved in protein targeting to mitochondrion [GO:1903217]; negative regulation of protein targeting to mitochondrion [GO:1903215]; negative regulation of thioredoxin peroxidase activity by peptidyl-threonine phosphorylation [GO:1903125]; neuromuscular junction development [GO:0007528]; neuron death [GO:0070997]; neuron projection arborization [GO:0140058]; neuron projection morphogenesis [GO:0048812]; olfactory bulb development [GO:0021772]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; phosphorylation [GO:0016310]; positive regulation of autophagy [GO:0010508]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of dopamine receptor signaling pathway [GO:0060161]; positive regulation of histone deacetylase activity [GO:1901727]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of microglial cell activation [GO:1903980]; positive regulation of nitric-oxide synthase biosynthetic process [GO:0051770]; positive regulation of programmed cell death [GO:0043068]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein autoubiquitination [GO:1902499]; positive regulation of protein binding [GO:0032092]; positive regulation of protein kinase activity [GO:0045860]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein ubiquitination [GO:0031398]; positive regulation of synaptic vesicle endocytosis [GO:1900244]; positive regulation of tumor necrosis factor production [GO:0032760]; protein autophosphorylation [GO:0046777]; protein import into nucleus [GO:0006606]; protein localization [GO:0008104]; protein localization to endoplasmic reticulum exit site [GO:0070973]; protein localization to mitochondrion [GO:0070585]; protein phosphorylation [GO:0006468]; reactive oxygen species metabolic process [GO:0072593]; regulation of autophagy [GO:0010506]; regulation of branching morphogenesis of a nerve [GO:2000172]; regulation of CAMKK-AMPK signaling cascade [GO:1905289]; regulation of canonical Wnt signaling pathway [GO:0060828]; regulation of dendritic spine morphogenesis [GO:0061001]; regulation of dopamine receptor signaling pathway [GO:0060159]; regulation of ER to Golgi vesicle-mediated transport [GO:0060628]; regulation of kidney size [GO:0035564]; regulation of locomotion [GO:0040012]; regulation of lysosomal lumen pH [GO:0035751]; regulation of membrane potential [GO:0042391]; regulation of mitochondrial depolarization [GO:0051900]; regulation of mitochondrial fission [GO:0090140]; regulation of neuroblast proliferation [GO:1902692]; regulation of neuron death [GO:1901214]; regulation of neuron maturation [GO:0014041]; regulation of protein kinase A signaling [GO:0010738]; regulation of protein stability [GO:0031647]; regulation of retrograde transport, endosome to Golgi [GO:1905279]; regulation of synaptic transmission, glutamatergic [GO:0051966]; regulation of synaptic vesicle exocytosis [GO:2000300]; regulation of synaptic vesicle transport [GO:1902803]; response to oxidative stress [GO:0006979]; signal transduction [GO:0007165]; spermatogenesis [GO:0007283]; striatum development [GO:0021756]; tangential migration from the subventricular zone to the olfactory bulb [GO:0022028]; Wnt signalosome assembly [GO:1904887]"	actin binding [GO:0003779]; ATP binding [GO:0005524]; beta-catenin destruction complex binding [GO:1904713]; clathrin binding [GO:0030276]; co-receptor binding [GO:0039706]; GTP binding [GO:0005525]; GTP-dependent protein kinase activity [GO:0034211]; GTPase activator activity [GO:0005096]; GTPase activity [GO:0003924]; identical protein binding [GO:0042802]; JUN kinase kinase kinase activity [GO:0004706]; kinase activity [GO:0016301]; magnesium ion binding [GO:0000287]; MAP kinase kinase kinase activity [GO:0004709]; microtubule binding [GO:0008017]; peroxidase inhibitor activity [GO:0036479]; protein homodimerization activity [GO:0042803]; protein kinase A binding [GO:0051018]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; protein serine/threonine phosphatase activity [GO:0004722]; signaling receptor complex adaptor activity [GO:0030159]; small GTPase binding [GO:0031267]; SNARE binding [GO:0000149]; syntaxin-1 binding [GO:0017075]; transmembrane transporter binding [GO:0044325]; tubulin binding [GO:0015631]	GO:0000139; GO:0000149; GO:0000165; GO:0000287; GO:0001933; GO:0001934; GO:0003779; GO:0003924; GO:0004672; GO:0004674; GO:0004706; GO:0004709; GO:0004722; GO:0005096; GO:0005524; GO:0005525; GO:0005615; GO:0005737; GO:0005739; GO:0005741; GO:0005743; GO:0005759; GO:0005764; GO:0005768; GO:0005783; GO:0005789; GO:0005794; GO:0005798; GO:0005802; GO:0005829; GO:0005886; GO:0005902; GO:0006468; GO:0006606; GO:0006897; GO:0006914; GO:0006979; GO:0007005; GO:0007029; GO:0007030; GO:0007040; GO:0007165; GO:0007254; GO:0007283; GO:0007528; GO:0008017; GO:0008104; GO:0008340; GO:0009267; GO:0010506; GO:0010508; GO:0010738; GO:0010955; GO:0010977; GO:0014041; GO:0015631; GO:0016234; GO:0016242; GO:0016301; GO:0016310; GO:0017075; GO:0018105; GO:0018107; GO:0019722; GO:0021756; GO:0021772; GO:0022028; GO:0030159; GO:0030276; GO:0030424; GO:0030425; GO:0030426; GO:0030672; GO:0031267; GO:0031398; GO:0031410; GO:0031647; GO:0031966; GO:0032091; GO:0032092; GO:0032436; GO:0032473; GO:0032760; GO:0032839; GO:0034211; GO:0034260; GO:0034599; GO:0035556; GO:0035564; GO:0035640; GO:0035641; GO:0035751; GO:0036479; GO:0039706; GO:0040012; GO:0042391; GO:0042802; GO:0042803; GO:0043005; GO:0043025; GO:0043068; GO:0043195; GO:0043204; GO:0043231; GO:0043406; GO:0044325; GO:0044753; GO:0044754; GO:0045121; GO:0045860; GO:0046039; GO:0046777; GO:0048312; GO:0048812; GO:0051018; GO:0051646; GO:0051770; GO:0051900; GO:0051966; GO:0060070; GO:0060079; GO:0060159; GO:0060161; GO:0060628; GO:0060828; GO:0061001; GO:0070062; GO:0070161; GO:0070585; GO:0070971; GO:0070973; GO:0070997; GO:0071287; GO:0071407; GO:0072593; GO:0090140; GO:0090263; GO:0090394; GO:0097487; GO:0098794; GO:0098978; GO:0099400; GO:0099523; GO:0106310; GO:0140058; GO:1900244; GO:1901214; GO:1901215; GO:1901727; GO:1902236; GO:1902499; GO:1902692; GO:1902803; GO:1902823; GO:1902902; GO:1903125; GO:1903206; GO:1903215; GO:1903217; GO:1903351; GO:1903980; GO:1904713; GO:1904887; GO:1905279; GO:1905289; GO:1990904; GO:1990909; GO:2000172; GO:2000300	AAYEGEEVAVKIFNK	1.0016	15.4649	15.4949	15.5099	14.5051	14.1186	14.2861	14.4479	15.3001	15.1901	15.3585	15.3671	14.6221	15.5104	15.4849	16.0357
Q08379	GOGA2_HUMAN	Golgin subfamily A member 2 (130 kDa cis-Golgi matrix protein) (GM130) (GM130 autoantigen) (Golgin-95)	GOLGA2	Homo sapiens (Human)	asymmetric cell division [GO:0008356]; centrosome cycle [GO:0007098]; endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; Golgi disassembly [GO:0090166]; Golgi organization [GO:0007030]; Golgi ribbon formation [GO:0090161]; meiotic spindle assembly [GO:0090306]; microtubule nucleation [GO:0007020]; mitotic spindle assembly [GO:0090307]; negative regulation of autophagy [GO:0010507]; negative regulation of protein binding [GO:0032091]; positive regulation of protein glycosylation [GO:0060050]; protein glycosylation [GO:0006486]; protein homotetramerization [GO:0051289]; protein transport [GO:0015031]; spindle assembly [GO:0051225]	cis-Golgi network [GO:0005801]; COPII-coated ER to Golgi transport vesicle [GO:0030134]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; Golgi apparatus [GO:0005794]; Golgi cis cisterna [GO:0000137]; Golgi cisterna membrane [GO:0032580]; Golgi membrane [GO:0000139]; microtubule [GO:0005874]; mitotic spindle [GO:0072686]; spindle pole [GO:0000922]	cis-Golgi network [GO:0005801]; COPII-coated ER to Golgi transport vesicle [GO:0030134]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; Golgi apparatus [GO:0005794]; Golgi cis cisterna [GO:0000137]; Golgi cisterna membrane [GO:0032580]; Golgi membrane [GO:0000139]; microtubule [GO:0005874]; mitotic spindle [GO:0072686]; spindle pole [GO:0000922]; cadherin binding [GO:0045296]; identical protein binding [GO:0042802]; importin-alpha family protein binding [GO:0061676]; microtubule binding [GO:0008017]; protein kinase binding [GO:0019901]; syntaxin binding [GO:0019905]; asymmetric cell division [GO:0008356]; centrosome cycle [GO:0007098]; endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; Golgi disassembly [GO:0090166]; Golgi organization [GO:0007030]; Golgi ribbon formation [GO:0090161]; meiotic spindle assembly [GO:0090306]; microtubule nucleation [GO:0007020]; mitotic spindle assembly [GO:0090307]; negative regulation of autophagy [GO:0010507]; negative regulation of protein binding [GO:0032091]; positive regulation of protein glycosylation [GO:0060050]; protein glycosylation [GO:0006486]; protein homotetramerization [GO:0051289]; protein transport [GO:0015031]; spindle assembly [GO:0051225]	cadherin binding [GO:0045296]; identical protein binding [GO:0042802]; importin-alpha family protein binding [GO:0061676]; microtubule binding [GO:0008017]; protein kinase binding [GO:0019901]; syntaxin binding [GO:0019905]	GO:0000137; GO:0000139; GO:0000922; GO:0005794; GO:0005801; GO:0005874; GO:0006486; GO:0006888; GO:0007020; GO:0007030; GO:0007098; GO:0008017; GO:0008356; GO:0010507; GO:0015031; GO:0019901; GO:0019905; GO:0030134; GO:0032091; GO:0032580; GO:0033116; GO:0042802; GO:0045296; GO:0051225; GO:0051289; GO:0060050; GO:0061676; GO:0072686; GO:0090161; GO:0090166; GO:0090306; GO:0090307	AAELWGEQAEAR	1.0031	14.8472	15.6319	14.8338	14.6555	14.2085	13.438	15.8213	15.0774	15.6707	14.978	15.3868	15.5216	15.3073	15.5206	15.3146
Q12959	DLG1_HUMAN	Disks large homolog 1 (Synapse-associated protein 97) (SAP-97) (SAP97) (hDlg)	DLG1	Homo sapiens (Human)	actin filament organization [GO:0007015]; actin filament polymerization [GO:0030041]; activation of protein kinase activity [GO:0032147]; amyloid precursor protein metabolic process [GO:0042982]; astral microtubule organization [GO:0030953]; bicellular tight junction assembly [GO:0070830]; branching involved in ureteric bud morphogenesis [GO:0001658]; cell-cell adhesion [GO:0098609]; chemical synaptic transmission [GO:0007268]; cortical actin cytoskeleton organization [GO:0030866]; cortical microtubule organization [GO:0043622]; embryonic skeletal system morphogenesis [GO:0048704]; endothelial cell proliferation [GO:0001935]; establishment of centrosome localization [GO:0051660]; establishment or maintenance of cell polarity [GO:0007163]; establishment or maintenance of epithelial cell apical/basal polarity [GO:0045197]; hard palate development [GO:0060022]; immunological synapse formation [GO:0001771]; lens development in camera-type eye [GO:0002088]; membrane raft organization [GO:0031579]; negative regulation of epithelial cell proliferation [GO:0050680]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; negative regulation of G1/S transition of mitotic cell cycle [GO:2000134]; negative regulation of p38MAPK cascade [GO:1903753]; negative regulation of protein kinase B signaling [GO:0051898]; negative regulation of T cell proliferation [GO:0042130]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neurotransmitter receptor localization to postsynaptic specialization membrane [GO:0099645]; peristalsis [GO:0030432]; positive regulation of actin filament polymerization [GO:0030838]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of potassium ion transport [GO:0043268]; positive regulation of protein localization to plasma membrane [GO:1903078]; protein kinase B signaling [GO:0043491]; protein localization to plasma membrane [GO:0072659]; protein-containing complex localization [GO:0031503]; receptor clustering [GO:0043113]; receptor localization to synapse [GO:0097120]; regulation of cell shape [GO:0008360]; regulation of membrane potential [GO:0042391]; regulation of myelination [GO:0031641]; regulation of potassium ion export across plasma membrane [GO:1903764]; regulation of potassium ion import [GO:1903286]; regulation of protein localization to synapse [GO:1902473]; regulation of sodium ion transmembrane transport [GO:1902305]; regulation of ventricular cardiac muscle cell action potential [GO:0098911]; regulation of voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization [GO:1903760]; reproductive structure development [GO:0048608]; smooth muscle tissue development [GO:0048745]; T cell proliferation [GO:0042098]	adherens junction [GO:0005912]; apical plasma membrane [GO:0016324]; basement membrane [GO:0005604]; basolateral plasma membrane [GO:0016323]; bicellular tight junction [GO:0005923]; cell junction [GO:0030054]; cell projection membrane [GO:0031253]; cell-cell junction [GO:0005911]; cytoplasm [GO:0005737]; cytoplasmic side of plasma membrane [GO:0009898]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; extracellular exosome [GO:0070062]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; immunological synapse [GO:0001772]; intercalated disc [GO:0014704]; lateral loop [GO:0043219]; lateral plasma membrane [GO:0016328]; membrane raft [GO:0045121]; microtubule [GO:0005874]; MPP7-DLG1-LIN7 complex [GO:0097025]; myelin sheath abaxonal region [GO:0035748]; neuromuscular junction [GO:0031594]; neuron projection [GO:0043005]; node of Ranvier [GO:0033268]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; postsynaptic density membrane [GO:0098839]; sarcolemma [GO:0042383]; synaptic membrane [GO:0097060]	adherens junction [GO:0005912]; apical plasma membrane [GO:0016324]; basement membrane [GO:0005604]; basolateral plasma membrane [GO:0016323]; bicellular tight junction [GO:0005923]; cell junction [GO:0030054]; cell projection membrane [GO:0031253]; cell-cell junction [GO:0005911]; cytoplasm [GO:0005737]; cytoplasmic side of plasma membrane [GO:0009898]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; extracellular exosome [GO:0070062]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; immunological synapse [GO:0001772]; intercalated disc [GO:0014704]; lateral loop [GO:0043219]; lateral plasma membrane [GO:0016328]; membrane raft [GO:0045121]; microtubule [GO:0005874]; MPP7-DLG1-LIN7 complex [GO:0097025]; myelin sheath abaxonal region [GO:0035748]; neuromuscular junction [GO:0031594]; neuron projection [GO:0043005]; node of Ranvier [GO:0033268]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; postsynaptic density membrane [GO:0098839]; sarcolemma [GO:0042383]; synaptic membrane [GO:0097060]; cadherin binding [GO:0045296]; cytoskeletal protein binding [GO:0008092]; guanylate kinase activity [GO:0004385]; L27 domain binding [GO:0097016]; mitogen-activated protein kinase kinase binding [GO:0031434]; molecular adaptor activity [GO:0060090]; phosphatase binding [GO:0019902]; phosphoprotein phosphatase activity [GO:0004721]; potassium channel regulator activity [GO:0015459]; protein C-terminus binding [GO:0008022]; protein kinase binding [GO:0019901]; structural constituent of postsynaptic density [GO:0098919]; transmembrane transporter binding [GO:0044325]; actin filament organization [GO:0007015]; actin filament polymerization [GO:0030041]; activation of protein kinase activity [GO:0032147]; amyloid precursor protein metabolic process [GO:0042982]; astral microtubule organization [GO:0030953]; bicellular tight junction assembly [GO:0070830]; branching involved in ureteric bud morphogenesis [GO:0001658]; cell-cell adhesion [GO:0098609]; chemical synaptic transmission [GO:0007268]; cortical actin cytoskeleton organization [GO:0030866]; cortical microtubule organization [GO:0043622]; embryonic skeletal system morphogenesis [GO:0048704]; endothelial cell proliferation [GO:0001935]; establishment of centrosome localization [GO:0051660]; establishment or maintenance of cell polarity [GO:0007163]; establishment or maintenance of epithelial cell apical/basal polarity [GO:0045197]; hard palate development [GO:0060022]; immunological synapse formation [GO:0001771]; lens development in camera-type eye [GO:0002088]; membrane raft organization [GO:0031579]; negative regulation of epithelial cell proliferation [GO:0050680]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; negative regulation of G1/S transition of mitotic cell cycle [GO:2000134]; negative regulation of p38MAPK cascade [GO:1903753]; negative regulation of protein kinase B signaling [GO:0051898]; negative regulation of T cell proliferation [GO:0042130]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neurotransmitter receptor localization to postsynaptic specialization membrane [GO:0099645]; peristalsis [GO:0030432]; positive regulation of actin filament polymerization [GO:0030838]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of potassium ion transport [GO:0043268]; positive regulation of protein localization to plasma membrane [GO:1903078]; protein kinase B signaling [GO:0043491]; protein localization to plasma membrane [GO:0072659]; protein-containing complex localization [GO:0031503]; receptor clustering [GO:0043113]; receptor localization to synapse [GO:0097120]; regulation of cell shape [GO:0008360]; regulation of membrane potential [GO:0042391]; regulation of myelination [GO:0031641]; regulation of potassium ion export across plasma membrane [GO:1903764]; regulation of potassium ion import [GO:1903286]; regulation of protein localization to synapse [GO:1902473]; regulation of sodium ion transmembrane transport [GO:1902305]; regulation of ventricular cardiac muscle cell action potential [GO:0098911]; regulation of voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization [GO:1903760]; reproductive structure development [GO:0048608]; smooth muscle tissue development [GO:0048745]; T cell proliferation [GO:0042098]	cadherin binding [GO:0045296]; cytoskeletal protein binding [GO:0008092]; guanylate kinase activity [GO:0004385]; L27 domain binding [GO:0097016]; mitogen-activated protein kinase kinase binding [GO:0031434]; molecular adaptor activity [GO:0060090]; phosphatase binding [GO:0019902]; phosphoprotein phosphatase activity [GO:0004721]; potassium channel regulator activity [GO:0015459]; protein C-terminus binding [GO:0008022]; protein kinase binding [GO:0019901]; structural constituent of postsynaptic density [GO:0098919]; transmembrane transporter binding [GO:0044325]	GO:0000122; GO:0001658; GO:0001771; GO:0001772; GO:0001935; GO:0002088; GO:0004385; GO:0004721; GO:0005604; GO:0005634; GO:0005737; GO:0005783; GO:0005789; GO:0005794; GO:0005829; GO:0005874; GO:0005886; GO:0005911; GO:0005912; GO:0005923; GO:0007015; GO:0007163; GO:0007268; GO:0008022; GO:0008092; GO:0008284; GO:0008360; GO:0009898; GO:0014704; GO:0015459; GO:0016323; GO:0016324; GO:0016328; GO:0019901; GO:0019902; GO:0030041; GO:0030054; GO:0030432; GO:0030838; GO:0030866; GO:0030953; GO:0031253; GO:0031434; GO:0031503; GO:0031579; GO:0031594; GO:0031641; GO:0032147; GO:0033268; GO:0035748; GO:0042098; GO:0042130; GO:0042383; GO:0042391; GO:0042982; GO:0043005; GO:0043113; GO:0043219; GO:0043268; GO:0043491; GO:0043622; GO:0044325; GO:0045121; GO:0045197; GO:0045296; GO:0048471; GO:0048608; GO:0048704; GO:0048745; GO:0050680; GO:0051660; GO:0051898; GO:0060022; GO:0060090; GO:0070062; GO:0070373; GO:0070830; GO:0072659; GO:0097016; GO:0097025; GO:0097060; GO:0097120; GO:0098609; GO:0098839; GO:0098911; GO:0098919; GO:0098978; GO:0099645; GO:1902305; GO:1902473; GO:1903078; GO:1903286; GO:1903753; GO:1903760; GO:1903764; GO:2000134	AASHEQAAAALK	1.0136	15.8805	16.3424	15.7911	15.1653	15.384	15.4097	15.6181	12.8856	15.9673	15.8559	12.9971	16.121	15.9384	16.0771	10.1273
Q9BZC7	ABCA2_HUMAN	ATP-binding cassette sub-family A member 2 (EC 7.6.2.-) (ATP-binding cassette transporter 2) (ATP-binding cassette 2)	ABCA2 ABC2 KIAA1062	Homo sapiens (Human)	cellular sphingolipid homeostasis [GO:0090156]; central nervous system myelin formation [GO:0032289]; ceramide translocation [GO:0099040]; cholesterol homeostasis [GO:0042632]; ganglioside metabolic process [GO:0001573]; glycosphingolipid metabolic process [GO:0006687]; lipid metabolic process [GO:0006629]; lipid transport [GO:0006869]; locomotory behavior [GO:0007626]; negative regulation of cholesterol efflux [GO:0090370]; negative regulation of intracellular cholesterol transport [GO:0032384]; negative regulation of low-density lipoprotein receptor activity [GO:1905598]; negative regulation of phospholipid biosynthetic process [GO:0071072]; negative regulation of receptor-mediated endocytosis involved in cholesterol transport [GO:1905601]; negative regulation of sphingolipid biosynthetic process [GO:0090155]; negative regulation of steroid metabolic process [GO:0045939]; positive regulation of amyloid precursor protein biosynthetic process [GO:0042986]; positive regulation of amyloid precursor protein catabolic process [GO:1902993]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of low-density lipoprotein particle receptor catabolic process [GO:0032805]; regulation of cholesterol esterification [GO:0010872]; regulation of intracellular cholesterol transport [GO:0032383]; regulation of post-translational protein modification [GO:1901873]; regulation of protein glycosylation [GO:0060049]; regulation of protein localization to cell periphery [GO:1904375]; regulation of protein localization to cell surface [GO:2000008]; regulation of steroid metabolic process [GO:0019218]; regulation of transcription by RNA polymerase II [GO:0006357]; response to cholesterol [GO:0070723]; response to steroid hormone [GO:0048545]; response to xenobiotic stimulus [GO:0009410]; sphingomyelin metabolic process [GO:0006684]; sphingosine biosynthetic process [GO:0046512]; transmembrane transport [GO:0055085]; transport across blood-brain barrier [GO:0150104]	ATP-binding cassette (ABC) transporter complex [GO:0043190]; cytoplasmic vesicle [GO:0031410]; endosome [GO:0005768]; endosome membrane [GO:0010008]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; membrane [GO:0016020]; microtubule organizing center [GO:0005815]; plasma membrane [GO:0005886]	ATP-binding cassette (ABC) transporter complex [GO:0043190]; cytoplasmic vesicle [GO:0031410]; endosome [GO:0005768]; endosome membrane [GO:0010008]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; membrane [GO:0016020]; microtubule organizing center [GO:0005815]; plasma membrane [GO:0005886]; ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ceramide floppase activity [GO:0099038]; endopeptidase regulator activity [GO:0061135]; lipid transporter activity [GO:0005319]; nucleotide binding [GO:0000166]; cellular sphingolipid homeostasis [GO:0090156]; central nervous system myelin formation [GO:0032289]; ceramide translocation [GO:0099040]; cholesterol homeostasis [GO:0042632]; ganglioside metabolic process [GO:0001573]; glycosphingolipid metabolic process [GO:0006687]; lipid metabolic process [GO:0006629]; lipid transport [GO:0006869]; locomotory behavior [GO:0007626]; negative regulation of cholesterol efflux [GO:0090370]; negative regulation of intracellular cholesterol transport [GO:0032384]; negative regulation of low-density lipoprotein receptor activity [GO:1905598]; negative regulation of phospholipid biosynthetic process [GO:0071072]; negative regulation of receptor-mediated endocytosis involved in cholesterol transport [GO:1905601]; negative regulation of sphingolipid biosynthetic process [GO:0090155]; negative regulation of steroid metabolic process [GO:0045939]; positive regulation of amyloid precursor protein biosynthetic process [GO:0042986]; positive regulation of amyloid precursor protein catabolic process [GO:1902993]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of low-density lipoprotein particle receptor catabolic process [GO:0032805]; regulation of cholesterol esterification [GO:0010872]; regulation of intracellular cholesterol transport [GO:0032383]; regulation of post-translational protein modification [GO:1901873]; regulation of protein glycosylation [GO:0060049]; regulation of protein localization to cell periphery [GO:1904375]; regulation of protein localization to cell surface [GO:2000008]; regulation of steroid metabolic process [GO:0019218]; regulation of transcription by RNA polymerase II [GO:0006357]; response to cholesterol [GO:0070723]; response to steroid hormone [GO:0048545]; response to xenobiotic stimulus [GO:0009410]; sphingomyelin metabolic process [GO:0006684]; sphingosine biosynthetic process [GO:0046512]; transmembrane transport [GO:0055085]; transport across blood-brain barrier [GO:0150104]	ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ceramide floppase activity [GO:0099038]; endopeptidase regulator activity [GO:0061135]; lipid transporter activity [GO:0005319]; nucleotide binding [GO:0000166]	GO:0000166; GO:0001573; GO:0005319; GO:0005524; GO:0005764; GO:0005765; GO:0005768; GO:0005815; GO:0005886; GO:0006357; GO:0006629; GO:0006684; GO:0006687; GO:0006869; GO:0007626; GO:0009410; GO:0010008; GO:0010872; GO:0016020; GO:0016021; GO:0019218; GO:0031410; GO:0032289; GO:0032383; GO:0032384; GO:0032805; GO:0042626; GO:0042632; GO:0042986; GO:0043190; GO:0043231; GO:0045939; GO:0046512; GO:0048545; GO:0055085; GO:0060049; GO:0061135; GO:0070723; GO:0071072; GO:0090155; GO:0090156; GO:0090370; GO:0099038; GO:0099040; GO:0140359; GO:0150104; GO:1901873; GO:1902004; GO:1902993; GO:1904375; GO:1905598; GO:1905601; GO:2000008	AAQVFYNNK	1.0089	15.162	14.6579	14.6942	14.8709	14.9134	15.2024	14.8662	15.2943	14.8792	15.7799	15.1402	14.8942	15.7431	14.3158	14.6222
Q9UHC1	MLH3_HUMAN	DNA mismatch repair protein Mlh3 (MutL protein homolog 3)	MLH3	Homo sapiens (Human)	female meiosis I [GO:0007144]; male meiotic nuclear division [GO:0007140]; mismatch repair [GO:0006298]; protein localization [GO:0008104]; reciprocal meiotic recombination [GO:0007131]; synaptonemal complex assembly [GO:0007130]	chiasma [GO:0005712]; male germ cell nucleus [GO:0001673]; mismatch repair complex [GO:0032300]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; synaptonemal complex [GO:0000795]	chiasma [GO:0005712]; male germ cell nucleus [GO:0001673]; mismatch repair complex [GO:0032300]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; synaptonemal complex [GO:0000795]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent DNA damage sensor activity [GO:0140664]; centromeric DNA binding [GO:0019237]; chromatin binding [GO:0003682]; mismatched DNA binding [GO:0030983]; satellite DNA binding [GO:0003696]; female meiosis I [GO:0007144]; male meiotic nuclear division [GO:0007140]; mismatch repair [GO:0006298]; protein localization [GO:0008104]; reciprocal meiotic recombination [GO:0007131]; synaptonemal complex assembly [GO:0007130]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent DNA damage sensor activity [GO:0140664]; centromeric DNA binding [GO:0019237]; chromatin binding [GO:0003682]; mismatched DNA binding [GO:0030983]; satellite DNA binding [GO:0003696]	GO:0000795; GO:0001673; GO:0003682; GO:0003696; GO:0005524; GO:0005634; GO:0005654; GO:0005712; GO:0006298; GO:0007130; GO:0007131; GO:0007140; GO:0007144; GO:0008104; GO:0016887; GO:0019237; GO:0030983; GO:0032300; GO:0140664	ACEADVTR	1.0065	15.5279	15.6075	15.4769	14.0636	14.5227	14.0768	15.824	15.641	14.2999	16.1924	16.341	15.456	13.457	14.2177	13.6457
P49758	RGS6_HUMAN	Regulator of G-protein signaling 6 (RGS6) (S914)	RGS6	Homo sapiens (Human)	G protein-coupled receptor signaling pathway [GO:0007186]; intracellular signal transduction [GO:0035556]; negative regulation of signal transduction [GO:0009968]; positive regulation of GTPase activity [GO:0043547]; regulation of G protein-coupled receptor signaling pathway [GO:0008277]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extrinsic component of membrane [GO:0019898]; neuron projection [GO:0043005]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extrinsic component of membrane [GO:0019898]; neuron projection [GO:0043005]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; GTPase activator activity [GO:0005096]; GTPase activity [GO:0003924]; G protein-coupled receptor signaling pathway [GO:0007186]; intracellular signal transduction [GO:0035556]; negative regulation of signal transduction [GO:0009968]; positive regulation of GTPase activity [GO:0043547]; regulation of G protein-coupled receptor signaling pathway [GO:0008277]	GTPase activator activity [GO:0005096]; GTPase activity [GO:0003924]	GO:0003924; GO:0005096; GO:0005634; GO:0005737; GO:0005829; GO:0005886; GO:0007186; GO:0008277; GO:0009968; GO:0019898; GO:0035556; GO:0043005; GO:0043547	AFWDVHRPVPGCVNTTEMDIR	1.0107	14.3735	15.3488	15.0545	13.5728	13.8969	13.7692	15.2743	15.1346	16.1554	15.6037	15.3586	15.1678	15.3938	13.6131	15.169
Q13127	REST_HUMAN	RE1-silencing transcription factor (Neural-restrictive silencer factor) (X2 box repressor)	REST NRSF XBR	Homo sapiens (Human)	"auditory receptor cell stereocilium organization [GO:0060088]; cardiac muscle cell myoblast differentiation [GO:0060379]; cellular response to electrical stimulus [GO:0071257]; cellular response to glucocorticoid stimulus [GO:0071385]; cellular response to xenobiotic stimulus [GO:0071466]; detection of mechanical stimulus involved in sensory perception of sound [GO:0050910]; hematopoietic progenitor cell differentiation [GO:0002244]; histone H4 deacetylation [GO:0070933]; modification of synaptic structure [GO:0099563]; negative regulation by host of viral transcription [GO:0043922]; negative regulation of aldosterone biosynthetic process [GO:0032348]; negative regulation of amniotic stem cell differentiation [GO:2000798]; negative regulation of calcium ion-dependent exocytosis [GO:0045955]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cortisol biosynthetic process [GO:2000065]; negative regulation of dense core granule biogenesis [GO:2000706]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of gene expression [GO:0010629]; negative regulation of insulin secretion [GO:0046676]; negative regulation of mesenchymal stem cell differentiation [GO:2000740]; negative regulation of miRNA transcription [GO:1902894]; negative regulation of neurogenesis [GO:0050768]; negative regulation of neuron differentiation [GO:0045665]; negative regulation of oxidative stress-induced neuron death [GO:1903204]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transcription regulatory region DNA binding [GO:2000678]; neuromuscular process controlling balance [GO:0050885]; neuronal stem cell population maintenance [GO:0097150]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of gene expression [GO:0010628]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of oxidative stress-induced neuron death [GO:1903223]; positive regulation of stem cell population maintenance [GO:1902459]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]; regulation of DNA-templated transcription [GO:0006355]; regulation of gene expression [GO:0010468]; regulation of osteoblast differentiation [GO:0045667]; regulation of oxidative stress-induced neuron death [GO:1903203]; response to hypoxia [GO:0001666]; response to ischemia [GO:0002931]; somatic stem cell population maintenance [GO:0035019]"	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription repressor complex [GO:0017053]	"cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription repressor complex [GO:0017053]; chromatin binding [GO:0003682]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II core promoter sequence-specific DNA binding [GO:0000979]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; transcription cis-regulatory region binding [GO:0000976]; auditory receptor cell stereocilium organization [GO:0060088]; cardiac muscle cell myoblast differentiation [GO:0060379]; cellular response to electrical stimulus [GO:0071257]; cellular response to glucocorticoid stimulus [GO:0071385]; cellular response to xenobiotic stimulus [GO:0071466]; detection of mechanical stimulus involved in sensory perception of sound [GO:0050910]; hematopoietic progenitor cell differentiation [GO:0002244]; histone H4 deacetylation [GO:0070933]; modification of synaptic structure [GO:0099563]; negative regulation by host of viral transcription [GO:0043922]; negative regulation of aldosterone biosynthetic process [GO:0032348]; negative regulation of amniotic stem cell differentiation [GO:2000798]; negative regulation of calcium ion-dependent exocytosis [GO:0045955]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cortisol biosynthetic process [GO:2000065]; negative regulation of dense core granule biogenesis [GO:2000706]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of gene expression [GO:0010629]; negative regulation of insulin secretion [GO:0046676]; negative regulation of mesenchymal stem cell differentiation [GO:2000740]; negative regulation of miRNA transcription [GO:1902894]; negative regulation of neurogenesis [GO:0050768]; negative regulation of neuron differentiation [GO:0045665]; negative regulation of oxidative stress-induced neuron death [GO:1903204]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transcription regulatory region DNA binding [GO:2000678]; neuromuscular process controlling balance [GO:0050885]; neuronal stem cell population maintenance [GO:0097150]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of gene expression [GO:0010628]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of oxidative stress-induced neuron death [GO:1903223]; positive regulation of stem cell population maintenance [GO:1902459]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]; regulation of DNA-templated transcription [GO:0006355]; regulation of gene expression [GO:0010468]; regulation of osteoblast differentiation [GO:0045667]; regulation of oxidative stress-induced neuron death [GO:1903203]; response to hypoxia [GO:0001666]; response to ischemia [GO:0002931]; somatic stem cell population maintenance [GO:0035019]"	"chromatin binding [GO:0003682]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II core promoter sequence-specific DNA binding [GO:0000979]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; transcription cis-regulatory region binding [GO:0000976]"	GO:0000122; GO:0000381; GO:0000976; GO:0000978; GO:0000979; GO:0001227; GO:0001666; GO:0002244; GO:0002931; GO:0003682; GO:0003700; GO:0005634; GO:0005654; GO:0005737; GO:0005829; GO:0006355; GO:0008285; GO:0010468; GO:0010628; GO:0010629; GO:0017053; GO:0032348; GO:0035019; GO:0042802; GO:0043065; GO:0043280; GO:0043922; GO:0045665; GO:0045666; GO:0045667; GO:0045892; GO:0045893; GO:0045944; GO:0045955; GO:0046676; GO:0046872; GO:0050768; GO:0050885; GO:0050910; GO:0060088; GO:0060379; GO:0061629; GO:0070933; GO:0071257; GO:0071385; GO:0071466; GO:0097150; GO:0099563; GO:1902459; GO:1902894; GO:1903203; GO:1903204; GO:1903223; GO:2000065; GO:2000678; GO:2000706; GO:2000740; GO:2000798	AAKGDFVCIFCDRSFR	1.0031	15.2918	13.8424	14.8228	14.6458	14.2379	13.6261	14.8685	15.1376	14.7365	15.3564	15.2062	14.5957	15.975	15.0444	14.6747
O75369	FLNB_HUMAN	Filamin-B (FLN-B) (ABP-278) (ABP-280 homolog) (Actin-binding-like protein) (Beta-filamin) (Filamin homolog 1) (Fh1) (Filamin-3) (Thyroid autoantigen) (Truncated actin-binding protein) (Truncated ABP)	FLNB FLN1L FLN3 TABP TAP	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; cellular response to interferon-gamma [GO:0071346]; epithelial cell morphogenesis [GO:0003382]; keratinocyte development [GO:0003334]; signal transduction [GO:0007165]; skeletal muscle tissue development [GO:0007519]	actin cytoskeleton [GO:0015629]; brush border [GO:0005903]; cell cortex [GO:0005938]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; integral component of membrane [GO:0016021]; phagocytic vesicle [GO:0045335]; plasma membrane [GO:0005886]; stress fiber [GO:0001725]; Z disc [GO:0030018]	actin cytoskeleton [GO:0015629]; brush border [GO:0005903]; cell cortex [GO:0005938]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; integral component of membrane [GO:0016021]; phagocytic vesicle [GO:0045335]; plasma membrane [GO:0005886]; stress fiber [GO:0001725]; Z disc [GO:0030018]; actin binding [GO:0003779]; actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; identical protein binding [GO:0042802]; RNA binding [GO:0003723]; actin cytoskeleton organization [GO:0030036]; cellular response to interferon-gamma [GO:0071346]; epithelial cell morphogenesis [GO:0003382]; keratinocyte development [GO:0003334]; signal transduction [GO:0007165]; skeletal muscle tissue development [GO:0007519]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; identical protein binding [GO:0042802]; RNA binding [GO:0003723]	GO:0001725; GO:0003334; GO:0003382; GO:0003723; GO:0003779; GO:0005737; GO:0005829; GO:0005886; GO:0005903; GO:0005925; GO:0005938; GO:0007165; GO:0007519; GO:0015629; GO:0016021; GO:0030018; GO:0030036; GO:0042802; GO:0045296; GO:0045335; GO:0051015; GO:0070062; GO:0071346	AAGSGELGVTMK	1	15.1036	14.8132	14.5187	13.9368	13.5573	13.786	14.7892	15.0111	14.6203	15.7705	15.4346	15.5058	14.6741	15.8665	14.4633
P25021	HRH2_HUMAN	Histamine H2 receptor (H2R) (HH2R) (Gastric receptor I)	HRH2	Homo sapiens (Human)	"chemical synaptic transmission [GO:0007268]; G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger [GO:0007187]; gastric acid secretion [GO:0001696]; immune response [GO:0006955]; positive regulation of vasoconstriction [GO:0045907]"	dendrite [GO:0030425]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; synapse [GO:0045202]	"dendrite [GO:0030425]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; synapse [GO:0045202]; G protein-coupled serotonin receptor activity [GO:0004993]; histamine receptor activity [GO:0004969]; neurotransmitter receptor activity [GO:0030594]; chemical synaptic transmission [GO:0007268]; G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger [GO:0007187]; gastric acid secretion [GO:0001696]; immune response [GO:0006955]; positive regulation of vasoconstriction [GO:0045907]"	G protein-coupled serotonin receptor activity [GO:0004993]; histamine receptor activity [GO:0004969]; neurotransmitter receptor activity [GO:0030594]	GO:0001696; GO:0004969; GO:0004993; GO:0005886; GO:0005887; GO:0006955; GO:0007187; GO:0007268; GO:0030425; GO:0030594; GO:0045202; GO:0045907	AATIREHK	1.0165	14.6117	14.9534	14.6435	12.3011	12.3294	12.4937	15.1128	15.8486	15.4377	16	15.9444	15.7962	14.9792	15.1774	15.3182
P19525	E2AK2_HUMAN	"Interferon-induced, double-stranded RNA-activated protein kinase (EC 2.7.11.1) (Eukaryotic translation initiation factor 2-alpha kinase 2) (eIF-2A protein kinase 2) (Interferon-inducible RNA-dependent protein kinase) (P1/eIF-2A protein kinase) (Protein kinase RNA-activated) (PKR) (Protein kinase R) (Tyrosine-protein kinase EIF2AK2) (EC 2.7.10.2) (p68 kinase)"	EIF2AK2 PKR PRKR	Homo sapiens (Human)	cellular response to amino acid starvation [GO:0034198]; defense response to virus [GO:0051607]; endoplasmic reticulum unfolded protein response [GO:0030968]; innate immune response [GO:0045087]; negative regulation of apoptotic process [GO:0043066]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of osteoblast proliferation [GO:0033689]; negative regulation of translation [GO:0017148]; negative regulation of viral genome replication [GO:0045071]; positive regulation of chemokine production [GO:0032722]; positive regulation of cytokine production [GO:0001819]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of stress-activated MAPK cascade [GO:0032874]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of hematopoietic progenitor cell differentiation [GO:1901532]; regulation of hematopoietic stem cell differentiation [GO:1902036]; regulation of hematopoietic stem cell proliferation [GO:1902033]; regulation of NLRP3 inflammasome complex assembly [GO:1900225]; response to interferon-alpha [GO:0035455]; response to virus [GO:0009615]; translation [GO:0006412]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; ribosome [GO:0005840]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; ribosome [GO:0005840]; ATP binding [GO:0005524]; double-stranded RNA binding [GO:0003725]; eukaryotic translation initiation factor 2alpha kinase activity [GO:0004694]; identical protein binding [GO:0042802]; non-membrane spanning protein tyrosine kinase activity [GO:0004715]; protein kinase activity [GO:0004672]; protein phosphatase regulator activity [GO:0019888]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; RNA binding [GO:0003723]; cellular response to amino acid starvation [GO:0034198]; defense response to virus [GO:0051607]; endoplasmic reticulum unfolded protein response [GO:0030968]; innate immune response [GO:0045087]; negative regulation of apoptotic process [GO:0043066]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of osteoblast proliferation [GO:0033689]; negative regulation of translation [GO:0017148]; negative regulation of viral genome replication [GO:0045071]; positive regulation of chemokine production [GO:0032722]; positive regulation of cytokine production [GO:0001819]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of stress-activated MAPK cascade [GO:0032874]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of hematopoietic progenitor cell differentiation [GO:1901532]; regulation of hematopoietic stem cell differentiation [GO:1902036]; regulation of hematopoietic stem cell proliferation [GO:1902033]; regulation of NLRP3 inflammasome complex assembly [GO:1900225]; response to interferon-alpha [GO:0035455]; response to virus [GO:0009615]; translation [GO:0006412]	ATP binding [GO:0005524]; double-stranded RNA binding [GO:0003725]; eukaryotic translation initiation factor 2alpha kinase activity [GO:0004694]; identical protein binding [GO:0042802]; non-membrane spanning protein tyrosine kinase activity [GO:0004715]; protein kinase activity [GO:0004672]; protein phosphatase regulator activity [GO:0019888]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; RNA binding [GO:0003723]	GO:0001819; GO:0003723; GO:0003725; GO:0004672; GO:0004674; GO:0004694; GO:0004715; GO:0005524; GO:0005634; GO:0005737; GO:0005829; GO:0005840; GO:0006412; GO:0006468; GO:0008285; GO:0009615; GO:0016020; GO:0017148; GO:0019888; GO:0030968; GO:0032722; GO:0032874; GO:0033689; GO:0034198; GO:0035455; GO:0042802; GO:0043066; GO:0043410; GO:0045071; GO:0045087; GO:0046777; GO:0048471; GO:0051092; GO:0051607; GO:0106310; GO:1900225; GO:1901224; GO:1901532; GO:1902033; GO:1902036	AGDLSAGFFMEELNTYR	1.0037	15.2075	14.6402	15.0604	13.0547	13.2593	13.1019	14.1568	14.1689	15.845	14.7996	15.7908	15.2139	14.5998	15.9903	15.1739
A8K0M8	A8K0M8_HUMAN	"cDNA FLJ78057, highly similar to Homo sapiens differential display and activated by p53 (DDA3),mRNA"		Homo sapiens (Human)		cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]		GO:0005737; GO:0005856	AGPSGRAAASPPTPIR	1.0128	14.6432	16.104	14.6554	13.4598	13.1013	15.119	15.3873	13.4295	14.7368	14.3154	14.2548	14.1692	16.1706	14.9783	14.6965
Q96IZ0	PAWR_HUMAN	PRKC apoptosis WT1 regulator protein (Prostate apoptosis response 4 protein) (Par-4)	PAWR PAR4	Homo sapiens (Human)	actin filament bundle assembly [GO:0051017]; apoptotic process [GO:0006915]; apoptotic signaling pathway [GO:0097190]; negative regulation of B cell proliferation [GO:0030889]; negative regulation of fibroblast proliferation [GO:0048147]; negative regulation of gene expression [GO:0010629]; negative regulation of T cell proliferation [GO:0042130]; negative regulation of T cell receptor signaling pathway [GO:0050860]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of amyloid precursor protein biosynthetic process [GO:0042986]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cellular senescence [GO:2000774]; positive regulation of gene expression [GO:0010628]; positive regulation of hydrogen peroxide-mediated programmed cell death [GO:1901300]	actin cytoskeleton [GO:0015629]; chromatin [GO:0000785]; cytoplasm [GO:0005737]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	actin cytoskeleton [GO:0015629]; chromatin [GO:0000785]; cytoplasm [GO:0005737]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; actin binding [GO:0003779]; enzyme binding [GO:0019899]; leucine zipper domain binding [GO:0043522]; transcription corepressor activity [GO:0003714]; actin filament bundle assembly [GO:0051017]; apoptotic process [GO:0006915]; apoptotic signaling pathway [GO:0097190]; negative regulation of B cell proliferation [GO:0030889]; negative regulation of fibroblast proliferation [GO:0048147]; negative regulation of gene expression [GO:0010629]; negative regulation of T cell proliferation [GO:0042130]; negative regulation of T cell receptor signaling pathway [GO:0050860]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of amyloid precursor protein biosynthetic process [GO:0042986]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cellular senescence [GO:2000774]; positive regulation of gene expression [GO:0010628]; positive regulation of hydrogen peroxide-mediated programmed cell death [GO:1901300]	actin binding [GO:0003779]; enzyme binding [GO:0019899]; leucine zipper domain binding [GO:0043522]; transcription corepressor activity [GO:0003714]	GO:0000122; GO:0000785; GO:0003714; GO:0003779; GO:0005634; GO:0005737; GO:0005886; GO:0006915; GO:0010628; GO:0010629; GO:0015629; GO:0019899; GO:0030889; GO:0042130; GO:0042986; GO:0043065; GO:0043522; GO:0048147; GO:0050860; GO:0051017; GO:0097190; GO:1901300; GO:2000774	AAPGPRR	1.0206	11.1279	13.3818	15.6416	14.3421	14.0468	13.8601	14.3775	14.6964	16.4462	14.9438	14.9828	15.0851	15.8376	15.7437	13.345
B4DFM3	B4DFM3_HUMAN	"cDNA FLJ57267, highly similar to Neurogenic locus notch homolog protein 4"		Homo sapiens (Human)						AAGPGWASAGGR	0.91304	14.5964	14.5704	14.499	14.0694	14.0931	13.9466	14.5031	14.3498	14.5689	14.7147	14.6772	14.7404	14.73	14.8055	14.5869
B4DFE9	B4DFE9_HUMAN	"cDNA FLJ59619, highly similar to Epoxide hydrolase 2"		Homo sapiens (Human)			hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	GO:0016787	AAVFDLDGVLALPAVFGVLGR	0.98539	14.6444	14.7015	14.5761	13.5236	13.5378	13.4289	14.6081	14.6508	14.732	15.1965	14.5124	15.277	14.8069	14.3127	14.2609
Q8IY17	PLPL6_HUMAN	Patatin-like phospholipase domain-containing protein 6 (EC 3.1.1.5) (Neuropathy target esterase)	PNPLA6 NTE	Homo sapiens (Human)	glycerophospholipid catabolic process [GO:0046475]; phosphatidylcholine metabolic process [GO:0046470]	cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; membrane [GO:0016020]	cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; lysophospholipase activity [GO:0004622]; phosphatidyl phospholipase B activity [GO:0102545]; glycerophospholipid catabolic process [GO:0046475]; phosphatidylcholine metabolic process [GO:0046470]	lysophospholipase activity [GO:0004622]; phosphatidyl phospholipase B activity [GO:0102545]	GO:0004622; GO:0005783; GO:0005789; GO:0005829; GO:0016020; GO:0016021; GO:0046470; GO:0046475; GO:0102545	AARDSTVLR	1.0062	14.1077	14.9261	14.8864	13.0515	13.1786	13.3959	13.9792	14.4348	14.274	15.3335	15.5678	15.1976	14.6628	14.8216	14.6811
Q5R372	RBG1L_HUMAN	Rab GTPase-activating protein 1-like	RABGAP1L HHL KIAA0471	Homo sapiens (Human)	activation of GTPase activity [GO:0090630]; endocytosis [GO:0006897]; protein transport [GO:0015031]; regulation of protein localization [GO:0032880]	early endosome [GO:0005769]; Golgi apparatus [GO:0005794]; nucleus [GO:0005634]	early endosome [GO:0005769]; Golgi apparatus [GO:0005794]; nucleus [GO:0005634]; GTPase activator activity [GO:0005096]; small GTPase binding [GO:0031267]; activation of GTPase activity [GO:0090630]; endocytosis [GO:0006897]; protein transport [GO:0015031]; regulation of protein localization [GO:0032880]	GTPase activator activity [GO:0005096]; small GTPase binding [GO:0031267]	GO:0005096; GO:0005634; GO:0005769; GO:0005794; GO:0006897; GO:0015031; GO:0031267; GO:0032880; GO:0090630	AEENARR	1.0019	14.6203	13.8595	13.461	11.5652	12.9728	16.545	13.6286	14.2989	13.8154	14.204	13.5375	16.5782	13.5827	16.7719	16.8876
P23219	PGH1_HUMAN	Prostaglandin G/H synthase 1 (EC 1.14.99.1) (Cyclooxygenase-1) (COX-1) (Prostaglandin H2 synthase 1) (PGH synthase 1) (PGHS-1) (PHS 1) (Prostaglandin-endoperoxide synthase 1)	PTGS1 COX1	Homo sapiens (Human)	cyclooxygenase pathway [GO:0019371]; inflammatory response [GO:0006954]; prostaglandin biosynthetic process [GO:0001516]; regulation of blood pressure [GO:0008217]; regulation of cell population proliferation [GO:0042127]; response to oxidative stress [GO:0006979]	cytoplasm [GO:0005737]; endoplasmic reticulum membrane [GO:0005789]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; neuron projection [GO:0043005]; photoreceptor outer segment [GO:0001750]	"cytoplasm [GO:0005737]; endoplasmic reticulum membrane [GO:0005789]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; neuron projection [GO:0043005]; photoreceptor outer segment [GO:0001750]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]; peroxidase activity [GO:0004601]; prostaglandin-endoperoxide synthase activity [GO:0004666]; cyclooxygenase pathway [GO:0019371]; inflammatory response [GO:0006954]; prostaglandin biosynthetic process [GO:0001516]; regulation of blood pressure [GO:0008217]; regulation of cell population proliferation [GO:0042127]; response to oxidative stress [GO:0006979]"	"heme binding [GO:0020037]; metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]; peroxidase activity [GO:0004601]; prostaglandin-endoperoxide synthase activity [GO:0004666]"	GO:0001516; GO:0001750; GO:0004601; GO:0004666; GO:0005737; GO:0005789; GO:0005794; GO:0006954; GO:0006979; GO:0008217; GO:0016702; GO:0019371; GO:0020037; GO:0042127; GO:0043005; GO:0043231; GO:0046872; GO:0070062	AEHPTWGDEQLFQTTR	0.98214	16.4797	16.3022	16.0904	13.1066	12.5328	9.69877	12.9966	15.5756	13.2626	14.2502	13.7792	14.0766	16.1956	14.4995	17.4236
P61026	RAB10_HUMAN	Ras-related protein Rab-10 (EC 3.6.5.2)	RAB10	Homo sapiens (Human)	antigen processing and presentation [GO:0019882]; axonogenesis [GO:0007409]; cellular response to insulin stimulus [GO:0032869]; endoplasmic reticulum tubular network organization [GO:0071786]; endosomal transport [GO:0016197]; establishment of neuroblast polarity [GO:0045200]; establishment of protein localization to endoplasmic reticulum membrane [GO:0097051]; establishment of protein localization to membrane [GO:0090150]; Golgi to plasma membrane protein transport [GO:0043001]; Golgi to plasma membrane transport [GO:0006893]; polarized epithelial cell differentiation [GO:0030859]; protein localization to basolateral plasma membrane [GO:1903361]; protein localization to plasma membrane [GO:0072659]; protein secretion [GO:0009306]; regulated exocytosis [GO:0045055]; regulation of exocytosis [GO:0017157]; vesicle docking involved in exocytosis [GO:0006904]; vesicle-mediated transport [GO:0016192]	adherens junction [GO:0005912]; cilium [GO:0005929]; cytoplasmic vesicle membrane [GO:0030659]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum tubular network [GO:0071782]; endosome [GO:0005768]; exocytic vesicle [GO:0070382]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; insulin-responsive compartment [GO:0032593]; intracellular membrane-bounded organelle [GO:0043231]; perinuclear region of cytoplasm [GO:0048471]; phagocytic vesicle membrane [GO:0030670]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]; recycling endosome membrane [GO:0055038]; secretory granule membrane [GO:0030667]; synaptic vesicle [GO:0008021]; trans-Golgi network [GO:0005802]	adherens junction [GO:0005912]; cilium [GO:0005929]; cytoplasmic vesicle membrane [GO:0030659]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum tubular network [GO:0071782]; endosome [GO:0005768]; exocytic vesicle [GO:0070382]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; insulin-responsive compartment [GO:0032593]; intracellular membrane-bounded organelle [GO:0043231]; perinuclear region of cytoplasm [GO:0048471]; phagocytic vesicle membrane [GO:0030670]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]; recycling endosome membrane [GO:0055038]; secretory granule membrane [GO:0030667]; synaptic vesicle [GO:0008021]; trans-Golgi network [GO:0005802]; cadherin binding involved in cell-cell adhesion [GO:0098641]; G protein activity [GO:0003925]; GDP binding [GO:0019003]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; myosin V binding [GO:0031489]; antigen processing and presentation [GO:0019882]; axonogenesis [GO:0007409]; cellular response to insulin stimulus [GO:0032869]; endoplasmic reticulum tubular network organization [GO:0071786]; endosomal transport [GO:0016197]; establishment of neuroblast polarity [GO:0045200]; establishment of protein localization to endoplasmic reticulum membrane [GO:0097051]; establishment of protein localization to membrane [GO:0090150]; Golgi to plasma membrane protein transport [GO:0043001]; Golgi to plasma membrane transport [GO:0006893]; polarized epithelial cell differentiation [GO:0030859]; protein localization to basolateral plasma membrane [GO:1903361]; protein localization to plasma membrane [GO:0072659]; protein secretion [GO:0009306]; regulated exocytosis [GO:0045055]; regulation of exocytosis [GO:0017157]; vesicle docking involved in exocytosis [GO:0006904]; vesicle-mediated transport [GO:0016192]	cadherin binding involved in cell-cell adhesion [GO:0098641]; G protein activity [GO:0003925]; GDP binding [GO:0019003]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; myosin V binding [GO:0031489]	GO:0000139; GO:0003924; GO:0003925; GO:0005525; GO:0005768; GO:0005789; GO:0005794; GO:0005802; GO:0005829; GO:0005856; GO:0005886; GO:0005912; GO:0005925; GO:0005929; GO:0006893; GO:0006904; GO:0007409; GO:0008021; GO:0009306; GO:0016192; GO:0016197; GO:0017157; GO:0019003; GO:0019882; GO:0030659; GO:0030667; GO:0030670; GO:0030859; GO:0031489; GO:0032593; GO:0032869; GO:0043001; GO:0043231; GO:0045055; GO:0045200; GO:0048471; GO:0055037; GO:0055038; GO:0070062; GO:0070382; GO:0071782; GO:0071786; GO:0072659; GO:0090150; GO:0097051; GO:0098641; GO:1903361	AFLTLAEDILR	1.0022	13.7913	14.2367	10.1231	13.6271	13.7927	13.9135	15.3344	13.9018	14.7546	15.6633	15.6264	15.5066	14.9531	15.3249	15.5695
P07384	CAN1_HUMAN	Calpain-1 catalytic subunit (EC 3.4.22.52) (Calcium-activated neutral proteinase 1) (CANP 1) (Calpain mu-type) (Calpain-1 large subunit) (Cell proliferation-inducing gene 30 protein) (Micromolar-calpain) (muCANP)	CAPN1 CANPL1 PIG30	Homo sapiens (Human)	mammary gland involution [GO:0060056]; positive regulation of cell population proliferation [GO:0008284]; proteolysis [GO:0006508]; receptor catabolic process [GO:0032801]; regulation of catalytic activity [GO:0050790]; regulation of macroautophagy [GO:0016241]; regulation of NMDA receptor activity [GO:2000310]; self proteolysis [GO:0097264]	cornified envelope [GO:0001533]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; ficolin-1-rich granule lumen [GO:1904813]; focal adhesion [GO:0005925]; lysosome [GO:0005764]; membrane [GO:0016020]; mitochondrion [GO:0005739]; plasma membrane [GO:0005886]	cornified envelope [GO:0001533]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; ficolin-1-rich granule lumen [GO:1904813]; focal adhesion [GO:0005925]; lysosome [GO:0005764]; membrane [GO:0016020]; mitochondrion [GO:0005739]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; calcium-dependent cysteine-type endopeptidase activity [GO:0004198]; peptidase activity [GO:0008233]; mammary gland involution [GO:0060056]; positive regulation of cell population proliferation [GO:0008284]; proteolysis [GO:0006508]; receptor catabolic process [GO:0032801]; regulation of catalytic activity [GO:0050790]; regulation of macroautophagy [GO:0016241]; regulation of NMDA receptor activity [GO:2000310]; self proteolysis [GO:0097264]	calcium ion binding [GO:0005509]; calcium-dependent cysteine-type endopeptidase activity [GO:0004198]; peptidase activity [GO:0008233]	GO:0001533; GO:0004198; GO:0005509; GO:0005576; GO:0005737; GO:0005739; GO:0005764; GO:0005829; GO:0005886; GO:0005925; GO:0006508; GO:0008233; GO:0008284; GO:0016020; GO:0016241; GO:0032801; GO:0050790; GO:0060056; GO:0070062; GO:0097264; GO:1904813; GO:2000310	ALFRQLAGEDMEISVK	1.0119	13.2951	15.1856	13.9311	15.4194	12.9585	12.5785	16.2242	15.3417	14.2659	14.0689	14.3375	15.363	13.5591	13.467	13.4054
O75914	PAK3_HUMAN	Serine/threonine-protein kinase PAK 3 (EC 2.7.11.1) (Beta-PAK) (Oligophrenin-3) (p21-activated kinase 3) (PAK-3)	PAK3 OPHN3	Homo sapiens (Human)	axonogenesis [GO:0007409]; cellular response to organic cyclic compound [GO:0071407]; dendrite development [GO:0016358]; dendritic spine morphogenesis [GO:0060997]; ephrin receptor signaling pathway [GO:0048013]; intracellular signal transduction [GO:0035556]; positive regulation of dendritic spine morphogenesis [GO:0061003]; positive regulation of DNA biosynthetic process [GO:2000573]; positive regulation of fibroblast migration [GO:0010763]; positive regulation of neuron apoptotic process [GO:0043525]; protein phosphorylation [GO:0006468]; regulation of actin cytoskeleton organization [GO:0032956]; regulation of actin filament polymerization [GO:0030833]; regulation of axonogenesis [GO:0050770]; regulation of MAPK cascade [GO:0043408]; stimulatory C-type lectin receptor signaling pathway [GO:0002223]; synapse organization [GO:0050808]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endosome [GO:0005768]; glutamatergic synapse [GO:0098978]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endosome [GO:0005768]; glutamatergic synapse [GO:0098978]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; ATP binding [GO:0005524]; MAP kinase kinase activity [GO:0004708]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; SH3 domain binding [GO:0017124]; small GTPase binding [GO:0031267]; axonogenesis [GO:0007409]; cellular response to organic cyclic compound [GO:0071407]; dendrite development [GO:0016358]; dendritic spine morphogenesis [GO:0060997]; ephrin receptor signaling pathway [GO:0048013]; intracellular signal transduction [GO:0035556]; positive regulation of dendritic spine morphogenesis [GO:0061003]; positive regulation of DNA biosynthetic process [GO:2000573]; positive regulation of fibroblast migration [GO:0010763]; positive regulation of neuron apoptotic process [GO:0043525]; protein phosphorylation [GO:0006468]; regulation of actin cytoskeleton organization [GO:0032956]; regulation of actin filament polymerization [GO:0030833]; regulation of axonogenesis [GO:0050770]; regulation of MAPK cascade [GO:0043408]; stimulatory C-type lectin receptor signaling pathway [GO:0002223]; synapse organization [GO:0050808]	ATP binding [GO:0005524]; MAP kinase kinase activity [GO:0004708]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; SH3 domain binding [GO:0017124]; small GTPase binding [GO:0031267]	GO:0002223; GO:0004674; GO:0004708; GO:0005524; GO:0005737; GO:0005768; GO:0005829; GO:0005886; GO:0006468; GO:0007409; GO:0010763; GO:0014069; GO:0016358; GO:0017124; GO:0030833; GO:0031267; GO:0032956; GO:0035556; GO:0043408; GO:0043525; GO:0046872; GO:0048013; GO:0050770; GO:0050808; GO:0060997; GO:0061003; GO:0071407; GO:0098978; GO:0106310; GO:2000573	ALYLIATNGTPELQNPER	0.96825	13.9416	14.0453	14.018	14.0586	14.2574	13.9347	13.9621	13.938	13.8205	14.7369	14.4902	14.8916	14.4053	14.2102	14.5738
O95782	AP2A1_HUMAN	AP-2 complex subunit alpha-1 (100 kDa coated vesicle protein A) (Adaptor protein complex AP-2 subunit alpha-1) (Adaptor-related protein complex 2 subunit alpha-1) (Alpha-adaptin A) (Alpha1-adaptin) (Clathrin assembly protein complex 2 alpha-A large chain) (Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit)	AP2A1 ADTAA CLAPA1	Homo sapiens (Human)	clathrin-dependent endocytosis [GO:0072583]; endocytosis [GO:0006897]; Golgi to endosome transport [GO:0006895]; intracellular protein transport [GO:0006886]; negative regulation of hyaluronan biosynthetic process [GO:1900126]; postsynaptic neurotransmitter receptor internalization [GO:0098884]; receptor-mediated endocytosis [GO:0006898]; vesicle-mediated transport [GO:0016192]	AP-2 adaptor complex [GO:0030122]; clathrin coat of trans-Golgi network vesicle [GO:0030130]; clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated endocytic vesicle membrane [GO:0030669]; cytoplasmic side of plasma membrane [GO:0009898]; cytosol [GO:0005829]; endocytic vesicle membrane [GO:0030666]; endolysosome membrane [GO:0036020]; filopodium tip [GO:0032433]; membrane [GO:0016020]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]	AP-2 adaptor complex [GO:0030122]; clathrin coat of trans-Golgi network vesicle [GO:0030130]; clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated endocytic vesicle membrane [GO:0030669]; cytoplasmic side of plasma membrane [GO:0009898]; cytosol [GO:0005829]; endocytic vesicle membrane [GO:0030666]; endolysosome membrane [GO:0036020]; filopodium tip [GO:0032433]; membrane [GO:0016020]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; cargo adaptor activity [GO:0140312]; clathrin adaptor activity [GO:0035615]; low-density lipoprotein particle receptor binding [GO:0050750]; protein kinase binding [GO:0019901]; clathrin-dependent endocytosis [GO:0072583]; endocytosis [GO:0006897]; Golgi to endosome transport [GO:0006895]; intracellular protein transport [GO:0006886]; negative regulation of hyaluronan biosynthetic process [GO:1900126]; postsynaptic neurotransmitter receptor internalization [GO:0098884]; receptor-mediated endocytosis [GO:0006898]; vesicle-mediated transport [GO:0016192]	cargo adaptor activity [GO:0140312]; clathrin adaptor activity [GO:0035615]; low-density lipoprotein particle receptor binding [GO:0050750]; protein kinase binding [GO:0019901]	GO:0005829; GO:0005886; GO:0006886; GO:0006895; GO:0006897; GO:0006898; GO:0009898; GO:0016020; GO:0016192; GO:0019901; GO:0030122; GO:0030130; GO:0030666; GO:0030669; GO:0032433; GO:0035615; GO:0036020; GO:0045334; GO:0050750; GO:0072583; GO:0098794; GO:0098884; GO:0140312; GO:1900126	AADLLYAMCDR	1.0033	14.0972	13.8137	14.2062	13.5543	12.5605	12.0689	15.0236	14.7792	15.0761	15.3824	14.2573	14.9454	14.4538	13.8229	15.089
Q99828	CIB1_HUMAN	Calcium and integrin-binding protein 1 (CIB) (Calcium- and integrin-binding protein) (CIBP) (Calmyrin) (DNA-PKcs-interacting protein) (Kinase-interacting protein) (KIP) (SNK-interacting protein 2-28) (SIP2-28)	CIB1 CIB KIP PRKDCIP	Homo sapiens (Human)	angiogenesis [GO:0001525]; apoptotic process [GO:0006915]; cell adhesion [GO:0007155]; cell division [GO:0051301]; cellular response to DNA damage stimulus [GO:0006974]; cellular response to growth factor stimulus [GO:0071363]; cellular response to nerve growth factor stimulus [GO:1990090]; cellular response to tumor necrosis factor [GO:0071356]; cytoplasmic microtubule organization [GO:0031122]; double-strand break repair [GO:0006302]; endomitotic cell cycle [GO:0007113]; extrinsic apoptotic signaling pathway [GO:0097191]; negative regulation of apoptotic process [GO:0043066]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of megakaryocyte differentiation [GO:0045653]; negative regulation of microtubule depolymerization [GO:0007026]; negative regulation of neuron projection development [GO:0010977]; negative regulation of protein kinase B signaling [GO:0051898]; negative regulation of protein phosphorylation [GO:0001933]; platelet formation [GO:0030220]; positive regulation of calcineurin-NFAT signaling cascade [GO:0070886]; positive regulation of catalytic activity [GO:0043085]; positive regulation of cell adhesion mediated by integrin [GO:0033630]; positive regulation of cell growth [GO:0030307]; positive regulation of cell migration [GO:0030335]; positive regulation of cell migration involved in sprouting angiogenesis [GO:0090050]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of cell-matrix adhesion [GO:0001954]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of male germ cell proliferation [GO:2000256]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein serine/threonine kinase activity [GO:0071902]; positive regulation of protein targeting to membrane [GO:0090314]; positive regulation of substrate adhesion-dependent cell spreading [GO:1900026]; regulation of cell division [GO:0051302]; regulation of cell population proliferation [GO:0042127]; response to ischemia [GO:0002931]; spermatid development [GO:0007286]; thrombopoietin-mediated signaling pathway [GO:0038163]	apical plasma membrane [GO:0016324]; axon [GO:0030424]; cell periphery [GO:0071944]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; extracellular exosome [GO:0070062]; filopodium tip [GO:0032433]; Golgi apparatus [GO:0005794]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; membrane [GO:0016020]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; ruffle membrane [GO:0032587]; sarcolemma [GO:0042383]; vesicle [GO:0031982]	apical plasma membrane [GO:0016324]; axon [GO:0030424]; cell periphery [GO:0071944]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; extracellular exosome [GO:0070062]; filopodium tip [GO:0032433]; Golgi apparatus [GO:0005794]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; membrane [GO:0016020]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; ruffle membrane [GO:0032587]; sarcolemma [GO:0042383]; vesicle [GO:0031982]; calcium ion binding [GO:0005509]; calcium-dependent protein kinase inhibitor activity [GO:0008427]; magnesium ion binding [GO:0000287]; protein serine/threonine kinase inhibitor activity [GO:0030291]; protein-membrane adaptor activity [GO:0043495]; small GTPase binding [GO:0031267]; transmembrane transporter binding [GO:0044325]; angiogenesis [GO:0001525]; apoptotic process [GO:0006915]; cell adhesion [GO:0007155]; cell division [GO:0051301]; cellular response to DNA damage stimulus [GO:0006974]; cellular response to growth factor stimulus [GO:0071363]; cellular response to nerve growth factor stimulus [GO:1990090]; cellular response to tumor necrosis factor [GO:0071356]; cytoplasmic microtubule organization [GO:0031122]; double-strand break repair [GO:0006302]; endomitotic cell cycle [GO:0007113]; extrinsic apoptotic signaling pathway [GO:0097191]; negative regulation of apoptotic process [GO:0043066]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of megakaryocyte differentiation [GO:0045653]; negative regulation of microtubule depolymerization [GO:0007026]; negative regulation of neuron projection development [GO:0010977]; negative regulation of protein kinase B signaling [GO:0051898]; negative regulation of protein phosphorylation [GO:0001933]; platelet formation [GO:0030220]; positive regulation of calcineurin-NFAT signaling cascade [GO:0070886]; positive regulation of catalytic activity [GO:0043085]; positive regulation of cell adhesion mediated by integrin [GO:0033630]; positive regulation of cell growth [GO:0030307]; positive regulation of cell migration [GO:0030335]; positive regulation of cell migration involved in sprouting angiogenesis [GO:0090050]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of cell-matrix adhesion [GO:0001954]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of male germ cell proliferation [GO:2000256]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein serine/threonine kinase activity [GO:0071902]; positive regulation of protein targeting to membrane [GO:0090314]; positive regulation of substrate adhesion-dependent cell spreading [GO:1900026]; regulation of cell division [GO:0051302]; regulation of cell population proliferation [GO:0042127]; response to ischemia [GO:0002931]; spermatid development [GO:0007286]; thrombopoietin-mediated signaling pathway [GO:0038163]	calcium ion binding [GO:0005509]; calcium-dependent protein kinase inhibitor activity [GO:0008427]; magnesium ion binding [GO:0000287]; protein serine/threonine kinase inhibitor activity [GO:0030291]; protein-membrane adaptor activity [GO:0043495]; small GTPase binding [GO:0031267]; transmembrane transporter binding [GO:0044325]	GO:0000287; GO:0001525; GO:0001933; GO:0001934; GO:0001954; GO:0002931; GO:0005509; GO:0005634; GO:0005654; GO:0005737; GO:0005783; GO:0005794; GO:0005813; GO:0005886; GO:0006302; GO:0006915; GO:0006974; GO:0007026; GO:0007113; GO:0007155; GO:0007286; GO:0008284; GO:0008285; GO:0008427; GO:0010977; GO:0016020; GO:0016324; GO:0030027; GO:0030220; GO:0030291; GO:0030307; GO:0030335; GO:0030424; GO:0030426; GO:0031122; GO:0031267; GO:0031982; GO:0032433; GO:0032587; GO:0033630; GO:0038163; GO:0042127; GO:0042383; GO:0043005; GO:0043025; GO:0043066; GO:0043085; GO:0043204; GO:0043495; GO:0044325; GO:0045653; GO:0048471; GO:0051092; GO:0051301; GO:0051302; GO:0051898; GO:0070062; GO:0070374; GO:0070886; GO:0071356; GO:0071363; GO:0071902; GO:0071944; GO:0090050; GO:0090314; GO:0097191; GO:1900026; GO:1903078; GO:1990090; GO:2000256	ANPFKER	0.88095	14.3301	15.648	14.072	10.8931	16.5602	16.4253	12.9842	17.0469	15.1092	16.6608	15.773	15.4484	12.3627	9.37313	9.71776
P30305	MPIP2_HUMAN	M-phase inducer phosphatase 2 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25B)	CDC25B CDC25HU2	Homo sapiens (Human)	cell division [GO:0051301]; female meiosis I [GO:0007144]; G2/M transition of mitotic cell cycle [GO:0000086]; mitotic cell cycle [GO:0000278]; oocyte maturation [GO:0001556]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of cytokinesis [GO:0032467]; positive regulation of G2/M transition of mitotic cell cycle [GO:0010971]; positive regulation of G2/MI transition of meiotic cell cycle [GO:0110032]; positive regulation of mitotic cell cycle [GO:0045931]; positive regulation of protein kinase activity [GO:0045860]; protein dephosphorylation [GO:0006470]; protein phosphorylation [GO:0006468]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; spindle pole [GO:0000922]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; spindle pole [GO:0000922]; phosphoprotein phosphatase activity [GO:0004721]; protein kinase binding [GO:0019901]; protein tyrosine phosphatase activity [GO:0004725]; cell division [GO:0051301]; female meiosis I [GO:0007144]; G2/M transition of mitotic cell cycle [GO:0000086]; mitotic cell cycle [GO:0000278]; oocyte maturation [GO:0001556]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of cytokinesis [GO:0032467]; positive regulation of G2/M transition of mitotic cell cycle [GO:0010971]; positive regulation of G2/MI transition of meiotic cell cycle [GO:0110032]; positive regulation of mitotic cell cycle [GO:0045931]; positive regulation of protein kinase activity [GO:0045860]; protein dephosphorylation [GO:0006470]; protein phosphorylation [GO:0006468]	phosphoprotein phosphatase activity [GO:0004721]; protein kinase binding [GO:0019901]; protein tyrosine phosphatase activity [GO:0004725]	GO:0000086; GO:0000278; GO:0000922; GO:0001556; GO:0004721; GO:0004725; GO:0005634; GO:0005654; GO:0005737; GO:0005813; GO:0005829; GO:0006468; GO:0006470; GO:0007144; GO:0008284; GO:0010971; GO:0019901; GO:0032467; GO:0045860; GO:0045931; GO:0051301; GO:0110032	AFLLQTVDGK	1	12.1813	11.5193	12.4559	13.8101	13.2764	13.8412	14.8515	15.5648	15.4744	13.5961	15.803	15.7136	13.981	14.529	15.0868
O14672	ADA10_HUMAN	Disintegrin and metalloproteinase domain-containing protein 10 (ADAM 10) (EC 3.4.24.81) (CDw156) (Kuzbanian protein homolog) (Mammalian disintegrin-metalloprotease) (CD antigen CD156c)	ADAM10 KUZ MADM	Homo sapiens (Human)	adherens junction organization [GO:0034332]; amyloid precursor protein catabolic process [GO:0042987]; cell-cell signaling [GO:0007267]; cochlea development [GO:0090102]; constitutive protein ectodomain proteolysis [GO:0051089]; epidermal growth factor receptor ligand maturation [GO:0038004]; extracellular matrix disassembly [GO:0022617]; in utero embryonic development [GO:0001701]; integrin-mediated signaling pathway [GO:0007229]; membrane protein ectodomain proteolysis [GO:0006509]; monocyte activation [GO:0042117]; negative regulation of cell adhesion [GO:0007162]; negative regulation of gene expression [GO:0010629]; Notch signaling pathway [GO:0007219]; pore complex assembly [GO:0046931]; positive regulation of cell growth [GO:0030307]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of T cell chemotaxis [GO:0010820]; postsynapse organization [GO:0099173]; protein phosphorylation [GO:0006468]; protein processing [GO:0016485]; regulation of neurotransmitter receptor localization to postsynaptic specialization membrane [GO:0098696]; regulation of Notch signaling pathway [GO:0008593]; regulation of vasculature development [GO:1901342]; response to tumor necrosis factor [GO:0034612]; toxin transport [GO:1901998]	adherens junction [GO:0005912]; axon [GO:0030424]; cell surface [GO:0009986]; clathrin-coated vesicle [GO:0030136]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; Golgi-associated vesicle [GO:0005798]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; nucleus [GO:0005634]; perinuclear endoplasmic reticulum [GO:0097038]; plasma membrane [GO:0005886]; pore complex [GO:0046930]; postsynaptic density [GO:0014069]; specific granule membrane [GO:0035579]; synaptic membrane [GO:0097060]; tertiary granule membrane [GO:0070821]; tetraspanin-enriched microdomain [GO:0097197]	adherens junction [GO:0005912]; axon [GO:0030424]; cell surface [GO:0009986]; clathrin-coated vesicle [GO:0030136]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; Golgi-associated vesicle [GO:0005798]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; nucleus [GO:0005634]; perinuclear endoplasmic reticulum [GO:0097038]; plasma membrane [GO:0005886]; pore complex [GO:0046930]; postsynaptic density [GO:0014069]; specific granule membrane [GO:0035579]; synaptic membrane [GO:0097060]; tertiary granule membrane [GO:0070821]; tetraspanin-enriched microdomain [GO:0097197]; endopeptidase activity [GO:0004175]; integrin binding [GO:0005178]; metal ion binding [GO:0046872]; metallodipeptidase activity [GO:0070573]; metalloendopeptidase activity [GO:0004222]; metalloendopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902945]; metallopeptidase activity [GO:0008237]; molecular adaptor activity [GO:0060090]; protein homodimerization activity [GO:0042803]; protein kinase binding [GO:0019901]; SH3 domain binding [GO:0017124]; signaling receptor binding [GO:0005102]; adherens junction organization [GO:0034332]; amyloid precursor protein catabolic process [GO:0042987]; cell-cell signaling [GO:0007267]; cochlea development [GO:0090102]; constitutive protein ectodomain proteolysis [GO:0051089]; epidermal growth factor receptor ligand maturation [GO:0038004]; extracellular matrix disassembly [GO:0022617]; in utero embryonic development [GO:0001701]; integrin-mediated signaling pathway [GO:0007229]; membrane protein ectodomain proteolysis [GO:0006509]; monocyte activation [GO:0042117]; negative regulation of cell adhesion [GO:0007162]; negative regulation of gene expression [GO:0010629]; Notch signaling pathway [GO:0007219]; pore complex assembly [GO:0046931]; positive regulation of cell growth [GO:0030307]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of T cell chemotaxis [GO:0010820]; postsynapse organization [GO:0099173]; protein phosphorylation [GO:0006468]; protein processing [GO:0016485]; regulation of neurotransmitter receptor localization to postsynaptic specialization membrane [GO:0098696]; regulation of Notch signaling pathway [GO:0008593]; regulation of vasculature development [GO:1901342]; response to tumor necrosis factor [GO:0034612]; toxin transport [GO:1901998]	endopeptidase activity [GO:0004175]; integrin binding [GO:0005178]; metal ion binding [GO:0046872]; metallodipeptidase activity [GO:0070573]; metalloendopeptidase activity [GO:0004222]; metalloendopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902945]; metallopeptidase activity [GO:0008237]; molecular adaptor activity [GO:0060090]; protein homodimerization activity [GO:0042803]; protein kinase binding [GO:0019901]; SH3 domain binding [GO:0017124]; signaling receptor binding [GO:0005102]	GO:0000139; GO:0001701; GO:0004175; GO:0004222; GO:0005102; GO:0005178; GO:0005634; GO:0005737; GO:0005788; GO:0005794; GO:0005798; GO:0005886; GO:0005912; GO:0005925; GO:0006468; GO:0006509; GO:0007162; GO:0007219; GO:0007229; GO:0007267; GO:0008237; GO:0008284; GO:0008593; GO:0009986; GO:0010629; GO:0010820; GO:0014069; GO:0016020; GO:0016021; GO:0016485; GO:0017124; GO:0019901; GO:0022617; GO:0030136; GO:0030307; GO:0030335; GO:0030424; GO:0030425; GO:0034332; GO:0034612; GO:0035579; GO:0038004; GO:0042117; GO:0042803; GO:0042987; GO:0043231; GO:0046872; GO:0046930; GO:0046931; GO:0051089; GO:0060090; GO:0070062; GO:0070573; GO:0070821; GO:0090102; GO:0097038; GO:0097060; GO:0097197; GO:0098696; GO:0098978; GO:0099173; GO:1901342; GO:1901998; GO:1902945	AIDTIYQTTDFSGIR	0.93662	15.2402	15.2538	14.8525	11.1408	13.3359	12.7762	14.8763	14.3807	14.4477	15.0828	13.8849	14.3502	14.3983	13.7119	13.9159
P49757	NUMB_HUMAN	Protein numb homolog (h-Numb) (Protein S171)	NUMB C14orf41	Homo sapiens (Human)	adherens junction organization [GO:0034332]; axonogenesis [GO:0007409]; lateral ventricle development [GO:0021670]; negative regulation of protein localization to plasma membrane [GO:1903077]; neuroblast division in subventricular zone [GO:0021849]; positive regulation of cell migration [GO:0030335]; positive regulation of neurogenesis [GO:0050769]; regulation of postsynaptic neurotransmitter receptor internalization [GO:0099149]	apical part of cell [GO:0045177]; basolateral plasma membrane [GO:0016323]; clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]; cytoplasm [GO:0005737]; early endosome [GO:0005769]; endosome membrane [GO:0010008]; extrinsic component of plasma membrane [GO:0019897]; focal adhesion [GO:0005925]; glutamatergic synapse [GO:0098978]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	apical part of cell [GO:0045177]; basolateral plasma membrane [GO:0016323]; clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]; cytoplasm [GO:0005737]; early endosome [GO:0005769]; endosome membrane [GO:0010008]; extrinsic component of plasma membrane [GO:0019897]; focal adhesion [GO:0005925]; glutamatergic synapse [GO:0098978]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; alpha-catenin binding [GO:0045294]; beta-catenin binding [GO:0008013]; cadherin binding [GO:0045296]; adherens junction organization [GO:0034332]; axonogenesis [GO:0007409]; lateral ventricle development [GO:0021670]; negative regulation of protein localization to plasma membrane [GO:1903077]; neuroblast division in subventricular zone [GO:0021849]; positive regulation of cell migration [GO:0030335]; positive regulation of neurogenesis [GO:0050769]; regulation of postsynaptic neurotransmitter receptor internalization [GO:0099149]	alpha-catenin binding [GO:0045294]; beta-catenin binding [GO:0008013]; cadherin binding [GO:0045296]	GO:0005634; GO:0005737; GO:0005769; GO:0005886; GO:0005905; GO:0005925; GO:0007409; GO:0008013; GO:0010008; GO:0016323; GO:0019897; GO:0021670; GO:0021849; GO:0030136; GO:0030335; GO:0034332; GO:0045177; GO:0045294; GO:0045296; GO:0050769; GO:0098978; GO:0099149; GO:1903077	AERKFFK	1.0127	15.2541	12.433	15.1797	13.5441	12.251	11.3667	13.2231	13.7823	14.9648	15.3024	16.1859	14.3491	13.6823	14.9447	14.9296
P01011	AACT_HUMAN	Alpha-1-antichymotrypsin (ACT) (Cell growth-inhibiting gene 24/25 protein) (Serpin A3) [Cleaved into: Alpha-1-antichymotrypsin His-Pro-less]	SERPINA3 AACT GIG24 GIG25	Homo sapiens (Human)	acute-phase response [GO:0006953]; inflammatory response [GO:0006954]; maintenance of gastrointestinal epithelium [GO:0030277]; negative regulation of endopeptidase activity [GO:0010951]; regulation of lipid metabolic process [GO:0019216]	azurophil granule lumen [GO:0035578]; blood microparticle [GO:0072562]; collagen-containing extracellular matrix [GO:0062023]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nucleus [GO:0005634]; platelet alpha granule lumen [GO:0031093]; secretory granule lumen [GO:0034774]	azurophil granule lumen [GO:0035578]; blood microparticle [GO:0072562]; collagen-containing extracellular matrix [GO:0062023]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nucleus [GO:0005634]; platelet alpha granule lumen [GO:0031093]; secretory granule lumen [GO:0034774]; DNA binding [GO:0003677]; serine-type endopeptidase inhibitor activity [GO:0004867]; acute-phase response [GO:0006953]; inflammatory response [GO:0006954]; maintenance of gastrointestinal epithelium [GO:0030277]; negative regulation of endopeptidase activity [GO:0010951]; regulation of lipid metabolic process [GO:0019216]	DNA binding [GO:0003677]; serine-type endopeptidase inhibitor activity [GO:0004867]	GO:0003677; GO:0004867; GO:0005576; GO:0005615; GO:0005634; GO:0006953; GO:0006954; GO:0010951; GO:0019216; GO:0030277; GO:0031093; GO:0034774; GO:0035578; GO:0062023; GO:0070062; GO:0072562	ADLSGITGAR	0.91139	14.8272	14.2081	13.9828	12.4568	12.2388	12.3429	14.7797	14.6207	14.8732	14.9048	14.7202	13.0527	14.0739	14.9783	14.8189
Q9UQF2	JIP1_HUMAN	C-Jun-amino-terminal kinase-interacting protein 1 (JIP-1) (JNK-interacting protein 1) (Islet-brain 1) (IB-1) (JNK MAP kinase scaffold protein 1) (Mitogen-activated protein kinase 8-interacting protein 1)	MAPK8IP1 IB1 JIP1 PRKM8IP	Homo sapiens (Human)	"JUN phosphorylation [GO:0007258]; negative regulation of intrinsic apoptotic signaling pathway [GO:2001243]; negative regulation of JUN kinase activity [GO:0043508]; positive regulation of JNK cascade [GO:0046330]; regulation of CD8-positive, alpha-beta T cell proliferation [GO:2000564]; regulation of DNA-templated transcription [GO:0006355]; regulation of JNK cascade [GO:0046328]; vesicle-mediated transport [GO:0016192]"	cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; dentate gyrus mossy fiber [GO:0044302]; endoplasmic reticulum membrane [GO:0005789]; mitochondrial membrane [GO:0031966]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; synapse [GO:0045202]	"cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; dentate gyrus mossy fiber [GO:0044302]; endoplasmic reticulum membrane [GO:0005789]; mitochondrial membrane [GO:0031966]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; synapse [GO:0045202]; kinesin binding [GO:0019894]; MAP-kinase scaffold activity [GO:0005078]; protein kinase binding [GO:0019901]; protein kinase inhibitor activity [GO:0004860]; JUN phosphorylation [GO:0007258]; negative regulation of intrinsic apoptotic signaling pathway [GO:2001243]; negative regulation of JUN kinase activity [GO:0043508]; positive regulation of JNK cascade [GO:0046330]; regulation of CD8-positive, alpha-beta T cell proliferation [GO:2000564]; regulation of DNA-templated transcription [GO:0006355]; regulation of JNK cascade [GO:0046328]; vesicle-mediated transport [GO:0016192]"	kinesin binding [GO:0019894]; MAP-kinase scaffold activity [GO:0005078]; protein kinase binding [GO:0019901]; protein kinase inhibitor activity [GO:0004860]	GO:0004860; GO:0005078; GO:0005634; GO:0005737; GO:0005789; GO:0005829; GO:0005886; GO:0006355; GO:0007258; GO:0016192; GO:0019894; GO:0019901; GO:0030425; GO:0031966; GO:0043025; GO:0043508; GO:0044302; GO:0045202; GO:0046328; GO:0046330; GO:0048471; GO:2000564; GO:2001243	AARRPGAGPPK	0.98232	13.9397	13.7454	13.1183	16.6541	11.2365	10.581	12.0599	16.6962	12.3612	13.4244	16.8685	16.8818	17.4679	12.8075	12.9536
Q14114	LRP8_HUMAN	Low-density lipoprotein receptor-related protein 8 (LRP-8) (Apolipoprotein E receptor 2)	LRP8 APOER2	Homo sapiens (Human)	ammon gyrus development [GO:0021541]; cellular response to cholesterol [GO:0071397]; cellular response to growth factor stimulus [GO:0071363]; chemical synaptic transmission [GO:0007268]; cytokine-mediated signaling pathway [GO:0019221]; dendrite morphogenesis [GO:0048813]; endocytosis [GO:0006897]; layer formation in cerebral cortex [GO:0021819]; lipid metabolic process [GO:0006629]; modulation of chemical synaptic transmission [GO:0050804]; positive regulation of CREB transcription factor activity [GO:0032793]; positive regulation of dendrite development [GO:1900006]; positive regulation of dendritic spine morphogenesis [GO:0061003]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of protein tyrosine kinase activity [GO:0061098]; proteolysis [GO:0006508]; reelin-mediated signaling pathway [GO:0038026]; regulation of apoptotic process [GO:0042981]; regulation of innate immune response [GO:0045088]; response to xenobiotic stimulus [GO:0009410]; retinoid metabolic process [GO:0001523]; signal transduction [GO:0007165]; ventral spinal cord development [GO:0021517]	axon [GO:0030424]; caveola [GO:0005901]; cell surface [GO:0009986]; dendrite [GO:0030425]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; microtubule associated complex [GO:0005875]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; receptor complex [GO:0043235]	axon [GO:0030424]; caveola [GO:0005901]; cell surface [GO:0009986]; dendrite [GO:0030425]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; microtubule associated complex [GO:0005875]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; receptor complex [GO:0043235]; amyloid-beta binding [GO:0001540]; apolipoprotein binding [GO:0034185]; calcium ion binding [GO:0005509]; calcium-dependent protein binding [GO:0048306]; cargo receptor activity [GO:0038024]; high-density lipoprotein particle binding [GO:0008035]; kinesin binding [GO:0019894]; low-density lipoprotein particle receptor activity [GO:0005041]; protein N-terminus binding [GO:0047485]; reelin receptor activity [GO:0038025]; transmembrane signaling receptor activity [GO:0004888]; very-low-density lipoprotein particle receptor activity [GO:0030229]; ammon gyrus development [GO:0021541]; cellular response to cholesterol [GO:0071397]; cellular response to growth factor stimulus [GO:0071363]; chemical synaptic transmission [GO:0007268]; cytokine-mediated signaling pathway [GO:0019221]; dendrite morphogenesis [GO:0048813]; endocytosis [GO:0006897]; layer formation in cerebral cortex [GO:0021819]; lipid metabolic process [GO:0006629]; modulation of chemical synaptic transmission [GO:0050804]; positive regulation of CREB transcription factor activity [GO:0032793]; positive regulation of dendrite development [GO:1900006]; positive regulation of dendritic spine morphogenesis [GO:0061003]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of protein tyrosine kinase activity [GO:0061098]; proteolysis [GO:0006508]; reelin-mediated signaling pathway [GO:0038026]; regulation of apoptotic process [GO:0042981]; regulation of innate immune response [GO:0045088]; response to xenobiotic stimulus [GO:0009410]; retinoid metabolic process [GO:0001523]; signal transduction [GO:0007165]; ventral spinal cord development [GO:0021517]	amyloid-beta binding [GO:0001540]; apolipoprotein binding [GO:0034185]; calcium ion binding [GO:0005509]; calcium-dependent protein binding [GO:0048306]; cargo receptor activity [GO:0038024]; high-density lipoprotein particle binding [GO:0008035]; kinesin binding [GO:0019894]; low-density lipoprotein particle receptor activity [GO:0005041]; protein N-terminus binding [GO:0047485]; reelin receptor activity [GO:0038025]; transmembrane signaling receptor activity [GO:0004888]; very-low-density lipoprotein particle receptor activity [GO:0030229]	GO:0001523; GO:0001540; GO:0004888; GO:0005041; GO:0005509; GO:0005615; GO:0005875; GO:0005886; GO:0005901; GO:0006508; GO:0006629; GO:0006897; GO:0007165; GO:0007268; GO:0008035; GO:0009410; GO:0009986; GO:0014069; GO:0016020; GO:0016021; GO:0019221; GO:0019894; GO:0021517; GO:0021541; GO:0021819; GO:0030229; GO:0030424; GO:0030425; GO:0032793; GO:0034185; GO:0038024; GO:0038025; GO:0038026; GO:0042981; GO:0043025; GO:0043235; GO:0045088; GO:0047485; GO:0048306; GO:0048813; GO:0050731; GO:0050804; GO:0061003; GO:0061098; GO:0071363; GO:0071397; GO:1900006	AAAGKSPSLIFTNR	0.74308	14.492	14.4658	13.8213	13.7266	13.5921	13.5355	13.6227	13.9896	13.7111	15.227	13.8222	14.483	14.824	13.7987	13.6187
Q13207	TBX2_HUMAN	T-box transcription factor TBX2 (T-box protein 2)	TBX2	Homo sapiens (Human)	aorta morphogenesis [GO:0035909]; apoptotic process [GO:0006915]; atrioventricular canal development [GO:0036302]; atrioventricular canal morphogenesis [GO:1905222]; cardiac jelly development [GO:1905072]; cardiac muscle cell myoblast differentiation [GO:0060379]; cardiac muscle tissue development [GO:0048738]; cell fate specification [GO:0001708]; cellular senescence [GO:0090398]; cochlea morphogenesis [GO:0090103]; developmental growth involved in morphogenesis [GO:0060560]; embryonic camera-type eye morphogenesis [GO:0048596]; embryonic digit morphogenesis [GO:0042733]; embryonic heart tube development [GO:0035050]; endocardial cushion formation [GO:0003272]; endocardial cushion morphogenesis [GO:0003203]; epithelial tube branching involved in lung morphogenesis [GO:0060441]; fibroblast growth factor receptor signaling pathway [GO:0008543]; heart looping [GO:0001947]; mammary placode formation [GO:0060596]; melanocyte proliferation [GO:0097325]; mesenchymal cell proliferation involved in lung development [GO:0060916]; muscle cell fate determination [GO:0007521]; negative regulation of cardiac chamber formation [GO:1901211]; negative regulation of cellular senescence [GO:2000773]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of heart looping [GO:1901208]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neurogenesis [GO:0022008]; Notch signaling pathway [GO:0007219]; outflow tract morphogenesis [GO:0003151]; outflow tract septum morphogenesis [GO:0003148]; pharynx development [GO:0060465]; pigment metabolic process involved in pigmentation [GO:0043474]; positive regulation of cardiac muscle cell proliferation [GO:0060045]; positive regulation of cell cycle G1/S phase transition [GO:1902808]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of heart contraction [GO:0008016]; regulation of transcription by RNA polymerase II [GO:0006357]; response to retinoic acid [GO:0032526]; roof of mouth development [GO:0060021]; smooth muscle cell differentiation [GO:0051145]; ureteric peristalsis [GO:0072105]	chromatin [GO:0000785]; cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	"chromatin [GO:0000785]; cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription factor binding [GO:0140297]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; histone deacetylase binding [GO:0042826]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]; sequence-specific double-stranded DNA binding [GO:1990837]; aorta morphogenesis [GO:0035909]; apoptotic process [GO:0006915]; atrioventricular canal development [GO:0036302]; atrioventricular canal morphogenesis [GO:1905222]; cardiac jelly development [GO:1905072]; cardiac muscle cell myoblast differentiation [GO:0060379]; cardiac muscle tissue development [GO:0048738]; cell fate specification [GO:0001708]; cellular senescence [GO:0090398]; cochlea morphogenesis [GO:0090103]; developmental growth involved in morphogenesis [GO:0060560]; embryonic camera-type eye morphogenesis [GO:0048596]; embryonic digit morphogenesis [GO:0042733]; embryonic heart tube development [GO:0035050]; endocardial cushion formation [GO:0003272]; endocardial cushion morphogenesis [GO:0003203]; epithelial tube branching involved in lung morphogenesis [GO:0060441]; fibroblast growth factor receptor signaling pathway [GO:0008543]; heart looping [GO:0001947]; mammary placode formation [GO:0060596]; melanocyte proliferation [GO:0097325]; mesenchymal cell proliferation involved in lung development [GO:0060916]; muscle cell fate determination [GO:0007521]; negative regulation of cardiac chamber formation [GO:1901211]; negative regulation of cellular senescence [GO:2000773]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of heart looping [GO:1901208]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neurogenesis [GO:0022008]; Notch signaling pathway [GO:0007219]; outflow tract morphogenesis [GO:0003151]; outflow tract septum morphogenesis [GO:0003148]; pharynx development [GO:0060465]; pigment metabolic process involved in pigmentation [GO:0043474]; positive regulation of cardiac muscle cell proliferation [GO:0060045]; positive regulation of cell cycle G1/S phase transition [GO:1902808]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of heart contraction [GO:0008016]; regulation of transcription by RNA polymerase II [GO:0006357]; response to retinoic acid [GO:0032526]; roof of mouth development [GO:0060021]; smooth muscle cell differentiation [GO:0051145]; ureteric peristalsis [GO:0072105]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription factor binding [GO:0140297]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; histone deacetylase binding [GO:0042826]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]; sequence-specific double-stranded DNA binding [GO:1990837]"	GO:0000122; GO:0000785; GO:0000978; GO:0000981; GO:0001227; GO:0001708; GO:0001947; GO:0003148; GO:0003151; GO:0003203; GO:0003272; GO:0003677; GO:0005634; GO:0005667; GO:0005737; GO:0006357; GO:0006915; GO:0007219; GO:0007521; GO:0008016; GO:0008543; GO:0022008; GO:0032526; GO:0035050; GO:0035909; GO:0036302; GO:0042733; GO:0042826; GO:0043474; GO:0043565; GO:0045892; GO:0045944; GO:0048596; GO:0048738; GO:0051145; GO:0060021; GO:0060045; GO:0060379; GO:0060441; GO:0060465; GO:0060560; GO:0060596; GO:0060916; GO:0072105; GO:0090103; GO:0090398; GO:0097325; GO:0140297; GO:1901208; GO:1901211; GO:1902808; GO:1905072; GO:1905222; GO:1990837; GO:2000773	AAGGNSR	1.0175	13.836	13.9893	12.7491	13.1486	13.4653	10.9097	15.1638	14.0661	13.0255	15.1526	15.3612	15.206	14.9036	14.9264	14.712
P39687	AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A (Acidic nuclear phosphoprotein pp32) (pp32) (Leucine-rich acidic nuclear protein) (LANP) (Mapmodulin) (Potent heat-stable protein phosphatase 2A inhibitor I1PP2A) (Putative HLA-DR-associated protein I) (PHAPI)	ANP32A C15orf1 LANP MAPM PHAP1	Homo sapiens (Human)	intracellular signal transduction [GO:0035556]; nucleocytoplasmic transport [GO:0006913]; regulation of apoptotic process [GO:0042981]	cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]	cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; histone binding [GO:0042393]; RNA binding [GO:0003723]; intracellular signal transduction [GO:0035556]; nucleocytoplasmic transport [GO:0006913]; regulation of apoptotic process [GO:0042981]	histone binding [GO:0042393]; RNA binding [GO:0003723]	GO:0003723; GO:0005634; GO:0005654; GO:0005737; GO:0005783; GO:0006913; GO:0035556; GO:0042393; GO:0042981; GO:0048471	CPNLTHLNLSGNK	0.42331	13.5647	13.4448	13.7576	12.4379	13.1528	13.3156	13.4444	13.3042	13.7583	14.7676	15.0824	15.3097	14.673	15.3631	15.2082
Q8IU99	CAHM1_HUMAN	Calcium homeostasis modulator protein 1 (Protein FAM26C)	CALHM1 FAM26C	Homo sapiens (Human)	ATP transport [GO:0015867]; cation transport [GO:0006812]; protein heterooligomerization [GO:0051291]; protein homooligomerization [GO:0051260]; regulation of ion transmembrane transport [GO:0034765]; response to stimulus [GO:0050896]; sensory perception of bitter taste [GO:0050913]; sensory perception of sweet taste [GO:0050916]; sensory perception of umami taste [GO:0050917]	basolateral plasma membrane [GO:0016323]; endoplasmic reticulum membrane [GO:0005789]; integral component of plasma membrane [GO:0005887]	basolateral plasma membrane [GO:0016323]; endoplasmic reticulum membrane [GO:0005789]; integral component of plasma membrane [GO:0005887]; calcium activated cation channel activity [GO:0005227]; cation channel activity [GO:0005261]; identical protein binding [GO:0042802]; voltage-gated calcium channel activity [GO:0005245]; voltage-gated ion channel activity [GO:0005244]; ATP transport [GO:0015867]; cation transport [GO:0006812]; protein heterooligomerization [GO:0051291]; protein homooligomerization [GO:0051260]; regulation of ion transmembrane transport [GO:0034765]; response to stimulus [GO:0050896]; sensory perception of bitter taste [GO:0050913]; sensory perception of sweet taste [GO:0050916]; sensory perception of umami taste [GO:0050917]	calcium activated cation channel activity [GO:0005227]; cation channel activity [GO:0005261]; identical protein binding [GO:0042802]; voltage-gated calcium channel activity [GO:0005245]; voltage-gated ion channel activity [GO:0005244]	GO:0005227; GO:0005244; GO:0005245; GO:0005261; GO:0005789; GO:0005887; GO:0006812; GO:0015867; GO:0016323; GO:0034765; GO:0042802; GO:0050896; GO:0050913; GO:0050916; GO:0050917; GO:0051260; GO:0051291	AKDPAVLR	0.97778	14.0521	14.2832	13.8668	13.5631	13.6818	13.0637	14.5973	13.5078	13.993	18.3839	12.3453	13.8613	12.1357	14.3688	14.6481
Q8N3V7	SYNPO_HUMAN	Synaptopodin	SYNPO KIAA1029	Homo sapiens (Human)	modification of dendritic spine [GO:0098886]; positive regulation of actin filament bundle assembly [GO:0032233]; regulation of stress fiber assembly [GO:0051492]; spine apparatus assembly [GO:1905355]	actin cytoskeleton [GO:0015629]; bicellular tight junction [GO:0005923]; cytosol [GO:0005829]; dendritic spine [GO:0043197]; nucleus [GO:0005634]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; spine apparatus [GO:0097444]; stress fiber [GO:0001725]; Z disc [GO:0030018]	actin cytoskeleton [GO:0015629]; bicellular tight junction [GO:0005923]; cytosol [GO:0005829]; dendritic spine [GO:0043197]; nucleus [GO:0005634]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; spine apparatus [GO:0097444]; stress fiber [GO:0001725]; Z disc [GO:0030018]; actin binding [GO:0003779]; modification of dendritic spine [GO:0098886]; positive regulation of actin filament bundle assembly [GO:0032233]; regulation of stress fiber assembly [GO:0051492]; spine apparatus assembly [GO:1905355]	actin binding [GO:0003779]	GO:0001725; GO:0003779; GO:0005634; GO:0005829; GO:0005886; GO:0005923; GO:0014069; GO:0015629; GO:0030018; GO:0032233; GO:0043197; GO:0043204; GO:0051492; GO:0097444; GO:0098886; GO:1905355	AGQMMTASPSPGPGPR	0.98316	14.8378	15.1337	13.9996	12.7893	13.425	12.6556	14.4135	14.1176	14.9865	14.848	14.7953	14.0452	12.9302	11.88	15.0201
P53041	PPP5_HUMAN	Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT)	PPP5C PPP5	Homo sapiens (Human)	DNA-templated transcription [GO:0006351]; double-strand break repair [GO:0006302]; MAPK cascade [GO:0000165]; mitotic cell cycle [GO:0000278]; peptidyl-serine dephosphorylation [GO:0070262]; peptidyl-threonine dephosphorylation [GO:0035970]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; protein dephosphorylation [GO:0006470]; response to arachidonic acid [GO:1904550]; response to lead ion [GO:0010288]; response to morphine [GO:0043278]	chaperone complex [GO:0101031]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]	chaperone complex [GO:0101031]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; ADP binding [GO:0043531]; ATP binding [GO:0005524]; Hsp90 protein binding [GO:0051879]; identical protein binding [GO:0042802]; lipid binding [GO:0008289]; metal ion binding [GO:0046872]; molecular adaptor activity [GO:0060090]; myosin phosphatase activity [GO:0017018]; phosphatase activity [GO:0016791]; phosphoprotein phosphatase activity [GO:0004721]; protein serine/threonine phosphatase activity [GO:0004722]; RNA binding [GO:0003723]; tau protein binding [GO:0048156]; DNA-templated transcription [GO:0006351]; double-strand break repair [GO:0006302]; MAPK cascade [GO:0000165]; mitotic cell cycle [GO:0000278]; peptidyl-serine dephosphorylation [GO:0070262]; peptidyl-threonine dephosphorylation [GO:0035970]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; protein dephosphorylation [GO:0006470]; response to arachidonic acid [GO:1904550]; response to lead ion [GO:0010288]; response to morphine [GO:0043278]	ADP binding [GO:0043531]; ATP binding [GO:0005524]; Hsp90 protein binding [GO:0051879]; identical protein binding [GO:0042802]; lipid binding [GO:0008289]; metal ion binding [GO:0046872]; molecular adaptor activity [GO:0060090]; myosin phosphatase activity [GO:0017018]; phosphatase activity [GO:0016791]; phosphoprotein phosphatase activity [GO:0004721]; protein serine/threonine phosphatase activity [GO:0004722]; RNA binding [GO:0003723]; tau protein binding [GO:0048156]	GO:0000165; GO:0000278; GO:0003723; GO:0004721; GO:0004722; GO:0005524; GO:0005634; GO:0005654; GO:0005829; GO:0005886; GO:0006302; GO:0006351; GO:0006470; GO:0008289; GO:0010288; GO:0016791; GO:0017018; GO:0032991; GO:0035970; GO:0042802; GO:0043123; GO:0043231; GO:0043278; GO:0043531; GO:0046872; GO:0048156; GO:0051879; GO:0060090; GO:0070262; GO:0101031; GO:1904550	AALRDYETVVK	1.0101	13.8366	13.8398	14.372	13.3801	10.6056	11.6725	15.2279	14.0849	13.7763	14.8532	13.695	15.3864	14.8167	14.3287	15.1082
Q92673	SORL_HUMAN	Sortilin-related receptor (Low-density lipoprotein receptor relative with 11 ligand-binding repeats) (LDLR relative with 11 ligand-binding repeats) (LR11) (SorLA-1) (Sorting protein-related receptor containing LDLR class A repeats) (SorLA)	SORL1 C11orf32	Homo sapiens (Human)	adaptive thermogenesis [GO:1990845]; cell migration [GO:0016477]; cell population proliferation [GO:0008283]; diet induced thermogenesis [GO:0002024]; insulin receptor recycling [GO:0038020]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902960]; negative regulation of BMP signaling pathway [GO:0030514]; negative regulation of MAP kinase activity [GO:0043407]; negative regulation of metalloendopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902963]; negative regulation of neurofibrillary tangle assembly [GO:1902997]; negative regulation of neurogenesis [GO:0050768]; negative regulation of neuron death [GO:1901215]; negative regulation of protein binding [GO:0032091]; negative regulation of protein-containing complex assembly [GO:0031333]; negative regulation of tau-protein kinase activity [GO:1902948]; negative regulation of triglyceride catabolic process [GO:0010897]; neuropeptide signaling pathway [GO:0007218]; positive regulation of adipose tissue development [GO:1904179]; positive regulation of choline O-acetyltransferase activity [GO:1902771]; positive regulation of early endosome to recycling endosome transport [GO:1902955]; positive regulation of endocytic recycling [GO:2001137]; positive regulation of ER to Golgi vesicle-mediated transport [GO:1902953]; positive regulation of glial cell-derived neurotrophic factor production [GO:1900168]; positive regulation of insulin receptor signaling pathway [GO:0046628]; positive regulation of protein catabolic process [GO:0045732]; positive regulation of protein exit from endoplasmic reticulum [GO:0070863]; positive regulation of protein localization to early endosome [GO:1902966]; post-Golgi vesicle-mediated transport [GO:0006892]; protein localization to Golgi apparatus [GO:0034067]; protein maturation [GO:0051604]; protein retention in Golgi apparatus [GO:0045053]; protein targeting [GO:0006605]; protein targeting to lysosome [GO:0006622]; receptor-mediated endocytosis [GO:0006898]; regulation of smooth muscle cell migration [GO:0014910]	cell surface [GO:0009986]; early endosome [GO:0005769]; early endosome membrane [GO:0031901]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endosome [GO:0005768]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; Golgi cisterna [GO:0031985]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; multivesicular body [GO:0005771]; multivesicular body membrane [GO:0032585]; neuronal cell body [GO:0043025]; nuclear envelope lumen [GO:0005641]; perinucleolar compartment [GO:0097356]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]; recycling endosome membrane [GO:0055038]; trans-Golgi network [GO:0005802]; transport vesicle membrane [GO:0030658]	cell surface [GO:0009986]; early endosome [GO:0005769]; early endosome membrane [GO:0031901]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endosome [GO:0005768]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; Golgi cisterna [GO:0031985]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; multivesicular body [GO:0005771]; multivesicular body membrane [GO:0032585]; neuronal cell body [GO:0043025]; nuclear envelope lumen [GO:0005641]; perinucleolar compartment [GO:0097356]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]; recycling endosome membrane [GO:0055038]; trans-Golgi network [GO:0005802]; transport vesicle membrane [GO:0030658]; amyloid-beta binding [GO:0001540]; low-density lipoprotein particle binding [GO:0030169]; low-density lipoprotein particle receptor activity [GO:0005041]; neuropeptide binding [GO:0042923]; small GTPase binding [GO:0031267]; transmembrane signaling receptor activity [GO:0004888]; adaptive thermogenesis [GO:1990845]; cell migration [GO:0016477]; cell population proliferation [GO:0008283]; diet induced thermogenesis [GO:0002024]; insulin receptor recycling [GO:0038020]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902960]; negative regulation of BMP signaling pathway [GO:0030514]; negative regulation of MAP kinase activity [GO:0043407]; negative regulation of metalloendopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902963]; negative regulation of neurofibrillary tangle assembly [GO:1902997]; negative regulation of neurogenesis [GO:0050768]; negative regulation of neuron death [GO:1901215]; negative regulation of protein binding [GO:0032091]; negative regulation of protein-containing complex assembly [GO:0031333]; negative regulation of tau-protein kinase activity [GO:1902948]; negative regulation of triglyceride catabolic process [GO:0010897]; neuropeptide signaling pathway [GO:0007218]; positive regulation of adipose tissue development [GO:1904179]; positive regulation of choline O-acetyltransferase activity [GO:1902771]; positive regulation of early endosome to recycling endosome transport [GO:1902955]; positive regulation of endocytic recycling [GO:2001137]; positive regulation of ER to Golgi vesicle-mediated transport [GO:1902953]; positive regulation of glial cell-derived neurotrophic factor production [GO:1900168]; positive regulation of insulin receptor signaling pathway [GO:0046628]; positive regulation of protein catabolic process [GO:0045732]; positive regulation of protein exit from endoplasmic reticulum [GO:0070863]; positive regulation of protein localization to early endosome [GO:1902966]; post-Golgi vesicle-mediated transport [GO:0006892]; protein localization to Golgi apparatus [GO:0034067]; protein maturation [GO:0051604]; protein retention in Golgi apparatus [GO:0045053]; protein targeting [GO:0006605]; protein targeting to lysosome [GO:0006622]; receptor-mediated endocytosis [GO:0006898]; regulation of smooth muscle cell migration [GO:0014910]	amyloid-beta binding [GO:0001540]; low-density lipoprotein particle binding [GO:0030169]; low-density lipoprotein particle receptor activity [GO:0005041]; neuropeptide binding [GO:0042923]; small GTPase binding [GO:0031267]; transmembrane signaling receptor activity [GO:0004888]	GO:0000139; GO:0001540; GO:0002024; GO:0004888; GO:0005041; GO:0005615; GO:0005641; GO:0005768; GO:0005769; GO:0005771; GO:0005783; GO:0005789; GO:0005794; GO:0005802; GO:0005886; GO:0005887; GO:0006605; GO:0006622; GO:0006892; GO:0006898; GO:0007218; GO:0008283; GO:0009986; GO:0010008; GO:0010897; GO:0014910; GO:0016020; GO:0016021; GO:0016477; GO:0030169; GO:0030514; GO:0030658; GO:0031267; GO:0031333; GO:0031901; GO:0031985; GO:0032091; GO:0032585; GO:0034067; GO:0038020; GO:0042923; GO:0043025; GO:0043407; GO:0045053; GO:0045732; GO:0046628; GO:0050768; GO:0051604; GO:0055037; GO:0055038; GO:0070062; GO:0070863; GO:0097356; GO:1900168; GO:1901215; GO:1902430; GO:1902771; GO:1902948; GO:1902953; GO:1902955; GO:1902960; GO:1902963; GO:1902966; GO:1902997; GO:1904179; GO:1990845; GO:2001137	AADLLLHSK	1.0049	13.6025	14.6689	14.4224	12.7574	13.3659	13.4131	13.0731	14.7837	13.8529	14.7885	14.4446	14.1403	14.0633	13.4177	13.5389
A4D1B5	GSAP_HUMAN	Gamma-secretase-activating protein (GSAP) (Protein pigeon homolog) [Cleaved into: Gamma-secretase-activating protein 16 kDa C-terminal form (GSAP-16K)]	GSAP PION	Homo sapiens (Human)	positive regulation of amyloid-beta formation [GO:1902004]; regulation of proteolysis [GO:0030162]	trans-Golgi network [GO:0005802]	trans-Golgi network [GO:0005802]; amyloid-beta binding [GO:0001540]; positive regulation of amyloid-beta formation [GO:1902004]; regulation of proteolysis [GO:0030162]	amyloid-beta binding [GO:0001540]	GO:0001540; GO:0005802; GO:0030162; GO:1902004	CASWGQITYSVFYIHK	1.0171	14.1695	14.2789	14.4999	10.7674	12.8413	12.6764	14.6499	13.0461	14.6693	14.5987	15.768	14.2496	13.6924	14.0631	14.2251
Q15392	DHC24_HUMAN	Delta(24)-sterol reductase (EC 1.3.1.72) (24-dehydrocholesterol reductase) (3-beta-hydroxysterol Delta-24-reductase) (Diminuto/dwarf1 homolog) (Seladin-1)	DHCR24 KIAA0018	Homo sapiens (Human)	amyloid precursor protein catabolic process [GO:0042987]; apoptotic process [GO:0006915]; cholesterol biosynthetic process [GO:0006695]; cholesterol biosynthetic process via desmosterol [GO:0033489]; cholesterol biosynthetic process via lathosterol [GO:0033490]; male genitalia development [GO:0030539]; membrane organization [GO:0061024]; negative regulation of apoptotic process [GO:0043066]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; plasminogen activation [GO:0031639]; protein localization [GO:0008104]; Ras protein signal transduction [GO:0007265]; regulation of cell cycle [GO:0051726]; regulation of neuron death [GO:1901214]; response to hormone [GO:0009725]; response to oxidative stress [GO:0006979]; skin development [GO:0043588]; steroid metabolic process [GO:0008202]; tissue development [GO:0009888]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; nucleus [GO:0005634]	"cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; nucleus [GO:0005634]; delta24(24-1) sterol reductase activity [GO:0000246]; delta24-sterol reductase activity [GO:0050614]; enzyme binding [GO:0019899]; FAD binding [GO:0071949]; oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor [GO:0016628]; peptide antigen binding [GO:0042605]; amyloid precursor protein catabolic process [GO:0042987]; apoptotic process [GO:0006915]; cholesterol biosynthetic process [GO:0006695]; cholesterol biosynthetic process via desmosterol [GO:0033489]; cholesterol biosynthetic process via lathosterol [GO:0033490]; male genitalia development [GO:0030539]; membrane organization [GO:0061024]; negative regulation of apoptotic process [GO:0043066]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; plasminogen activation [GO:0031639]; protein localization [GO:0008104]; Ras protein signal transduction [GO:0007265]; regulation of cell cycle [GO:0051726]; regulation of neuron death [GO:1901214]; response to hormone [GO:0009725]; response to oxidative stress [GO:0006979]; skin development [GO:0043588]; steroid metabolic process [GO:0008202]; tissue development [GO:0009888]"	"delta24(24-1) sterol reductase activity [GO:0000246]; delta24-sterol reductase activity [GO:0050614]; enzyme binding [GO:0019899]; FAD binding [GO:0071949]; oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor [GO:0016628]; peptide antigen binding [GO:0042605]"	GO:0000139; GO:0000246; GO:0005634; GO:0005737; GO:0005783; GO:0005789; GO:0005829; GO:0005856; GO:0006695; GO:0006915; GO:0006979; GO:0007265; GO:0008104; GO:0008202; GO:0008285; GO:0009725; GO:0009888; GO:0016020; GO:0016021; GO:0016628; GO:0019899; GO:0030539; GO:0031639; GO:0033489; GO:0033490; GO:0042605; GO:0042987; GO:0043066; GO:0043154; GO:0043588; GO:0050614; GO:0051726; GO:0061024; GO:0071949; GO:1901214	AWVVFKLSSAPR	1.0224	10.9829	16.8726	16.8007	16.3528	8.43475	16.3967	11.5035	16.5147	10.0978	12.7121	16.7601	16.4833	16.6659	10.8467	10.6074
P63010	AP2B1_HUMAN	AP-2 complex subunit beta (AP105B) (Adaptor protein complex AP-2 subunit beta) (Adaptor-related protein complex 2 subunit beta) (Beta-2-adaptin) (Beta-adaptin) (Clathrin assembly protein complex 2 beta large chain) (Plasma membrane adaptor HA2/AP2 adaptin beta subunit)	AP2B1 ADTB2 CLAPB1	Homo sapiens (Human)	aorta development [GO:0035904]; clathrin-dependent endocytosis [GO:0072583]; coronary vasculature development [GO:0060976]; intracellular protein transport [GO:0006886]; kidney development [GO:0001822]; postsynaptic neurotransmitter receptor internalization [GO:0098884]; synaptic vesicle endocytosis [GO:0048488]; ventricular septum development [GO:0003281]; vesicle-mediated transport [GO:0016192]	AP-2 adaptor complex [GO:0030122]; clathrin adaptor complex [GO:0030131]; clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated endocytic vesicle membrane [GO:0030669]; cytoplasmic side of plasma membrane [GO:0009898]; cytosol [GO:0005829]; endocytic vesicle membrane [GO:0030666]; endolysosome membrane [GO:0036020]; glutamatergic synapse [GO:0098978]; membrane [GO:0016020]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; presynapse [GO:0098793]	AP-2 adaptor complex [GO:0030122]; clathrin adaptor complex [GO:0030131]; clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated endocytic vesicle membrane [GO:0030669]; cytoplasmic side of plasma membrane [GO:0009898]; cytosol [GO:0005829]; endocytic vesicle membrane [GO:0030666]; endolysosome membrane [GO:0036020]; glutamatergic synapse [GO:0098978]; membrane [GO:0016020]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; presynapse [GO:0098793]; clathrin binding [GO:0030276]; signal sequence binding [GO:0005048]; aorta development [GO:0035904]; clathrin-dependent endocytosis [GO:0072583]; coronary vasculature development [GO:0060976]; intracellular protein transport [GO:0006886]; kidney development [GO:0001822]; postsynaptic neurotransmitter receptor internalization [GO:0098884]; synaptic vesicle endocytosis [GO:0048488]; ventricular septum development [GO:0003281]; vesicle-mediated transport [GO:0016192]	clathrin binding [GO:0030276]; signal sequence binding [GO:0005048]	GO:0001822; GO:0003281; GO:0005048; GO:0005829; GO:0005886; GO:0006886; GO:0009898; GO:0016020; GO:0016192; GO:0030122; GO:0030131; GO:0030276; GO:0030666; GO:0030669; GO:0035904; GO:0036020; GO:0045334; GO:0048488; GO:0060976; GO:0072583; GO:0098793; GO:0098794; GO:0098884; GO:0098978	AAMIWIVGEYAER	0.85762	14.0018	13.8113	13.3875	13.1508	13.2461	13.0261	13.8162	14.0228	14.0533	14.6968	14.5986	14.8216	13.6428	13.8346	13.7078
B4DFJ9	B4DFJ9_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 1		Homo sapiens (Human)	actin filament organization [GO:0007015]; neuron development [GO:0048666]; phosphorylation [GO:0016310]; plasma membrane tubulation [GO:0097320]	cytoplasmic vesicle membrane [GO:0030659]; cytosol [GO:0005829]; neuron projection [GO:0043005]; ruffle membrane [GO:0032587]; synapse [GO:0045202]	cytoplasmic vesicle membrane [GO:0030659]; cytosol [GO:0005829]; neuron projection [GO:0043005]; ruffle membrane [GO:0032587]; synapse [GO:0045202]; kinase activity [GO:0016301]; actin filament organization [GO:0007015]; neuron development [GO:0048666]; phosphorylation [GO:0016310]; plasma membrane tubulation [GO:0097320]	kinase activity [GO:0016301]	GO:0005829; GO:0007015; GO:0016301; GO:0016310; GO:0030659; GO:0032587; GO:0043005; GO:0045202; GO:0048666; GO:0097320	AEGVALTNATGAVESTSQAGDR	1.0225	14.4853	14.0514	13.3305	11.3169	13.1495	11.5065	14.42	12.7219	12.6949	15.0247	17.2955	17.2155	13.4423	13.5731	13.1595
Q6PI77	BHLH9_HUMAN	Protein BHLHb9 (bHLHb9) (Transcription regulator of 60 kDa) (p60TRP)	BHLHB9 KIAA1701	Homo sapiens (Human)	learning or memory [GO:0007611]; negative regulation of neuron apoptotic process [GO:0043524]; positive regulation of dendritic spine morphogenesis [GO:0061003]; positive regulation of neurogenesis [GO:0050769]; positive regulation of synapse assembly [GO:0051965]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; nucleus [GO:0005634]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; nucleus [GO:0005634]; protein homodimerization activity [GO:0042803]; learning or memory [GO:0007611]; negative regulation of neuron apoptotic process [GO:0043524]; positive regulation of dendritic spine morphogenesis [GO:0061003]; positive regulation of neurogenesis [GO:0050769]; positive regulation of synapse assembly [GO:0051965]	protein homodimerization activity [GO:0042803]	GO:0005634; GO:0005829; GO:0007611; GO:0042803; GO:0043524; GO:0050769; GO:0051965; GO:0061003; GO:0070062	AAIQAKAGAEREATGVVRPVAK	1.0113	13.6563	14.7918	14.0984	13.2512	13.2148	14.0458	13.8643	13.6621	13.6398	14.3852	13.8727	14.0125	13.4674	13.3828	13.8097
Q5U058	Q5U058_HUMAN	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43)	GAP43 hCG_2022854	Homo sapiens (Human)	astrocyte differentiation [GO:0048708]; axon choice point recognition [GO:0016198]; cell fate commitment [GO:0045165]; radial glial cell differentiation [GO:0060019]; regulation of growth [GO:0040008]; regulation of postsynaptic specialization assembly [GO:0099150]; tissue regeneration [GO:0042246]	anchoring junction [GO:0070161]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; filopodium membrane [GO:0031527]; GABA-ergic synapse [GO:0098982]; growth cone membrane [GO:0032584]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]	anchoring junction [GO:0070161]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; filopodium membrane [GO:0031527]; GABA-ergic synapse [GO:0098982]; growth cone membrane [GO:0032584]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; calmodulin binding [GO:0005516]; lysophosphatidic acid binding [GO:0035727]; phosphatidylinositol phosphate binding [GO:1901981]; phosphatidylserine binding [GO:0001786]; astrocyte differentiation [GO:0048708]; axon choice point recognition [GO:0016198]; cell fate commitment [GO:0045165]; radial glial cell differentiation [GO:0060019]; regulation of growth [GO:0040008]; regulation of postsynaptic specialization assembly [GO:0099150]; tissue regeneration [GO:0042246]	calmodulin binding [GO:0005516]; lysophosphatidic acid binding [GO:0035727]; phosphatidylinositol phosphate binding [GO:1901981]; phosphatidylserine binding [GO:0001786]	GO:0001786; GO:0005516; GO:0005737; GO:0005886; GO:0014069; GO:0016198; GO:0030425; GO:0031527; GO:0032584; GO:0035727; GO:0040008; GO:0042246; GO:0043204; GO:0045165; GO:0048708; GO:0060019; GO:0070161; GO:0098982; GO:0099150; GO:1901981	AEDAPAK	0.24167	16.2088	14.6453	16.3968	13.3443	13.2623	14.0888	13.3449	11.2903	13.2391	13.7234	13.8224	13.787	14.8375	10.7333	14.3242
Q9HDB5	NRX3B_HUMAN	"Neurexin-3-beta (Neurexin III-beta) [Cleaved into: Neurexin-3-beta, soluble form; Neurexin-3-beta, C-terminal fragment (NRXN3-CTF)]"	NRXN3 KIAA0743	Homo sapiens (Human)	adult behavior [GO:0030534]; angiogenesis [GO:0001525]; learning [GO:0007612]; neuron cell-cell adhesion [GO:0007158]; signal transduction [GO:0007165]; social behavior [GO:0035176]; vocalization behavior [GO:0071625]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; cell adhesion molecule binding [GO:0050839]; neuroligin family protein binding [GO:0097109]; transmembrane signaling receptor activity [GO:0004888]; adult behavior [GO:0030534]; angiogenesis [GO:0001525]; learning [GO:0007612]; neuron cell-cell adhesion [GO:0007158]; signal transduction [GO:0007165]; social behavior [GO:0035176]; vocalization behavior [GO:0071625]	cell adhesion molecule binding [GO:0050839]; neuroligin family protein binding [GO:0097109]; transmembrane signaling receptor activity [GO:0004888]	GO:0001525; GO:0004888; GO:0005886; GO:0007158; GO:0007165; GO:0007612; GO:0016021; GO:0030534; GO:0035176; GO:0050839; GO:0071625; GO:0097109	AHAPKWESK	1.0126	11.2622	10.7514	17.2829	12.01	13.528	12.1142	14.0056	14.396	17.047	17.714	15.0501	13.0995	12.9183	12.8718	12.8327
Q7KZI7	MARK2_HUMAN	Serine/threonine-protein kinase MARK2 (EC 2.7.11.1) (EC 2.7.11.26) (ELKL motif kinase 1) (EMK-1) (MAP/microtubule affinity-regulating kinase 2) (PAR1 homolog) (PAR1 homolog b) (Par-1b) (Par1b)	MARK2 EMK1	Homo sapiens (Human)	activation of protein kinase activity [GO:0032147]; autophagy of mitochondrion [GO:0000422]; axon development [GO:0061564]; establishment of cell polarity [GO:0030010]; establishment or maintenance of cell polarity regulating cell shape [GO:0071963]; establishment or maintenance of epithelial cell apical/basal polarity [GO:0045197]; intracellular signal transduction [GO:0035556]; microtubule cytoskeleton organization [GO:0000226]; mitochondrion localization [GO:0051646]; neuron migration [GO:0001764]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of neuron projection development [GO:0010976]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of axonogenesis [GO:0050770]; regulation of cytoskeleton organization [GO:0051493]; regulation of microtubule binding [GO:1904526]; regulation of microtubule cytoskeleton organization [GO:0070507]; Wnt signaling pathway [GO:0016055]	actin filament [GO:0005884]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; lateral plasma membrane [GO:0016328]; membrane [GO:0016020]; microtubule bundle [GO:0097427]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]	actin filament [GO:0005884]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; lateral plasma membrane [GO:0016328]; membrane [GO:0016020]; microtubule bundle [GO:0097427]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; cadherin binding [GO:0045296]; lipid binding [GO:0008289]; magnesium ion binding [GO:0000287]; protein kinase activator activity [GO:0030295]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; RNA binding [GO:0003723]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]; activation of protein kinase activity [GO:0032147]; autophagy of mitochondrion [GO:0000422]; axon development [GO:0061564]; establishment of cell polarity [GO:0030010]; establishment or maintenance of cell polarity regulating cell shape [GO:0071963]; establishment or maintenance of epithelial cell apical/basal polarity [GO:0045197]; intracellular signal transduction [GO:0035556]; microtubule cytoskeleton organization [GO:0000226]; mitochondrion localization [GO:0051646]; neuron migration [GO:0001764]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of neuron projection development [GO:0010976]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of axonogenesis [GO:0050770]; regulation of cytoskeleton organization [GO:0051493]; regulation of microtubule binding [GO:1904526]; regulation of microtubule cytoskeleton organization [GO:0070507]; Wnt signaling pathway [GO:0016055]	ATP binding [GO:0005524]; cadherin binding [GO:0045296]; lipid binding [GO:0008289]; magnesium ion binding [GO:0000287]; protein kinase activator activity [GO:0030295]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; RNA binding [GO:0003723]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]	GO:0000226; GO:0000287; GO:0000422; GO:0001764; GO:0003723; GO:0004674; GO:0005524; GO:0005654; GO:0005737; GO:0005739; GO:0005884; GO:0005886; GO:0006468; GO:0008289; GO:0010976; GO:0016020; GO:0016055; GO:0016328; GO:0018105; GO:0018107; GO:0030010; GO:0030295; GO:0030425; GO:0032147; GO:0035556; GO:0045197; GO:0045296; GO:0046777; GO:0048156; GO:0050321; GO:0050770; GO:0051493; GO:0051646; GO:0061564; GO:0070507; GO:0071963; GO:0097427; GO:0106310; GO:1904526	AENLLLDADMNIK	1.0118	15.4552	13.628	13.491	12.417	10.6321	12.3468	14.1061	12.9674	14.6325	15.384	14.8087	13.4021	14.9139	13.8478	14.5439
P49841	GSK3B_HUMAN	Glycogen synthase kinase-3 beta (GSK-3 beta) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3B) (EC 2.7.11.1)	GSK3B	Homo sapiens (Human)	beta-catenin destruction complex disassembly [GO:1904886]; cellular response to amyloid-beta [GO:1904646]; cellular response to interleukin-3 [GO:0036016]; cellular response to retinoic acid [GO:0071300]; circadian rhythm [GO:0007623]; dopamine receptor signaling pathway [GO:0007212]; epithelial to mesenchymal transition [GO:0001837]; ER overload response [GO:0006983]; establishment of cell polarity [GO:0030010]; excitatory postsynaptic potential [GO:0060079]; extrinsic apoptotic signaling pathway [GO:0097191]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; glycogen metabolic process [GO:0005977]; hippocampus development [GO:0021766]; insulin receptor signaling pathway [GO:0008286]; intracellular signal transduction [GO:0035556]; maintenance of cell polarity [GO:0030011]; negative regulation of apoptotic process [GO:0043066]; negative regulation of calcineurin-NFAT signaling cascade [GO:0070885]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of canonical Wnt signaling pathway involved in osteoblast differentiation [GO:1905240]; negative regulation of dopaminergic neuron differentiation [GO:1904339]; negative regulation of extrinsic apoptotic signaling pathway via death domain receptors [GO:1902042]; negative regulation of gene expression [GO:0010629]; negative regulation of glycogen (starch) synthase activity [GO:2000466]; negative regulation of glycogen biosynthetic process [GO:0045719]; negative regulation of mesenchymal stem cell differentiation [GO:2000740]; negative regulation of neuron death [GO:1901215]; negative regulation of phosphoprotein phosphatase activity [GO:0032515]; negative regulation of protein acetylation [GO:1901984]; negative regulation of protein binding [GO:0032091]; negative regulation of protein localization to nucleus [GO:1900181]; negative regulation of protein-containing complex assembly [GO:0031333]; negative regulation of type B pancreatic cell development [GO:2000077]; neuron projection development [GO:0031175]; neuron projection organization [GO:0106027]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of autophagy [GO:0010508]; positive regulation of cell differentiation [GO:0045597]; positive regulation of cell-matrix adhesion [GO:0001954]; positive regulation of cilium assembly [GO:0045724]; positive regulation of gene expression [GO:0010628]; positive regulation of GTPase activity [GO:0043547]; positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [GO:1901030]; positive regulation of mitochondrion organization [GO:0010822]; positive regulation of neuron death [GO:1901216]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein binding [GO:0032092]; positive regulation of protein catabolic process [GO:0045732]; positive regulation of protein export from nucleus [GO:0046827]; positive regulation of protein localization to centrosome [GO:1904781]; positive regulation of protein localization to cilium [GO:1903566]; positive regulation of protein-containing complex assembly [GO:0031334]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of axon extension [GO:0030516]; regulation of axonogenesis [GO:0050770]; regulation of cellular response to heat [GO:1900034]; regulation of circadian rhythm [GO:0042752]; regulation of dendrite morphogenesis [GO:0048814]; regulation of long-term synaptic potentiation [GO:1900271]; regulation of microtubule anchoring at centrosome [GO:0150101]; regulation of microtubule cytoskeleton organization [GO:0070507]; regulation of microtubule-based process [GO:0032886]; regulation of neuron projection development [GO:0010975]; regulation of protein export from nucleus [GO:0046825]; regulation of synaptic vesicle exocytosis [GO:2000300]; signal transduction [GO:0007165]; superior temporal gyrus development [GO:0071109]; viral protein processing [GO:0019082]	axon [GO:0030424]; beta-catenin destruction complex [GO:0030877]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; glutamatergic synapse [GO:0098978]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; Wnt signalosome [GO:1990909]	axon [GO:0030424]; beta-catenin destruction complex [GO:0030877]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; glutamatergic synapse [GO:0098978]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; Wnt signalosome [GO:1990909]; ATP binding [GO:0005524]; beta-catenin binding [GO:0008013]; dynactin binding [GO:0034452]; kinase activity [GO:0016301]; NF-kappaB binding [GO:0051059]; p53 binding [GO:0002039]; protease binding [GO:0002020]; protein kinase A catalytic subunit binding [GO:0034236]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]; ubiquitin protein ligase binding [GO:0031625]; beta-catenin destruction complex disassembly [GO:1904886]; cellular response to amyloid-beta [GO:1904646]; cellular response to interleukin-3 [GO:0036016]; cellular response to retinoic acid [GO:0071300]; circadian rhythm [GO:0007623]; dopamine receptor signaling pathway [GO:0007212]; epithelial to mesenchymal transition [GO:0001837]; ER overload response [GO:0006983]; establishment of cell polarity [GO:0030010]; excitatory postsynaptic potential [GO:0060079]; extrinsic apoptotic signaling pathway [GO:0097191]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; glycogen metabolic process [GO:0005977]; hippocampus development [GO:0021766]; insulin receptor signaling pathway [GO:0008286]; intracellular signal transduction [GO:0035556]; maintenance of cell polarity [GO:0030011]; negative regulation of apoptotic process [GO:0043066]; negative regulation of calcineurin-NFAT signaling cascade [GO:0070885]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of canonical Wnt signaling pathway involved in osteoblast differentiation [GO:1905240]; negative regulation of dopaminergic neuron differentiation [GO:1904339]; negative regulation of extrinsic apoptotic signaling pathway via death domain receptors [GO:1902042]; negative regulation of gene expression [GO:0010629]; negative regulation of glycogen (starch) synthase activity [GO:2000466]; negative regulation of glycogen biosynthetic process [GO:0045719]; negative regulation of mesenchymal stem cell differentiation [GO:2000740]; negative regulation of neuron death [GO:1901215]; negative regulation of phosphoprotein phosphatase activity [GO:0032515]; negative regulation of protein acetylation [GO:1901984]; negative regulation of protein binding [GO:0032091]; negative regulation of protein localization to nucleus [GO:1900181]; negative regulation of protein-containing complex assembly [GO:0031333]; negative regulation of type B pancreatic cell development [GO:2000077]; neuron projection development [GO:0031175]; neuron projection organization [GO:0106027]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of autophagy [GO:0010508]; positive regulation of cell differentiation [GO:0045597]; positive regulation of cell-matrix adhesion [GO:0001954]; positive regulation of cilium assembly [GO:0045724]; positive regulation of gene expression [GO:0010628]; positive regulation of GTPase activity [GO:0043547]; positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [GO:1901030]; positive regulation of mitochondrion organization [GO:0010822]; positive regulation of neuron death [GO:1901216]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein binding [GO:0032092]; positive regulation of protein catabolic process [GO:0045732]; positive regulation of protein export from nucleus [GO:0046827]; positive regulation of protein localization to centrosome [GO:1904781]; positive regulation of protein localization to cilium [GO:1903566]; positive regulation of protein-containing complex assembly [GO:0031334]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of axon extension [GO:0030516]; regulation of axonogenesis [GO:0050770]; regulation of cellular response to heat [GO:1900034]; regulation of circadian rhythm [GO:0042752]; regulation of dendrite morphogenesis [GO:0048814]; regulation of long-term synaptic potentiation [GO:1900271]; regulation of microtubule anchoring at centrosome [GO:0150101]; regulation of microtubule cytoskeleton organization [GO:0070507]; regulation of microtubule-based process [GO:0032886]; regulation of neuron projection development [GO:0010975]; regulation of protein export from nucleus [GO:0046825]; regulation of synaptic vesicle exocytosis [GO:2000300]; signal transduction [GO:0007165]; superior temporal gyrus development [GO:0071109]; viral protein processing [GO:0019082]	ATP binding [GO:0005524]; beta-catenin binding [GO:0008013]; dynactin binding [GO:0034452]; kinase activity [GO:0016301]; NF-kappaB binding [GO:0051059]; p53 binding [GO:0002039]; protease binding [GO:0002020]; protein kinase A catalytic subunit binding [GO:0034236]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]; ubiquitin protein ligase binding [GO:0031625]	GO:0001837; GO:0001954; GO:0002020; GO:0002039; GO:0004672; GO:0004674; GO:0005524; GO:0005634; GO:0005654; GO:0005737; GO:0005739; GO:0005813; GO:0005829; GO:0005886; GO:0005977; GO:0006468; GO:0006983; GO:0007165; GO:0007212; GO:0007623; GO:0008013; GO:0008286; GO:0010508; GO:0010628; GO:0010629; GO:0010822; GO:0010975; GO:0016301; GO:0018105; GO:0018107; GO:0019082; GO:0019901; GO:0021766; GO:0030010; GO:0030011; GO:0030424; GO:0030425; GO:0030516; GO:0030877; GO:0031175; GO:0031333; GO:0031334; GO:0031625; GO:0032091; GO:0032092; GO:0032436; GO:0032515; GO:0032886; GO:0034236; GO:0034452; GO:0035556; GO:0036016; GO:0042752; GO:0043066; GO:0043161; GO:0043547; GO:0045597; GO:0045719; GO:0045724; GO:0045732; GO:0046777; GO:0046825; GO:0046827; GO:0048156; GO:0048814; GO:0050321; GO:0050770; GO:0051059; GO:0060079; GO:0061629; GO:0070507; GO:0070885; GO:0071109; GO:0071300; GO:0090090; GO:0097191; GO:0097192; GO:0098794; GO:0098978; GO:0106027; GO:0106310; GO:0150101; GO:1900034; GO:1900181; GO:1900271; GO:1901030; GO:1901215; GO:1901216; GO:1901984; GO:1902042; GO:1903566; GO:1904339; GO:1904646; GO:1904781; GO:1904886; GO:1905240; GO:1990909; GO:2000077; GO:2000300; GO:2000466; GO:2000740	AHPWTKVFRPR	0.9515	13.2632	9.0222	13.3607	12.9039	13.7003	13.0015	12.5036	14.3927	13.4107	14.3817	18.6342	14.0287	14.8494	14.1347	14.8361
B4DFG0	B4DFG0_HUMAN	"Protein DEK (cDNA FLJ53031, highly similar to Protein DEK)"	DEK	Homo sapiens (Human)	chromatin organization [GO:0006325]	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; chromatin organization [GO:0006325]	DNA binding [GO:0003677]	GO:0003677; GO:0005634; GO:0006325	ADSSTTK	1.0208	14.2481	12.824	14.5731	10.9376	13.9035	11.0492	14.751	14.104	13.7207	14.1383	14.7639	13.3259	14.3176	14.3765	15.1974
B4DFH4	B4DFH4_HUMAN	"cDNA FLJ51815, highly similar to Homo sapiens casein kinase 1, alpha 1 (CSNK1A1), transcript variant 1, mRNA"		Homo sapiens (Human)	protein phosphorylation [GO:0006468]		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein phosphorylation [GO:0006468]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	GO:0004672; GO:0005524; GO:0006468	AAQQAASSSGQGQQAQTPTGF	0.97768	14.6932	10.2616	14.6384	10.3048	13.4337	11.3763	10.24	15.3606	14.9027	15.6965	15.0212	15.1481	14.5443	14.7003	14.5889
Q86X27	RGPS2_HUMAN	Ras-specific guanine nucleotide-releasing factor RalGPS2 (Ral GEF with PH domain and SH3-binding motif 2) (RalA exchange factor RalGPS2)	RALGPS2	Homo sapiens (Human)	positive regulation of GTPase activity [GO:0043547]; Ras protein signal transduction [GO:0007265]; regulation of Ral protein signal transduction [GO:0032485]	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]; guanyl-nucleotide exchange factor activity [GO:0005085]; positive regulation of GTPase activity [GO:0043547]; Ras protein signal transduction [GO:0007265]; regulation of Ral protein signal transduction [GO:0032485]	guanyl-nucleotide exchange factor activity [GO:0005085]	GO:0005085; GO:0005737; GO:0005886; GO:0007265; GO:0032485; GO:0043547	AIQPDELSSCGWNK	1.0066	14.9193	14.9481	14.1334	12.3945	9.24356	11.0121	14.1758	14.1376	14.6502	15.7275	15.8396	15.5049	11.8927	13.2126	12.8834
P10636	TAU_HUMAN	Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)	MAPT MAPTL MTBT1 TAU	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; amyloid fibril formation [GO:1990000]; astrocyte activation [GO:0048143]; axon development [GO:0061564]; axonal transport [GO:0098930]; axonal transport of mitochondrion [GO:0019896]; cell-cell signaling [GO:0007267]; cellular response to brain-derived neurotrophic factor stimulus [GO:1990416]; cellular response to heat [GO:0034605]; cellular response to nerve growth factor stimulus [GO:1990090]; cellular response to reactive oxygen species [GO:0034614]; central nervous system neuron development [GO:0021954]; cytoplasmic microtubule organization [GO:0031122]; generation of neurons [GO:0048699]; internal protein amino acid acetylation [GO:0006475]; intracellular distribution of mitochondria [GO:0048312]; learning or memory [GO:0007611]; memory [GO:0007613]; microglial cell activation [GO:0001774]; microtubule cytoskeleton organization [GO:0000226]; microtubule polymerization [GO:0046785]; negative regulation of establishment of protein localization to mitochondrion [GO:1903748]; negative regulation of gene expression [GO:0010629]; negative regulation of kinase activity [GO:0033673]; negative regulation of mitochondrial fission [GO:0090258]; negative regulation of mitochondrial membrane potential [GO:0010917]; negative regulation of tubulin deacetylation [GO:1904428]; neurofibrillary tangle assembly [GO:1902988]; neuron projection development [GO:0031175]; plus-end-directed organelle transport along microtubule [GO:0072386]; positive regulation of axon extension [GO:0045773]; positive regulation of diacylglycerol kinase activity [GO:1905689]; positive regulation of microtubule polymerization [GO:0031116]; positive regulation of neuron death [GO:1901216]; positive regulation of protein localization [GO:1903829]; positive regulation of protein localization to synapse [GO:1902474]; positive regulation of superoxide anion generation [GO:0032930]; protein homooligomerization [GO:0051260]; protein polymerization [GO:0051258]; regulation of autophagy [GO:0010506]; regulation of calcium-mediated signaling [GO:0050848]; regulation of cellular response to heat [GO:1900034]; regulation of chromosome organization [GO:0033044]; regulation of long-term synaptic depression [GO:1900452]; regulation of microtubule cytoskeleton organization [GO:0070507]; regulation of microtubule polymerization [GO:0031113]; regulation of microtubule polymerization or depolymerization [GO:0031110]; regulation of mitochondrial fission [GO:0090140]; regulation of response to DNA damage stimulus [GO:2001020]; regulation of synaptic plasticity [GO:0048167]; response to lead ion [GO:0010288]; rRNA metabolic process [GO:0016072]; stress granule assembly [GO:0034063]; supramolecular fiber organization [GO:0097435]; synapse assembly [GO:0007416]; synapse organization [GO:0050808]	axolemma [GO:0030673]; axon [GO:0030424]; axon cytoplasm [GO:1904115]; cell body [GO:0044297]; cytoplasm [GO:0005737]; cytoplasmic ribonucleoprotein granule [GO:0036464]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendritic spine [GO:0043197]; extracellular region [GO:0005576]; glial cell projection [GO:0097386]; growth cone [GO:0030426]; main axon [GO:0044304]; membrane raft [GO:0045121]; microtubule [GO:0005874]; microtubule cytoskeleton [GO:0015630]; mitochondrion [GO:0005739]; neurofibrillary tangle [GO:0097418]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; nuclear periphery [GO:0034399]; nuclear speck [GO:0016607]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; somatodendritic compartment [GO:0036477]; tubulin complex [GO:0045298]	axolemma [GO:0030673]; axon [GO:0030424]; axon cytoplasm [GO:1904115]; cell body [GO:0044297]; cytoplasm [GO:0005737]; cytoplasmic ribonucleoprotein granule [GO:0036464]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendritic spine [GO:0043197]; extracellular region [GO:0005576]; glial cell projection [GO:0097386]; growth cone [GO:0030426]; main axon [GO:0044304]; membrane raft [GO:0045121]; microtubule [GO:0005874]; microtubule cytoskeleton [GO:0015630]; mitochondrion [GO:0005739]; neurofibrillary tangle [GO:0097418]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; nuclear periphery [GO:0034399]; nuclear speck [GO:0016607]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; somatodendritic compartment [GO:0036477]; tubulin complex [GO:0045298]; actin binding [GO:0003779]; apolipoprotein binding [GO:0034185]; chaperone binding [GO:0051087]; DNA binding [GO:0003677]; double-stranded DNA binding [GO:0003690]; dynactin binding [GO:0034452]; enzyme binding [GO:0019899]; histone-dependent DNA binding [GO:0099077]; Hsp90 protein binding [GO:0051879]; identical protein binding [GO:0042802]; lipoprotein particle binding [GO:0071813]; microtubule binding [GO:0008017]; microtubule lateral binding [GO:0099609]; minor groove of adenine-thymine-rich DNA binding [GO:0003680]; phosphatidylinositol binding [GO:0035091]; phosphatidylinositol bisphosphate binding [GO:1902936]; protein kinase binding [GO:0019901]; protein phosphatase 2A binding [GO:0051721]; protein-macromolecule adaptor activity [GO:0030674]; RNA binding [GO:0003723]; sequence-specific DNA binding [GO:0043565]; SH3 domain binding [GO:0017124]; single-stranded DNA binding [GO:0003697]; activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; amyloid fibril formation [GO:1990000]; astrocyte activation [GO:0048143]; axon development [GO:0061564]; axonal transport [GO:0098930]; axonal transport of mitochondrion [GO:0019896]; cell-cell signaling [GO:0007267]; cellular response to brain-derived neurotrophic factor stimulus [GO:1990416]; cellular response to heat [GO:0034605]; cellular response to nerve growth factor stimulus [GO:1990090]; cellular response to reactive oxygen species [GO:0034614]; central nervous system neuron development [GO:0021954]; cytoplasmic microtubule organization [GO:0031122]; generation of neurons [GO:0048699]; internal protein amino acid acetylation [GO:0006475]; intracellular distribution of mitochondria [GO:0048312]; learning or memory [GO:0007611]; memory [GO:0007613]; microglial cell activation [GO:0001774]; microtubule cytoskeleton organization [GO:0000226]; microtubule polymerization [GO:0046785]; negative regulation of establishment of protein localization to mitochondrion [GO:1903748]; negative regulation of gene expression [GO:0010629]; negative regulation of kinase activity [GO:0033673]; negative regulation of mitochondrial fission [GO:0090258]; negative regulation of mitochondrial membrane potential [GO:0010917]; negative regulation of tubulin deacetylation [GO:1904428]; neurofibrillary tangle assembly [GO:1902988]; neuron projection development [GO:0031175]; plus-end-directed organelle transport along microtubule [GO:0072386]; positive regulation of axon extension [GO:0045773]; positive regulation of diacylglycerol kinase activity [GO:1905689]; positive regulation of microtubule polymerization [GO:0031116]; positive regulation of neuron death [GO:1901216]; positive regulation of protein localization [GO:1903829]; positive regulation of protein localization to synapse [GO:1902474]; positive regulation of superoxide anion generation [GO:0032930]; protein homooligomerization [GO:0051260]; protein polymerization [GO:0051258]; regulation of autophagy [GO:0010506]; regulation of calcium-mediated signaling [GO:0050848]; regulation of cellular response to heat [GO:1900034]; regulation of chromosome organization [GO:0033044]; regulation of long-term synaptic depression [GO:1900452]; regulation of microtubule cytoskeleton organization [GO:0070507]; regulation of microtubule polymerization [GO:0031113]; regulation of microtubule polymerization or depolymerization [GO:0031110]; regulation of mitochondrial fission [GO:0090140]; regulation of response to DNA damage stimulus [GO:2001020]; regulation of synaptic plasticity [GO:0048167]; response to lead ion [GO:0010288]; rRNA metabolic process [GO:0016072]; stress granule assembly [GO:0034063]; supramolecular fiber organization [GO:0097435]; synapse assembly [GO:0007416]; synapse organization [GO:0050808]	actin binding [GO:0003779]; apolipoprotein binding [GO:0034185]; chaperone binding [GO:0051087]; DNA binding [GO:0003677]; double-stranded DNA binding [GO:0003690]; dynactin binding [GO:0034452]; enzyme binding [GO:0019899]; histone-dependent DNA binding [GO:0099077]; Hsp90 protein binding [GO:0051879]; identical protein binding [GO:0042802]; lipoprotein particle binding [GO:0071813]; microtubule binding [GO:0008017]; microtubule lateral binding [GO:0099609]; minor groove of adenine-thymine-rich DNA binding [GO:0003680]; phosphatidylinositol binding [GO:0035091]; phosphatidylinositol bisphosphate binding [GO:1902936]; protein kinase binding [GO:0019901]; protein phosphatase 2A binding [GO:0051721]; protein-macromolecule adaptor activity [GO:0030674]; RNA binding [GO:0003723]; sequence-specific DNA binding [GO:0043565]; SH3 domain binding [GO:0017124]; single-stranded DNA binding [GO:0003697]	GO:0000226; GO:0001774; GO:0003677; GO:0003680; GO:0003690; GO:0003697; GO:0003723; GO:0003779; GO:0005576; GO:0005634; GO:0005737; GO:0005739; GO:0005829; GO:0005874; GO:0005886; GO:0006475; GO:0006919; GO:0007267; GO:0007416; GO:0007611; GO:0007613; GO:0008017; GO:0010288; GO:0010506; GO:0010629; GO:0010917; GO:0015630; GO:0016072; GO:0016607; GO:0017124; GO:0019896; GO:0019899; GO:0019901; GO:0021954; GO:0030424; GO:0030425; GO:0030426; GO:0030673; GO:0030674; GO:0031110; GO:0031113; GO:0031116; GO:0031122; GO:0031175; GO:0032930; GO:0033044; GO:0033673; GO:0034063; GO:0034185; GO:0034399; GO:0034452; GO:0034605; GO:0034614; GO:0035091; GO:0036464; GO:0036477; GO:0042802; GO:0043005; GO:0043025; GO:0043197; GO:0043565; GO:0044297; GO:0044304; GO:0045121; GO:0045298; GO:0045773; GO:0046785; GO:0048143; GO:0048167; GO:0048312; GO:0048699; GO:0050808; GO:0050848; GO:0051087; GO:0051258; GO:0051260; GO:0051721; GO:0051879; GO:0061564; GO:0070507; GO:0071813; GO:0072386; GO:0090140; GO:0090258; GO:0097386; GO:0097418; GO:0097435; GO:0098930; GO:0099077; GO:0099609; GO:1900034; GO:1900452; GO:1901216; GO:1902474; GO:1902936; GO:1902988; GO:1903748; GO:1903829; GO:1904115; GO:1904428; GO:1905689; GO:1990000; GO:1990090; GO:1990416; GO:2001020	AEPRQEFEVMEDHAGTYGLGDR	1.0032	13.5027	14.216	13.7481	12.4433	12.4844	13.1532	13.1842	14.3476	13.3228	13.4253	15.1122	14.523	13.6019	14.4615	12.9338
Q6FHU2	Q6FHU2_HUMAN	Phosphoglycerate mutase (EC 5.4.2.11) (EC 5.4.2.4)	PGAM1 HEL-S-35 hCG_2015269 hCG_25778	Homo sapiens (Human)	glycolytic process [GO:0006096]		bisphosphoglycerate mutase activity [GO:0004082]; hydrolase activity [GO:0016787]; phosphoglycerate mutase activity [GO:0004619]; glycolytic process [GO:0006096]	bisphosphoglycerate mutase activity [GO:0004082]; hydrolase activity [GO:0016787]; phosphoglycerate mutase activity [GO:0004619]	GO:0004082; GO:0004619; GO:0006096; GO:0016787	AAYKLVLIR	0.054348	13.0924	13.0458	14.4932	12.4058	12.2541	12.4142	13.8333	14.7097	14.3971	14.8026	14.9725	14.1697	13.581	13.2617	12.7994
O94985	CSTN1_HUMAN	Calsyntenin-1 (Alcadein-alpha) (Alc-alpha) (Alzheimer-related cadherin-like protein) (Non-classical cadherin XB31alpha) [Cleaved into: Soluble Alc-alpha (SAlc-alpha); CTF1-alpha (C-terminal fragment 1-alpha)]	CLSTN1 CS1 KIAA0911	Homo sapiens (Human)	cell adhesion [GO:0007155]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; neurotransmitter receptor transport to postsynaptic membrane [GO:0098969]; positive regulation of synapse assembly [GO:0051965]; positive regulation of synaptic transmission [GO:0050806]; regulation of cell growth [GO:0001558]; regulation of synapse maturation [GO:0090128]; vesicle-mediated transport in synapse [GO:0099003]	anchoring junction [GO:0070161]; cell surface [GO:0009986]; endoplasmic reticulum membrane [GO:0005789]; extracellular region [GO:0005576]; glutamatergic synapse [GO:0098978]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; neuron projection [GO:0043005]; nucleus [GO:0005634]; postsynaptic density [GO:0014069]; postsynaptic endosome [GO:0098845]; postsynaptic membrane [GO:0045211]	anchoring junction [GO:0070161]; cell surface [GO:0009986]; endoplasmic reticulum membrane [GO:0005789]; extracellular region [GO:0005576]; glutamatergic synapse [GO:0098978]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; neuron projection [GO:0043005]; nucleus [GO:0005634]; postsynaptic density [GO:0014069]; postsynaptic endosome [GO:0098845]; postsynaptic membrane [GO:0045211]; amyloid-beta binding [GO:0001540]; calcium ion binding [GO:0005509]; kinesin binding [GO:0019894]; X11-like protein binding [GO:0042988]; cell adhesion [GO:0007155]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; neurotransmitter receptor transport to postsynaptic membrane [GO:0098969]; positive regulation of synapse assembly [GO:0051965]; positive regulation of synaptic transmission [GO:0050806]; regulation of cell growth [GO:0001558]; regulation of synapse maturation [GO:0090128]; vesicle-mediated transport in synapse [GO:0099003]	amyloid-beta binding [GO:0001540]; calcium ion binding [GO:0005509]; kinesin binding [GO:0019894]; X11-like protein binding [GO:0042988]	GO:0000139; GO:0001540; GO:0001558; GO:0005509; GO:0005576; GO:0005634; GO:0005789; GO:0007155; GO:0007156; GO:0009986; GO:0014069; GO:0016021; GO:0019894; GO:0042988; GO:0043005; GO:0045211; GO:0050806; GO:0051965; GO:0070161; GO:0090128; GO:0098845; GO:0098969; GO:0098978; GO:0099003	AAHRRTMR	1.0209	13.8642	12.7298	12.8901	12.5189	12.3789	12.4385	13.748	13.9177	14.6333	13.7369	13.6818	14.6382	14.1443	14.1598	13.8361
Q92508	PIEZ1_HUMAN	Piezo-type mechanosensitive ion channel component 1 (Membrane protein induced by beta-amyloid treatment) (Mib) (Protein FAM38A)	PIEZO1 FAM38A KIAA0233	Homo sapiens (Human)	cation transport [GO:0006812]; cellular response to mechanical stimulus [GO:0071260]; detection of mechanical stimulus [GO:0050982]; positive regulation of cell-cell adhesion mediated by integrin [GO:0033634]; positive regulation of integrin activation [GO:0033625]; positive regulation of myotube differentiation [GO:0010831]; regulation of membrane potential [GO:0042391]	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; integral component of membrane [GO:0016021]; lamellipodium membrane [GO:0031258]; membrane [GO:0016020]; plasma membrane [GO:0005886]	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; integral component of membrane [GO:0016021]; lamellipodium membrane [GO:0031258]; membrane [GO:0016020]; plasma membrane [GO:0005886]; cation channel activity [GO:0005261]; mechanosensitive ion channel activity [GO:0008381]; cation transport [GO:0006812]; cellular response to mechanical stimulus [GO:0071260]; detection of mechanical stimulus [GO:0050982]; positive regulation of cell-cell adhesion mediated by integrin [GO:0033634]; positive regulation of integrin activation [GO:0033625]; positive regulation of myotube differentiation [GO:0010831]; regulation of membrane potential [GO:0042391]	cation channel activity [GO:0005261]; mechanosensitive ion channel activity [GO:0008381]	GO:0005261; GO:0005783; GO:0005789; GO:0005886; GO:0006812; GO:0008381; GO:0010831; GO:0016020; GO:0016021; GO:0031258; GO:0033116; GO:0033625; GO:0033634; GO:0042391; GO:0050982; GO:0071260	AERYLLTQELLQGGEVHR	1.0048	13.6601	13.6518	14.5166	11.9974	11.9692	11.7448	14.2229	13.7311	13.3569	14.3097	14.2832	13.6185	13.1775	14.1136	14.8564
P27448	MARK3_HUMAN	MAP/microtubule affinity-regulating kinase 3 (EC 2.7.11.1) (C-TAK1) (cTAK1) (Cdc25C-associated protein kinase 1) (ELKL motif kinase 2) (EMK-2) (Protein kinase STK10) (Ser/Thr protein kinase PAR-1) (Par-1a) (Serine/threonine-protein kinase p78)	MARK3 CTAK1 EMK2	Homo sapiens (Human)	intracellular signal transduction [GO:0035556]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of hippo signaling [GO:0035331]; peptidyl-serine autophosphorylation [GO:0036289]; peptidyl-serine phosphorylation [GO:0018105]; positive regulation of protein binding [GO:0032092]; protein phosphorylation [GO:0006468]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; extracellular exosome [GO:0070062]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; extracellular exosome [GO:0070062]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]; intracellular signal transduction [GO:0035556]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of hippo signaling [GO:0035331]; peptidyl-serine autophosphorylation [GO:0036289]; peptidyl-serine phosphorylation [GO:0018105]; positive regulation of protein binding [GO:0032092]; protein phosphorylation [GO:0006468]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]	GO:0000226; GO:0004674; GO:0005524; GO:0005737; GO:0005829; GO:0005886; GO:0006468; GO:0018105; GO:0030425; GO:0032092; GO:0035331; GO:0035556; GO:0036289; GO:0048156; GO:0050321; GO:0070062; GO:0106310	AENLLLDADMNIK	1.0109	11.2903	14.5696	14.7467	13.8593	9.7606	12.2581	14.28	13.3316	13.7435	14.9305	13.3987	15.1772	13.9099	13.6331	13.5371
P30307	MPIP3_HUMAN	M-phase inducer phosphatase 3 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25C)	CDC25C	Homo sapiens (Human)	cell division [GO:0051301]; cell population proliferation [GO:0008283]; G2/M transition of mitotic cell cycle [GO:0000086]; positive regulation of G2/M transition of mitotic cell cycle [GO:0010971]; positive regulation of G2/MI transition of meiotic cell cycle [GO:0110032]; protein dephosphorylation [GO:0006470]; regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]; regulation of mitotic nuclear division [GO:0007088]; spermatogenesis [GO:0007283]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; mitochondrial intermembrane space [GO:0005758]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; mitochondrial intermembrane space [GO:0005758]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; phosphoprotein phosphatase activity [GO:0004721]; protein kinase binding [GO:0019901]; protein tyrosine phosphatase activity [GO:0004725]; WW domain binding [GO:0050699]; cell division [GO:0051301]; cell population proliferation [GO:0008283]; G2/M transition of mitotic cell cycle [GO:0000086]; positive regulation of G2/M transition of mitotic cell cycle [GO:0010971]; positive regulation of G2/MI transition of meiotic cell cycle [GO:0110032]; protein dephosphorylation [GO:0006470]; regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]; regulation of mitotic nuclear division [GO:0007088]; spermatogenesis [GO:0007283]	phosphoprotein phosphatase activity [GO:0004721]; protein kinase binding [GO:0019901]; protein tyrosine phosphatase activity [GO:0004725]; WW domain binding [GO:0050699]	GO:0000079; GO:0000086; GO:0004721; GO:0004725; GO:0005634; GO:0005654; GO:0005737; GO:0005758; GO:0005829; GO:0006470; GO:0007088; GO:0007283; GO:0008283; GO:0010971; GO:0016607; GO:0019901; GO:0048471; GO:0050699; GO:0051301; GO:0110032	CRSQSKVQEGER	1.0097	15.4033	14.8601	13.0752	14.2861	12.5217	11.3184	11.7307	14.9894	11.9758	14.949	15.4351	12.6064	11.3813	16.0382	11.3385
Q6ZVD7	STOX1_HUMAN	Storkhead-box protein 1 (Winged-helix domain-containing protein)	STOX1 C10orf24	Homo sapiens (Human)	cell cycle [GO:0007049]; cell division [GO:0051301]; cellular response to nitrosative stress [GO:0071500]; inner ear development [GO:0048839]; negative regulation of gene expression [GO:0010629]; positive regulation of cyclin-dependent protein kinase activity [GO:1904031]; positive regulation of G1/S transition of mitotic cell cycle [GO:1900087]; positive regulation of G2/M transition of mitotic cell cycle [GO:0010971]; positive regulation of gene expression [GO:0010628]; positive regulation of otic vesicle morphogenesis [GO:1904120]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of peptidyl-threonine phosphorylation [GO:0010800]; positive regulation of protein kinase B signaling [GO:0051897]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of gene expression [GO:0010468]; regulation of mitochondrial DNA metabolic process [GO:1901858]; regulation of mitochondrial membrane potential [GO:0051881]; regulation of mitochondrion organization [GO:0010821]; regulation of response to oxidative stress [GO:1902882]; regulation of transcription from RNA polymerase II promoter in response to hypoxia [GO:0061418]	cell cortex [GO:0005938]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; fibrillar center [GO:0001650]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"cell cortex [GO:0005938]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; fibrillar center [GO:0001650]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; cell cycle [GO:0007049]; cell division [GO:0051301]; cellular response to nitrosative stress [GO:0071500]; inner ear development [GO:0048839]; negative regulation of gene expression [GO:0010629]; positive regulation of cyclin-dependent protein kinase activity [GO:1904031]; positive regulation of G1/S transition of mitotic cell cycle [GO:1900087]; positive regulation of G2/M transition of mitotic cell cycle [GO:0010971]; positive regulation of gene expression [GO:0010628]; positive regulation of otic vesicle morphogenesis [GO:1904120]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of peptidyl-threonine phosphorylation [GO:0010800]; positive regulation of protein kinase B signaling [GO:0051897]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of gene expression [GO:0010468]; regulation of mitochondrial DNA metabolic process [GO:1901858]; regulation of mitochondrial membrane potential [GO:0051881]; regulation of mitochondrion organization [GO:0010821]; regulation of response to oxidative stress [GO:1902882]; regulation of transcription from RNA polymerase II promoter in response to hypoxia [GO:0061418]"	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	GO:0000977; GO:0001228; GO:0001650; GO:0005634; GO:0005654; GO:0005737; GO:0005813; GO:0005829; GO:0005938; GO:0007049; GO:0010468; GO:0010628; GO:0010629; GO:0010800; GO:0010821; GO:0010971; GO:0033138; GO:0045944; GO:0048839; GO:0051301; GO:0051881; GO:0051897; GO:0061418; GO:0071500; GO:1900087; GO:1901858; GO:1902882; GO:1904031; GO:1904120	AAGAAEEPGGR	1.0065	13.8767	13.2713	13.1825	10.759	11.7982	11.6957	14.4708	18.4702	12.0695	14.3376	13.2112	13.0598	11.8517	11.9073	17.7814
P02787	TRFE_HUMAN	Serotransferrin (Transferrin) (Beta-1 metal-binding globulin) (Siderophilin)	TF PRO1400	Homo sapiens (Human)	actin filament organization [GO:0007015]; antibacterial humoral response [GO:0019731]; cellular iron ion homeostasis [GO:0006879]; cellular response to iron ion [GO:0071281]; ERK1 and ERK2 cascade [GO:0070371]; iron ion homeostasis [GO:0055072]; iron ion transport [GO:0006826]; osteoclast differentiation [GO:0030316]; positive regulation of bone resorption [GO:0045780]; positive regulation of cell motility [GO:2000147]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of phosphorylation [GO:0042327]; positive regulation of receptor-mediated endocytosis [GO:0048260]; regulation of iron ion transport [GO:0034756]; regulation of protein stability [GO:0031647]; retina homeostasis [GO:0001895]; SMAD protein signal transduction [GO:0060395]	apical plasma membrane [GO:0016324]; basal part of cell [GO:0045178]; basal plasma membrane [GO:0009925]; blood microparticle [GO:0072562]; cell surface [GO:0009986]; clathrin-coated endocytic vesicle membrane [GO:0030669]; clathrin-coated pit [GO:0005905]; cytoplasmic vesicle [GO:0031410]; early endosome [GO:0005769]; endocytic vesicle [GO:0030139]; endoplasmic reticulum lumen [GO:0005788]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; extrinsic component of external side of plasma membrane [GO:0031232]; HFE-transferrin receptor complex [GO:1990712]; late endosome [GO:0005770]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]; secretory granule lumen [GO:0034774]; vesicle [GO:0031982]	apical plasma membrane [GO:0016324]; basal part of cell [GO:0045178]; basal plasma membrane [GO:0009925]; blood microparticle [GO:0072562]; cell surface [GO:0009986]; clathrin-coated endocytic vesicle membrane [GO:0030669]; clathrin-coated pit [GO:0005905]; cytoplasmic vesicle [GO:0031410]; early endosome [GO:0005769]; endocytic vesicle [GO:0030139]; endoplasmic reticulum lumen [GO:0005788]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; extrinsic component of external side of plasma membrane [GO:0031232]; HFE-transferrin receptor complex [GO:1990712]; late endosome [GO:0005770]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]; secretory granule lumen [GO:0034774]; vesicle [GO:0031982]; ferric iron binding [GO:0008199]; ferrous iron binding [GO:0008198]; iron chaperone activity [GO:0034986]; transferrin receptor binding [GO:1990459]; actin filament organization [GO:0007015]; antibacterial humoral response [GO:0019731]; cellular iron ion homeostasis [GO:0006879]; cellular response to iron ion [GO:0071281]; ERK1 and ERK2 cascade [GO:0070371]; iron ion homeostasis [GO:0055072]; iron ion transport [GO:0006826]; osteoclast differentiation [GO:0030316]; positive regulation of bone resorption [GO:0045780]; positive regulation of cell motility [GO:2000147]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of phosphorylation [GO:0042327]; positive regulation of receptor-mediated endocytosis [GO:0048260]; regulation of iron ion transport [GO:0034756]; regulation of protein stability [GO:0031647]; retina homeostasis [GO:0001895]; SMAD protein signal transduction [GO:0060395]	ferric iron binding [GO:0008199]; ferrous iron binding [GO:0008198]; iron chaperone activity [GO:0034986]; transferrin receptor binding [GO:1990459]	GO:0001895; GO:0005576; GO:0005615; GO:0005769; GO:0005770; GO:0005788; GO:0005886; GO:0005905; GO:0006826; GO:0006879; GO:0007015; GO:0008198; GO:0008199; GO:0009925; GO:0009986; GO:0010008; GO:0016324; GO:0019731; GO:0030139; GO:0030316; GO:0030669; GO:0031232; GO:0031410; GO:0031647; GO:0031982; GO:0034756; GO:0034774; GO:0034986; GO:0042327; GO:0045178; GO:0045780; GO:0045893; GO:0048260; GO:0048471; GO:0055037; GO:0055072; GO:0060395; GO:0070062; GO:0070371; GO:0071281; GO:0072562; GO:1990459; GO:1990712; GO:2000147	ADRDQYELLCLDNTRKPVDEYK	0.99049	14.4286	13.9062	14.0135	9.33961	13.0364	12.8261	14.0355	14.07	13.4944	13.8627	14.1273	13.4893	14.7143	13.5297	12.6791
Q06481	APLP2_HUMAN	Amyloid beta precursor like protein 2 (APPH) (Amyloid beta (A4) precursor-like protein 2) (Amyloid protein homolog) (Amyloid-like protein 2) (APLP-2) (CDEI box-binding protein) (CDEBP) (Sperm membrane protein YWK-II)	APLP2 APPL2	Homo sapiens (Human)	axonogenesis [GO:0007409]; central nervous system development [GO:0007417]; G protein-coupled receptor signaling pathway [GO:0007186]; regulation of cellular protein metabolic process [GO:0032268]	endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; platelet alpha granule membrane [GO:0031092]	endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; platelet alpha granule membrane [GO:0031092]; DNA binding [GO:0003677]; heparin binding [GO:0008201]; identical protein binding [GO:0042802]; serine-type endopeptidase inhibitor activity [GO:0004867]; transition metal ion binding [GO:0046914]; axonogenesis [GO:0007409]; central nervous system development [GO:0007417]; G protein-coupled receptor signaling pathway [GO:0007186]; regulation of cellular protein metabolic process [GO:0032268]	DNA binding [GO:0003677]; heparin binding [GO:0008201]; identical protein binding [GO:0042802]; serine-type endopeptidase inhibitor activity [GO:0004867]; transition metal ion binding [GO:0046914]	GO:0003677; GO:0004867; GO:0005634; GO:0005788; GO:0005886; GO:0007186; GO:0007409; GO:0007417; GO:0008201; GO:0016020; GO:0016021; GO:0031092; GO:0032268; GO:0042802; GO:0046914; GO:0070062	AATGTAAAAATGR	1.0227	14.3433	14.3804	12.3504	12.484	12.4413	12.0427	14.1025	14.0816	14.099	13.6982	13.3076	12.6783	14.0751	14.2452	13.2228
P51693	APLP1_HUMAN	Amyloid beta precursor like protein 1 (Amyloid beta (A4) precursor-like protein 1) (Amyloid-like protein 1) (APLP) (APLP-1) [Cleaved into: C30]	APLP1	Homo sapiens (Human)	animal organ morphogenesis [GO:0009887]; apoptotic process [GO:0006915]; axonogenesis [GO:0007409]; cell adhesion [GO:0007155]; cellular response to norepinephrine stimulus [GO:0071874]; central nervous system development [GO:0007417]; endocytosis [GO:0006897]; extracellular matrix organization [GO:0030198]; forebrain development [GO:0030900]; mRNA polyadenylation [GO:0006378]; negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0106072]; nervous system development [GO:0007399]; regulation of translation [GO:0006417]	basement membrane [GO:0005604]; Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; nucleoplasm [GO:0005654]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]	basement membrane [GO:0005604]; Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; nucleoplasm [GO:0005654]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; alpha-2A adrenergic receptor binding [GO:0031694]; alpha-2B adrenergic receptor binding [GO:0031695]; alpha-2C adrenergic receptor binding [GO:0031696]; heparin binding [GO:0008201]; identical protein binding [GO:0042802]; transition metal ion binding [GO:0046914]; animal organ morphogenesis [GO:0009887]; apoptotic process [GO:0006915]; axonogenesis [GO:0007409]; cell adhesion [GO:0007155]; cellular response to norepinephrine stimulus [GO:0071874]; central nervous system development [GO:0007417]; endocytosis [GO:0006897]; extracellular matrix organization [GO:0030198]; forebrain development [GO:0030900]; mRNA polyadenylation [GO:0006378]; negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0106072]; nervous system development [GO:0007399]; regulation of translation [GO:0006417]	alpha-2A adrenergic receptor binding [GO:0031694]; alpha-2B adrenergic receptor binding [GO:0031695]; alpha-2C adrenergic receptor binding [GO:0031696]; heparin binding [GO:0008201]; identical protein binding [GO:0042802]; transition metal ion binding [GO:0046914]	GO:0005604; GO:0005654; GO:0005794; GO:0005886; GO:0006378; GO:0006417; GO:0006897; GO:0006915; GO:0007155; GO:0007399; GO:0007409; GO:0007417; GO:0008201; GO:0009887; GO:0016021; GO:0030198; GO:0030900; GO:0031694; GO:0031695; GO:0031696; GO:0042802; GO:0046914; GO:0048471; GO:0071874; GO:0106072	AEQKEQR	1.0108	13.9313	12.6568	12.208	12.6921	13.6055	13.4038	12.7797	12.9011	14.0121	13.6677	14.8545	13.8389	12.4659	14.3642	14.0613
Q9Y2A7	NCKP1_HUMAN	Nck-associated protein 1 (NAP 1) (Membrane-associated protein HEM-2) (p125Nap1)	NCKAP1 HEM2 KIAA0587 NAP1	Homo sapiens (Human)	apoptotic process [GO:0006915]; cell migration [GO:0016477]; cell morphogenesis [GO:0000902]; cell projection assembly [GO:0030031]; central nervous system development [GO:0007417]; cortical actin cytoskeleton organization [GO:0030866]; neuron projection morphogenesis [GO:0048812]; positive regulation of actin filament polymerization [GO:0030838]; positive regulation of Arp2/3 complex-mediated actin nucleation [GO:2000601]; positive regulation of lamellipodium assembly [GO:0010592]; Rac protein signal transduction [GO:0016601]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; filamentous actin [GO:0031941]; focal adhesion [GO:0005925]; integral component of membrane [GO:0016021]; lamellipodium [GO:0030027]; lamellipodium membrane [GO:0031258]; ruffle [GO:0001726]; SCAR complex [GO:0031209]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; filamentous actin [GO:0031941]; focal adhesion [GO:0005925]; integral component of membrane [GO:0016021]; lamellipodium [GO:0030027]; lamellipodium membrane [GO:0031258]; ruffle [GO:0001726]; SCAR complex [GO:0031209]; apoptotic process [GO:0006915]; cell migration [GO:0016477]; cell morphogenesis [GO:0000902]; cell projection assembly [GO:0030031]; central nervous system development [GO:0007417]; cortical actin cytoskeleton organization [GO:0030866]; neuron projection morphogenesis [GO:0048812]; positive regulation of actin filament polymerization [GO:0030838]; positive regulation of Arp2/3 complex-mediated actin nucleation [GO:2000601]; positive regulation of lamellipodium assembly [GO:0010592]; Rac protein signal transduction [GO:0016601]		GO:0000902; GO:0001726; GO:0005829; GO:0005925; GO:0006915; GO:0007417; GO:0010592; GO:0016021; GO:0016477; GO:0016601; GO:0030027; GO:0030031; GO:0030838; GO:0030866; GO:0031209; GO:0031258; GO:0031941; GO:0048812; GO:0070062; GO:2000601	AAEDLFVNIR	0.97059	13.8932	14.9108	13.7141	12.2216	13.4051	11.7404	12.4968	13.3004	12.9789	14.1012	13.2758	13.9005	12.7418	13.5948	14.989
B4DFJ1	B4DFJ1_HUMAN	"TERF1-interacting nuclear factor 2 (cDNA FLJ53728, highly similar to TERF1-interacting nuclear factor 2)"	TINF2	Homo sapiens (Human)	telomere capping [GO:0016233]	nuclear body [GO:0016604]; shelterin complex [GO:0070187]	nuclear body [GO:0016604]; shelterin complex [GO:0070187]; telomere capping [GO:0016233]		GO:0016233; GO:0016604; GO:0070187	AASTGKSK	0.99044	12.2742	14.9043	12.4829	13.8249	11.453	11.3998	14.1842	13.0873	14.9458	13.6512	12.3267	12.7051	14.4849	14.504	13.4047
P55290	CAD13_HUMAN	Cadherin-13 (Heart cadherin) (H-cadherin) (P105) (Truncated cadherin) (T-cad) (T-cadherin)	CDH13 CDHH	Homo sapiens (Human)	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules [GO:0016339]; cell-cell adhesion via plasma-membrane adhesion molecules [GO:0098742]; endothelial cell migration [GO:0043542]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; keratinocyte proliferation [GO:0043616]; lamellipodium assembly [GO:0030032]; localization within membrane [GO:0051668]; low-density lipoprotein particle mediated signaling [GO:0055096]; negative regulation of cell adhesion [GO:0007162]; negative regulation of cell population proliferation [GO:0008285]; positive regulation of calcium-mediated signaling [GO:0050850]; positive regulation of cell migration [GO:0030335]; positive regulation of cell-matrix adhesion [GO:0001954]; positive regulation of endothelial cell proliferation [GO:0001938]; positive regulation of positive chemotaxis [GO:0050927]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of transcription by RNA polymerase II [GO:0045944]; Rac protein signal transduction [GO:0016601]; regulation of endocytosis [GO:0030100]; regulation of epidermal growth factor receptor signaling pathway [GO:0042058]; Rho protein signal transduction [GO:0007266]; sprouting angiogenesis [GO:0002040]	anchored component of membrane [GO:0031225]; catenin complex [GO:0016342]; caveola [GO:0005901]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; focal adhesion [GO:0005925]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]	anchored component of membrane [GO:0031225]; catenin complex [GO:0016342]; caveola [GO:0005901]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; focal adhesion [GO:0005925]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]; adiponectin binding [GO:0055100]; cadherin binding [GO:0045296]; calcium ion binding [GO:0005509]; lipoprotein particle binding [GO:0071813]; low-density lipoprotein particle binding [GO:0030169]; protein homodimerization activity [GO:0042803]; calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules [GO:0016339]; cell-cell adhesion via plasma-membrane adhesion molecules [GO:0098742]; endothelial cell migration [GO:0043542]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; keratinocyte proliferation [GO:0043616]; lamellipodium assembly [GO:0030032]; localization within membrane [GO:0051668]; low-density lipoprotein particle mediated signaling [GO:0055096]; negative regulation of cell adhesion [GO:0007162]; negative regulation of cell population proliferation [GO:0008285]; positive regulation of calcium-mediated signaling [GO:0050850]; positive regulation of cell migration [GO:0030335]; positive regulation of cell-matrix adhesion [GO:0001954]; positive regulation of endothelial cell proliferation [GO:0001938]; positive regulation of positive chemotaxis [GO:0050927]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of transcription by RNA polymerase II [GO:0045944]; Rac protein signal transduction [GO:0016601]; regulation of endocytosis [GO:0030100]; regulation of epidermal growth factor receptor signaling pathway [GO:0042058]; Rho protein signal transduction [GO:0007266]; sprouting angiogenesis [GO:0002040]	adiponectin binding [GO:0055100]; cadherin binding [GO:0045296]; calcium ion binding [GO:0005509]; lipoprotein particle binding [GO:0071813]; low-density lipoprotein particle binding [GO:0030169]; protein homodimerization activity [GO:0042803]	GO:0001938; GO:0001954; GO:0002040; GO:0005509; GO:0005576; GO:0005615; GO:0005737; GO:0005886; GO:0005901; GO:0005925; GO:0007156; GO:0007162; GO:0007266; GO:0008285; GO:0009897; GO:0016339; GO:0016342; GO:0016601; GO:0030032; GO:0030100; GO:0030169; GO:0030335; GO:0031225; GO:0042058; GO:0042803; GO:0043005; GO:0043542; GO:0043616; GO:0045296; GO:0045944; GO:0048661; GO:0050850; GO:0050927; GO:0051668; GO:0055096; GO:0055100; GO:0062023; GO:0070062; GO:0071813; GO:0098742	DIQGSLQDIFKFAR	0.99149	13.3157	14.0818	14.277	11.5548	11.7773	11.1718	13.1266	13.3608	13.1953	13.7215	13.6514	13.7996	14.1793	13.4822	14.7945
Q8WXA9	SREK1_HUMAN	"Splicing regulatory glutamine/lysine-rich protein 1 (Serine/arginine-rich-splicing regulatory protein 86) (SRrp86) (Splicing factor, arginine/serine-rich 12) (Splicing regulatory protein 508) (SRrp508)"	SREK1 SFRS12 SRRP86	Homo sapiens (Human)	mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; spliceosomal complex [GO:0005681]	nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; spliceosomal complex [GO:0005681]; RNA binding [GO:0003723]; mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	RNA binding [GO:0003723]	GO:0003723; GO:0005654; GO:0005681; GO:0006397; GO:0008380; GO:0016607	ALAFNGVMFGDRPLK	1.0079	13.5498	13.9995	13.9514	12.6388	13.3127	12.6115	12.5526	13.1116	12.8637	13.7561	12.4108	13.9659	13.4273	13.4992	13.7688
O00499	BIN1_HUMAN	Myc box-dependent-interacting protein 1 (Amphiphysin II) (Amphiphysin-like protein) (Box-dependent myc-interacting protein 1) (Bridging integrator 1)	BIN1 AMPHL	Homo sapiens (Human)	cytoskeleton organization [GO:0007010]; endocytosis [GO:0006897]; endosome to lysosome transport [GO:0008333]; lipid tube assembly [GO:0060988]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902960]; negative regulation of calcium ion transmembrane transport via high voltage-gated calcium channel [GO:1904878]; negative regulation of potassium ion transmembrane transport [GO:1901380]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of ventricular cardiac muscle cell action potential [GO:1903946]; nucleus localization [GO:0051647]; nucleus organization [GO:0006997]; positive regulation of actin filament polymerization [GO:0030838]; positive regulation of apoptotic process [GO:0043065]; positive regulation of astrocyte differentiation [GO:0048711]; positive regulation of endocytosis [GO:0045807]; positive regulation of GTPase activity [GO:0043547]; regulation of cell cycle process [GO:0010564]; regulation of heart rate by cardiac conduction [GO:0086091]; regulation of neuron differentiation [GO:0045664]; synaptic vesicle endocytosis [GO:0048488]; T-tubule organization [GO:0033292]	actin cytoskeleton [GO:0015629]; axon [GO:0030424]; axon initial segment [GO:0043194]; axon terminus [GO:0043679]; cerebellar mossy fiber [GO:0044300]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; endosome [GO:0005768]; extrinsic component of synaptic vesicle membrane [GO:0098850]; glutamatergic synapse [GO:0098978]; I band [GO:0031674]; lipid tube [GO:0060987]; membrane [GO:0016020]; node of Ranvier [GO:0033268]; nuclear envelope [GO:0005635]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; RNA polymerase II transcription repressor complex [GO:0090571]; synaptic vesicle [GO:0008021]; T-tubule [GO:0030315]; varicosity [GO:0043196]; vesicle [GO:0031982]; Z disc [GO:0030018]	actin cytoskeleton [GO:0015629]; axon [GO:0030424]; axon initial segment [GO:0043194]; axon terminus [GO:0043679]; cerebellar mossy fiber [GO:0044300]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; endosome [GO:0005768]; extrinsic component of synaptic vesicle membrane [GO:0098850]; glutamatergic synapse [GO:0098978]; I band [GO:0031674]; lipid tube [GO:0060987]; membrane [GO:0016020]; node of Ranvier [GO:0033268]; nuclear envelope [GO:0005635]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; RNA polymerase II transcription repressor complex [GO:0090571]; synaptic vesicle [GO:0008021]; T-tubule [GO:0030315]; varicosity [GO:0043196]; vesicle [GO:0031982]; Z disc [GO:0030018]; actin filament binding [GO:0051015]; aspartic-type endopeptidase inhibitor activity [GO:0019828]; chaperone binding [GO:0051087]; clathrin binding [GO:0030276]; GTPase binding [GO:0051020]; identical protein binding [GO:0042802]; phospholipid binding [GO:0005543]; protease binding [GO:0002020]; RNA polymerase binding [GO:0070063]; tau protein binding [GO:0048156]; cytoskeleton organization [GO:0007010]; endocytosis [GO:0006897]; endosome to lysosome transport [GO:0008333]; lipid tube assembly [GO:0060988]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902960]; negative regulation of calcium ion transmembrane transport via high voltage-gated calcium channel [GO:1904878]; negative regulation of potassium ion transmembrane transport [GO:1901380]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of ventricular cardiac muscle cell action potential [GO:1903946]; nucleus localization [GO:0051647]; nucleus organization [GO:0006997]; positive regulation of actin filament polymerization [GO:0030838]; positive regulation of apoptotic process [GO:0043065]; positive regulation of astrocyte differentiation [GO:0048711]; positive regulation of endocytosis [GO:0045807]; positive regulation of GTPase activity [GO:0043547]; regulation of cell cycle process [GO:0010564]; regulation of heart rate by cardiac conduction [GO:0086091]; regulation of neuron differentiation [GO:0045664]; synaptic vesicle endocytosis [GO:0048488]; T-tubule organization [GO:0033292]	actin filament binding [GO:0051015]; aspartic-type endopeptidase inhibitor activity [GO:0019828]; chaperone binding [GO:0051087]; clathrin binding [GO:0030276]; GTPase binding [GO:0051020]; identical protein binding [GO:0042802]; phospholipid binding [GO:0005543]; protease binding [GO:0002020]; RNA polymerase binding [GO:0070063]; tau protein binding [GO:0048156]	GO:0000122; GO:0002020; GO:0005543; GO:0005634; GO:0005635; GO:0005737; GO:0005768; GO:0005829; GO:0005886; GO:0006897; GO:0006997; GO:0007010; GO:0008021; GO:0008333; GO:0010564; GO:0015629; GO:0016020; GO:0019828; GO:0030018; GO:0030276; GO:0030315; GO:0030424; GO:0030425; GO:0030838; GO:0031674; GO:0031982; GO:0033268; GO:0033292; GO:0042802; GO:0043065; GO:0043194; GO:0043196; GO:0043547; GO:0043679; GO:0044300; GO:0045664; GO:0045807; GO:0048156; GO:0048488; GO:0048711; GO:0051015; GO:0051020; GO:0051087; GO:0051647; GO:0060987; GO:0060988; GO:0070063; GO:0086091; GO:0090571; GO:0098850; GO:0098978; GO:1901380; GO:1902430; GO:1902960; GO:1903946; GO:1904878	AAPQWCQGK	1.0081	14.2926	13.1851	13.9617	10.3178	11.4139	11.8531	13.2907	14.0142	13.1596	14.2082	13.83	14.7868	13.5518	13.3994	13.6642
Q13492	PICAL_HUMAN	Phosphatidylinositol-binding clathrin assembly protein (Clathrin assembly lymphoid myeloid leukemia protein)	PICALM CALM	Homo sapiens (Human)	amyloid-beta clearance by transcytosis [GO:0150093]; axonogenesis [GO:0007409]; clathrin coat assembly [GO:0048268]; clathrin-coated pit assembly [GO:1905224]; clathrin-dependent endocytosis [GO:0072583]; dendrite morphogenesis [GO:0048813]; endocytosis [GO:0006897]; endosomal transport [GO:0016197]; hemopoiesis [GO:0030097]; iron ion homeostasis [GO:0055072]; learning or memory [GO:0007611]; membrane bending [GO:0097753]; negative regulation of gene expression [GO:0010629]; negative regulation of metalloendopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902963]; negative regulation of protein localization to cell surface [GO:2000009]; negative regulation of protein localization to plasma membrane [GO:1903077]; negative regulation of receptor-mediated endocytosis [GO:0048261]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902961]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of GTPase activity [GO:0043547]; positive regulation of neuron death [GO:1901216]; protein-containing complex assembly [GO:0065003]; receptor internalization [GO:0031623]; receptor-mediated endocytosis [GO:0006898]; regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902959]; regulation of clathrin-dependent endocytosis [GO:2000369]; regulation of endocytosis [GO:0030100]; regulation of protein localization [GO:0032880]; regulation of vesicle size [GO:0097494]; synaptic vesicle budding from presynaptic endocytic zone membrane [GO:0016185]; synaptic vesicle maturation [GO:0016188]; vesicle budding from membrane [GO:0006900]; vesicle cargo loading [GO:0035459]; vesicle-mediated transport [GO:0016192]	cell surface [GO:0009986]; clathrin coat of coated pit [GO:0030132]; clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]; cytosol [GO:0005829]; early endosome [GO:0005769]; endosome to plasma membrane transport vesicle [GO:0070381]; extrinsic component of presynaptic endocytic zone membrane [GO:0098894]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; intrinsic component of membrane [GO:0031224]; membrane [GO:0016020]; neurofibrillary tangle [GO:0097418]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; postsynaptic membrane [GO:0045211]; presynaptic membrane [GO:0042734]; synaptic vesicle [GO:0008021]; vesicle [GO:0031982]	"cell surface [GO:0009986]; clathrin coat of coated pit [GO:0030132]; clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]; cytosol [GO:0005829]; early endosome [GO:0005769]; endosome to plasma membrane transport vesicle [GO:0070381]; extrinsic component of presynaptic endocytic zone membrane [GO:0098894]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; intrinsic component of membrane [GO:0031224]; membrane [GO:0016020]; neurofibrillary tangle [GO:0097418]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; postsynaptic membrane [GO:0045211]; presynaptic membrane [GO:0042734]; synaptic vesicle [GO:0008021]; vesicle [GO:0031982]; 1-phosphatidylinositol binding [GO:0005545]; amyloid-beta binding [GO:0001540]; cadherin binding [GO:0045296]; clathrin binding [GO:0030276]; clathrin heavy chain binding [GO:0032050]; low-density lipoprotein particle receptor binding [GO:0050750]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]; small GTPase binding [GO:0031267]; SNARE binding [GO:0000149]; tau protein binding [GO:0048156]; amyloid-beta clearance by transcytosis [GO:0150093]; axonogenesis [GO:0007409]; clathrin coat assembly [GO:0048268]; clathrin-coated pit assembly [GO:1905224]; clathrin-dependent endocytosis [GO:0072583]; dendrite morphogenesis [GO:0048813]; endocytosis [GO:0006897]; endosomal transport [GO:0016197]; hemopoiesis [GO:0030097]; iron ion homeostasis [GO:0055072]; learning or memory [GO:0007611]; membrane bending [GO:0097753]; negative regulation of gene expression [GO:0010629]; negative regulation of metalloendopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902963]; negative regulation of protein localization to cell surface [GO:2000009]; negative regulation of protein localization to plasma membrane [GO:1903077]; negative regulation of receptor-mediated endocytosis [GO:0048261]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902961]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of GTPase activity [GO:0043547]; positive regulation of neuron death [GO:1901216]; protein-containing complex assembly [GO:0065003]; receptor internalization [GO:0031623]; receptor-mediated endocytosis [GO:0006898]; regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902959]; regulation of clathrin-dependent endocytosis [GO:2000369]; regulation of endocytosis [GO:0030100]; regulation of protein localization [GO:0032880]; regulation of vesicle size [GO:0097494]; synaptic vesicle budding from presynaptic endocytic zone membrane [GO:0016185]; synaptic vesicle maturation [GO:0016188]; vesicle budding from membrane [GO:0006900]; vesicle cargo loading [GO:0035459]; vesicle-mediated transport [GO:0016192]"	"1-phosphatidylinositol binding [GO:0005545]; amyloid-beta binding [GO:0001540]; cadherin binding [GO:0045296]; clathrin binding [GO:0030276]; clathrin heavy chain binding [GO:0032050]; low-density lipoprotein particle receptor binding [GO:0050750]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]; small GTPase binding [GO:0031267]; SNARE binding [GO:0000149]; tau protein binding [GO:0048156]"	GO:0000149; GO:0001540; GO:0005545; GO:0005546; GO:0005634; GO:0005769; GO:0005794; GO:0005829; GO:0005886; GO:0005905; GO:0006897; GO:0006898; GO:0006900; GO:0007409; GO:0007611; GO:0008021; GO:0009986; GO:0010629; GO:0016020; GO:0016185; GO:0016188; GO:0016192; GO:0016197; GO:0030097; GO:0030100; GO:0030132; GO:0030136; GO:0030276; GO:0031224; GO:0031267; GO:0031623; GO:0031982; GO:0032050; GO:0032880; GO:0035459; GO:0042734; GO:0043025; GO:0043231; GO:0043547; GO:0045211; GO:0045296; GO:0045334; GO:0045893; GO:0048156; GO:0048261; GO:0048268; GO:0048471; GO:0048813; GO:0050750; GO:0055072; GO:0065003; GO:0070381; GO:0072583; GO:0097418; GO:0097494; GO:0097753; GO:0098894; GO:0150093; GO:1901216; GO:1902004; GO:1902959; GO:1902961; GO:1902963; GO:1903077; GO:1905224; GO:2000009; GO:2000369	ATTHEIMGPK	0.92969	12.5966	14.5201	13.9907	9.97985	13.2712	13.4431	14.454	12.5973	14.3369	14.935	13.1291	13.014	13.501	11.8945	12.415
P12821	ACE_HUMAN	"Angiotensin-converting enzyme (ACE) (EC 3.4.15.1) (Dipeptidyl carboxypeptidase I) (Kininase II) (CD antigen CD143) [Cleaved into: Angiotensin-converting enzyme, soluble form]"	ACE DCP DCP1	Homo sapiens (Human)	aging [GO:0007568]; amyloid-beta metabolic process [GO:0050435]; angiogenesis involved in coronary vascular morphogenesis [GO:0060978]; angiotensin maturation [GO:0002003]; animal organ regeneration [GO:0031100]; antigen processing and presentation of peptide antigen via MHC class I [GO:0002474]; arachidonic acid secretion [GO:0050482]; blood vessel diameter maintenance [GO:0097746]; blood vessel remodeling [GO:0001974]; bradykinin catabolic process [GO:0010815]; brain development [GO:0007420]; cell proliferation in bone marrow [GO:0071838]; cellular response to aldosterone [GO:1904045]; cellular response to glucose stimulus [GO:0071333]; eating behavior [GO:0042755]; embryo development ending in birth or egg hatching [GO:0009792]; female pregnancy [GO:0007565]; heart contraction [GO:0060047]; hematopoietic stem cell differentiation [GO:0060218]; hormone catabolic process [GO:0042447]; hormone metabolic process [GO:0042445]; kidney development [GO:0001822]; lung alveolus development [GO:0048286]; male gonad development [GO:0008584]; mononuclear cell proliferation [GO:0032943]; negative regulation of calcium ion import [GO:0090281]; negative regulation of gap junction assembly [GO:1903597]; negative regulation of gene expression [GO:0010629]; negative regulation of glucose import [GO:0046325]; negative regulation of protein binding [GO:0032091]; negative regulation of renal sodium excretion [GO:0035814]; neutrophil mediated immunity [GO:0002446]; peptide catabolic process [GO:0043171]; positive regulation of apoptotic process [GO:0043065]; positive regulation of inflammatory response [GO:0050729]; positive regulation of neurogenesis [GO:0050769]; positive regulation of peptidyl-cysteine S-nitrosylation [GO:2000170]; positive regulation of peptidyl-tyrosine autophosphorylation [GO:1900086]; positive regulation of protein binding [GO:0032092]; positive regulation of protein tyrosine kinase activity [GO:0061098]; positive regulation of systemic arterial blood pressure [GO:0003084]; positive regulation of vasoconstriction [GO:0045907]; post-transcriptional regulation of gene expression [GO:0010608]; proteolysis [GO:0006508]; regulation of angiotensin metabolic process [GO:0060177]; regulation of blood pressure [GO:0008217]; regulation of hematopoietic stem cell proliferation [GO:1902033]; regulation of renal output by angiotensin [GO:0002019]; regulation of smooth muscle cell migration [GO:0014910]; regulation of synaptic plasticity [GO:0048167]; regulation of systemic arterial blood pressure by renin-angiotensin [GO:0003081]; regulation of vasoconstriction [GO:0019229]; response to dexamethasone [GO:0071548]; response to hypoxia [GO:0001666]; response to laminar fluid shear stress [GO:0034616]; response to lipopolysaccharide [GO:0032496]; response to nutrient levels [GO:0031667]; response to thyroid hormone [GO:0097066]; response to xenobiotic stimulus [GO:0009410]; sensory perception of pain [GO:0019233]; spermatogenesis [GO:0007283]; substance P catabolic process [GO:0010814]; vasoconstriction [GO:0042310]	basal plasma membrane [GO:0009925]; brush border membrane [GO:0031526]; endosome [GO:0005768]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; lysosome [GO:0005764]; plasma membrane [GO:0005886]; sperm midpiece [GO:0097225]	basal plasma membrane [GO:0009925]; brush border membrane [GO:0031526]; endosome [GO:0005768]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; lysosome [GO:0005764]; plasma membrane [GO:0005886]; sperm midpiece [GO:0097225]; actin binding [GO:0003779]; bradykinin receptor binding [GO:0031711]; carboxypeptidase activity [GO:0004180]; chloride ion binding [GO:0031404]; endopeptidase activity [GO:0004175]; exopeptidase activity [GO:0008238]; heterocyclic compound binding [GO:1901363]; metallodipeptidase activity [GO:0070573]; metalloendopeptidase activity [GO:0004222]; metallopeptidase activity [GO:0008237]; mitogen-activated protein kinase binding [GO:0051019]; mitogen-activated protein kinase kinase binding [GO:0031434]; peptidase activity [GO:0008233]; peptidyl-dipeptidase activity [GO:0008241]; tripeptidyl-peptidase activity [GO:0008240]; zinc ion binding [GO:0008270]; aging [GO:0007568]; amyloid-beta metabolic process [GO:0050435]; angiogenesis involved in coronary vascular morphogenesis [GO:0060978]; angiotensin maturation [GO:0002003]; animal organ regeneration [GO:0031100]; antigen processing and presentation of peptide antigen via MHC class I [GO:0002474]; arachidonic acid secretion [GO:0050482]; blood vessel diameter maintenance [GO:0097746]; blood vessel remodeling [GO:0001974]; bradykinin catabolic process [GO:0010815]; brain development [GO:0007420]; cell proliferation in bone marrow [GO:0071838]; cellular response to aldosterone [GO:1904045]; cellular response to glucose stimulus [GO:0071333]; eating behavior [GO:0042755]; embryo development ending in birth or egg hatching [GO:0009792]; female pregnancy [GO:0007565]; heart contraction [GO:0060047]; hematopoietic stem cell differentiation [GO:0060218]; hormone catabolic process [GO:0042447]; hormone metabolic process [GO:0042445]; kidney development [GO:0001822]; lung alveolus development [GO:0048286]; male gonad development [GO:0008584]; mononuclear cell proliferation [GO:0032943]; negative regulation of calcium ion import [GO:0090281]; negative regulation of gap junction assembly [GO:1903597]; negative regulation of gene expression [GO:0010629]; negative regulation of glucose import [GO:0046325]; negative regulation of protein binding [GO:0032091]; negative regulation of renal sodium excretion [GO:0035814]; neutrophil mediated immunity [GO:0002446]; peptide catabolic process [GO:0043171]; positive regulation of apoptotic process [GO:0043065]; positive regulation of inflammatory response [GO:0050729]; positive regulation of neurogenesis [GO:0050769]; positive regulation of peptidyl-cysteine S-nitrosylation [GO:2000170]; positive regulation of peptidyl-tyrosine autophosphorylation [GO:1900086]; positive regulation of protein binding [GO:0032092]; positive regulation of protein tyrosine kinase activity [GO:0061098]; positive regulation of systemic arterial blood pressure [GO:0003084]; positive regulation of vasoconstriction [GO:0045907]; post-transcriptional regulation of gene expression [GO:0010608]; proteolysis [GO:0006508]; regulation of angiotensin metabolic process [GO:0060177]; regulation of blood pressure [GO:0008217]; regulation of hematopoietic stem cell proliferation [GO:1902033]; regulation of renal output by angiotensin [GO:0002019]; regulation of smooth muscle cell migration [GO:0014910]; regulation of synaptic plasticity [GO:0048167]; regulation of systemic arterial blood pressure by renin-angiotensin [GO:0003081]; regulation of vasoconstriction [GO:0019229]; response to dexamethasone [GO:0071548]; response to hypoxia [GO:0001666]; response to laminar fluid shear stress [GO:0034616]; response to lipopolysaccharide [GO:0032496]; response to nutrient levels [GO:0031667]; response to thyroid hormone [GO:0097066]; response to xenobiotic stimulus [GO:0009410]; sensory perception of pain [GO:0019233]; spermatogenesis [GO:0007283]; substance P catabolic process [GO:0010814]; vasoconstriction [GO:0042310]	actin binding [GO:0003779]; bradykinin receptor binding [GO:0031711]; carboxypeptidase activity [GO:0004180]; chloride ion binding [GO:0031404]; endopeptidase activity [GO:0004175]; exopeptidase activity [GO:0008238]; heterocyclic compound binding [GO:1901363]; metallodipeptidase activity [GO:0070573]; metalloendopeptidase activity [GO:0004222]; metallopeptidase activity [GO:0008237]; mitogen-activated protein kinase binding [GO:0051019]; mitogen-activated protein kinase kinase binding [GO:0031434]; peptidase activity [GO:0008233]; peptidyl-dipeptidase activity [GO:0008241]; tripeptidyl-peptidase activity [GO:0008240]; zinc ion binding [GO:0008270]	GO:0001666; GO:0001822; GO:0001974; GO:0002003; GO:0002019; GO:0002446; GO:0002474; GO:0003081; GO:0003084; GO:0003779; GO:0004175; GO:0004180; GO:0004222; GO:0005576; GO:0005615; GO:0005764; GO:0005768; GO:0005886; GO:0005887; GO:0006508; GO:0007283; GO:0007420; GO:0007565; GO:0007568; GO:0008217; GO:0008233; GO:0008237; GO:0008238; GO:0008240; GO:0008241; GO:0008270; GO:0008584; GO:0009410; GO:0009792; GO:0009897; GO:0009925; GO:0010608; GO:0010629; GO:0010814; GO:0010815; GO:0014910; GO:0016021; GO:0019229; GO:0019233; GO:0031100; GO:0031404; GO:0031434; GO:0031526; GO:0031667; GO:0031711; GO:0032091; GO:0032092; GO:0032496; GO:0032943; GO:0034616; GO:0035814; GO:0042310; GO:0042445; GO:0042447; GO:0042755; GO:0043065; GO:0043171; GO:0045907; GO:0046325; GO:0048167; GO:0048286; GO:0050435; GO:0050482; GO:0050729; GO:0050769; GO:0051019; GO:0060047; GO:0060177; GO:0060218; GO:0060978; GO:0061098; GO:0070062; GO:0070573; GO:0071333; GO:0071548; GO:0071838; GO:0090281; GO:0097066; GO:0097225; GO:0097746; GO:1900086; GO:1901363; GO:1902033; GO:1903597; GO:1904045; GO:2000170	AALPAQELEEYNK	0.98406	14.9934	13.8711	13.5382	11.9943	11.2144	10.866	12.3123	12.8968	13.3722	12.3827	15.1047	15.5481	13.7603	11.8767	14.3296
P20700	LMNB1_HUMAN	Lamin-B1	LMNB1 LMN2 LMNB	Homo sapiens (Human)	heterochromatin assembly [GO:0031507]; nuclear envelope organization [GO:0006998]; nuclear migration [GO:0007097]; nuclear pore localization [GO:0051664]; protein localization to nuclear envelope [GO:0090435]	lamin filament [GO:0005638]; membrane [GO:0016020]; nuclear envelope [GO:0005635]; nuclear inner membrane [GO:0005637]; nuclear lamina [GO:0005652]; nuclear matrix [GO:0016363]; nuclear membrane [GO:0031965]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	lamin filament [GO:0005638]; membrane [GO:0016020]; nuclear envelope [GO:0005635]; nuclear inner membrane [GO:0005637]; nuclear lamina [GO:0005652]; nuclear matrix [GO:0016363]; nuclear membrane [GO:0031965]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; phospholipase binding [GO:0043274]; sequence-specific double-stranded DNA binding [GO:1990837]; structural constituent of cytoskeleton [GO:0005200]; structural molecule activity [GO:0005198]; heterochromatin assembly [GO:0031507]; nuclear envelope organization [GO:0006998]; nuclear migration [GO:0007097]; nuclear pore localization [GO:0051664]; protein localization to nuclear envelope [GO:0090435]	phospholipase binding [GO:0043274]; sequence-specific double-stranded DNA binding [GO:1990837]; structural constituent of cytoskeleton [GO:0005200]; structural molecule activity [GO:0005198]	GO:0005198; GO:0005200; GO:0005634; GO:0005635; GO:0005637; GO:0005638; GO:0005652; GO:0005654; GO:0006998; GO:0007097; GO:0016020; GO:0016363; GO:0031507; GO:0031965; GO:0043274; GO:0051664; GO:0090435; GO:1990837	ACLERIQELEDLLAKEK	1.008	13.0737	12.467	12.8847	12.5128	12.5224	11.8061	13.184	13.0078	13.7727	14.3478	13.8632	12.8156	13.7602	13.1308	13.7692
B7Z1Y1	B7Z1Y1_HUMAN	"cDNA FLJ50125, highly similar to Cullin-2"		Homo sapiens (Human)	ubiquitin-dependent protein catabolic process [GO:0006511]	cullin-RING ubiquitin ligase complex [GO:0031461]	cullin-RING ubiquitin ligase complex [GO:0031461]; ubiquitin protein ligase binding [GO:0031625]; ubiquitin-dependent protein catabolic process [GO:0006511]	ubiquitin protein ligase binding [GO:0031625]	GO:0006511; GO:0031461; GO:0031625	ALTSVVNYREPK	0.92271	13.7999	13.3738	14.0089	13.0805	13.1416	11.7768	10.3361	13.2404	12.7999	14.4839	13.2564	14.5609	13.0034	12.16	13.5618
A8K0M6	A8K0M6_HUMAN	cDNA FLJ76697		Homo sapiens (Human)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GO:0016021	AEEVELYLEK	0.89676	12.6118	14.2926	13.9243	10.461	11.8127	11.2248	14.9592	14.124	14.0029	15.7526	14.4557	11.6663	13.2962	13.9058	9.82636
B4DFH6	B4DFH6_HUMAN	"cDNA FLJ52536, highly similar to Tubulin beta-4 chain"		Homo sapiens (Human)	microtubule-based process [GO:0007017]	cytoplasm [GO:0005737]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; structural constituent of cytoskeleton [GO:0005200]; microtubule-based process [GO:0007017]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]; structural constituent of cytoskeleton [GO:0005200]	GO:0003924; GO:0005200; GO:0005525; GO:0005737; GO:0005874; GO:0007017	ALTVPELTQQMFDAK	0.77656	13.0655	13.4997	13.8164	12.8793	12.896	12.7376	12.5133	11.6498	12.797	12.82	12.9011	13.1722	14.3054	13.0913	13.5861
P52888	THOP1_HUMAN	Thimet oligopeptidase (EC 3.4.24.15) (Endopeptidase 24.15) (MP78)	THOP1	Homo sapiens (Human)	peptide metabolic process [GO:0006518]; protein polyubiquitination [GO:0000209]; proteolysis [GO:0006508]	cytosol [GO:0005829]; mitochondrial intermembrane space [GO:0005758]	cytosol [GO:0005829]; mitochondrial intermembrane space [GO:0005758]; metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]; peptide metabolic process [GO:0006518]; protein polyubiquitination [GO:0000209]; proteolysis [GO:0006508]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	GO:0000209; GO:0004222; GO:0005758; GO:0005829; GO:0006508; GO:0006518; GO:0046872	AECERRGLPFDGR	1.0096	14.2084	12.2573	12.3162	9.73486	11.5719	12.5612	12.5493	14.2942	13.3396	13.3845	13.7493	13.2172	14.7626	13.5866	13.4205
B4DFG8	B4DFG8_HUMAN	PRA1 family protein		Homo sapiens (Human)	autophagy [GO:0006914]	integral component of membrane [GO:0016021]; phagophore assembly site [GO:0000407]	integral component of membrane [GO:0016021]; phagophore assembly site [GO:0000407]; autophagy [GO:0006914]		GO:0000407; GO:0006914; GO:0016021	AAVRRCR	0.99037	13.312	13.0042	13.0033	12.2145	11.68	11.411	12.6796	13.0964	12.9042	14.2489	15.0916	14.0165	12.5492	12.8368	12.8363
P21796	VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 (VDAC-1) (hVDAC1) (Outer mitochondrial membrane protein porin 1) (Plasmalemmal porin) (Porin 31HL) (Porin 31HM)	VDAC1 VDAC	Homo sapiens (Human)	anion transport [GO:0006820]; apoptotic process [GO:0006915]; behavioral fear response [GO:0001662]; epithelial cell differentiation [GO:0030855]; learning [GO:0007612]; negative regulation of apoptotic process [GO:0043066]; negative regulation of calcium import into the mitochondrion [GO:0110099]; negative regulation of reactive oxygen species metabolic process [GO:2000378]; neuron-neuron synaptic transmission [GO:0007270]; positive regulation of parkin-mediated stimulation of mitophagy in response to mitochondrial depolarization [GO:1905091]; pyruvate metabolic process [GO:0006090]; regulation of autophagy of mitochondrion [GO:1903146]	extracellular exosome [GO:0070062]; membrane [GO:0016020]; membrane raft [GO:0045121]; mitochondrial membrane [GO:0031966]; mitochondrial nucleoid [GO:0042645]; mitochondrial outer membrane [GO:0005741]; mitochondrial permeability transition pore complex [GO:0005757]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; pore complex [GO:0046930]; synapse [GO:0045202]	extracellular exosome [GO:0070062]; membrane [GO:0016020]; membrane raft [GO:0045121]; mitochondrial membrane [GO:0031966]; mitochondrial nucleoid [GO:0042645]; mitochondrial outer membrane [GO:0005741]; mitochondrial permeability transition pore complex [GO:0005757]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; pore complex [GO:0046930]; synapse [GO:0045202]; ceramide binding [GO:0097001]; cholesterol binding [GO:0015485]; identical protein binding [GO:0042802]; phosphatidylcholine binding [GO:0031210]; porin activity [GO:0015288]; protein kinase binding [GO:0019901]; transmembrane transporter binding [GO:0044325]; voltage-gated anion channel activity [GO:0008308]; anion transport [GO:0006820]; apoptotic process [GO:0006915]; behavioral fear response [GO:0001662]; epithelial cell differentiation [GO:0030855]; learning [GO:0007612]; negative regulation of apoptotic process [GO:0043066]; negative regulation of calcium import into the mitochondrion [GO:0110099]; negative regulation of reactive oxygen species metabolic process [GO:2000378]; neuron-neuron synaptic transmission [GO:0007270]; positive regulation of parkin-mediated stimulation of mitophagy in response to mitochondrial depolarization [GO:1905091]; pyruvate metabolic process [GO:0006090]; regulation of autophagy of mitochondrion [GO:1903146]	ceramide binding [GO:0097001]; cholesterol binding [GO:0015485]; identical protein binding [GO:0042802]; phosphatidylcholine binding [GO:0031210]; porin activity [GO:0015288]; protein kinase binding [GO:0019901]; transmembrane transporter binding [GO:0044325]; voltage-gated anion channel activity [GO:0008308]	GO:0001662; GO:0005634; GO:0005739; GO:0005741; GO:0005757; GO:0005886; GO:0006090; GO:0006820; GO:0006915; GO:0007270; GO:0007612; GO:0008308; GO:0015288; GO:0015485; GO:0016020; GO:0019901; GO:0030855; GO:0031210; GO:0031966; GO:0042645; GO:0042802; GO:0043066; GO:0044325; GO:0045121; GO:0045202; GO:0046930; GO:0070062; GO:0097001; GO:0110099; GO:1903146; GO:1905091; GO:2000378	AVPPTYADLGK	0.94324	13.2718	14.4286	12.0144	12.6177	13.9547	11.8519	14.3142	13.0007	14.1733	12.1871	14.1706	14.7163	10.7356	12.3352	10.8777
B4DFF0	B4DFF0_HUMAN	"cDNA FLJ57483, highly similar to Collagen alpha-5(IV) chain"		Homo sapiens (Human)		basement membrane [GO:0005604]; collagen trimer [GO:0005581]; membrane [GO:0016020]	basement membrane [GO:0005604]; collagen trimer [GO:0005581]; membrane [GO:0016020]; extracellular matrix structural constituent [GO:0005201]	extracellular matrix structural constituent [GO:0005201]	GO:0005201; GO:0005581; GO:0005604; GO:0016020	AGDLRTR	0.87937	13.2261	13.1319	13.23	12.8809	12.8199	12.8708	12.4026	13.3284	12.3835	12.7066	13.1255	13.1367	12.871	12.8284	13.2166
Q9H8L6	MMRN2_HUMAN	Multimerin-2 (EMILIN-3) (Elastin microfibril interface located protein 3) (Elastin microfibril interfacer 3) (EndoGlyx-1 p125/p140 subunit)	MMRN2 EMILIN3	Homo sapiens (Human)	cell adhesion [GO:0007155]; cell migration involved in sprouting angiogenesis [GO:0002042]; negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis [GO:1903588]; negative regulation of cell migration [GO:0030336]; negative regulation of cell migration involved in sprouting angiogenesis [GO:0090051]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of vascular endothelial growth factor receptor signaling pathway [GO:0030948]; positive regulation of defense response to bacterium [GO:1900426]; positive regulation of epithelial tube formation [GO:1905278]; positive regulation of morphogenesis of an epithelium [GO:1905332]	basement membrane [GO:0005604]; collagen-containing extracellular matrix [GO:0062023]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]	basement membrane [GO:0005604]; collagen-containing extracellular matrix [GO:0062023]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; cell adhesion [GO:0007155]; cell migration involved in sprouting angiogenesis [GO:0002042]; negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis [GO:1903588]; negative regulation of cell migration [GO:0030336]; negative regulation of cell migration involved in sprouting angiogenesis [GO:0090051]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of vascular endothelial growth factor receptor signaling pathway [GO:0030948]; positive regulation of defense response to bacterium [GO:1900426]; positive regulation of epithelial tube formation [GO:1905278]; positive regulation of morphogenesis of an epithelium [GO:1905332]		GO:0002042; GO:0005604; GO:0005615; GO:0007155; GO:0008285; GO:0030336; GO:0030948; GO:0062023; GO:0070062; GO:0090051; GO:1900426; GO:1903588; GO:1905278; GO:1905332	AAAAEARHEVR	0.9963	13.0252	12.8352	14.1911	9.85181	12.3761	11.3487	12.5664	13.7845	13.6231	14.2717	13.8468	13.163	12.8276	13.138	13.1329
P35354	PGH2_HUMAN	Prostaglandin G/H synthase 2 (EC 1.14.99.1) (Cyclooxygenase-2) (COX-2) (PHS II) (Prostaglandin H2 synthase 2) (PGH synthase 2) (PGHS-2) (Prostaglandin-endoperoxide synthase 2)	PTGS2 COX2	Homo sapiens (Human)	"aging [GO:0007568]; angiogenesis [GO:0001525]; bone mineralization [GO:0030282]; brown fat cell differentiation [GO:0050873]; cellular response to ATP [GO:0071318]; cellular response to fluid shear stress [GO:0071498]; cellular response to heat [GO:0034605]; cellular response to hypoxia [GO:0071456]; cellular response to lead ion [GO:0071284]; cellular response to mechanical stimulus [GO:0071260]; cellular response to non-ionic osmotic stress [GO:0071471]; cellular response to UV [GO:0034644]; cyclooxygenase pathway [GO:0019371]; decidualization [GO:0046697]; embryo implantation [GO:0007566]; hair cycle [GO:0042633]; inflammatory response [GO:0006954]; learning [GO:0007612]; maintenance of blood-brain barrier [GO:0035633]; memory [GO:0007613]; negative regulation of calcium ion transport [GO:0051926]; negative regulation of cell cycle [GO:0045786]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [GO:1902219]; negative regulation of smooth muscle contraction [GO:0045986]; negative regulation of synaptic transmission, dopaminergic [GO:0032227]; ovulation [GO:0030728]; positive regulation of apoptotic process [GO:0043065]; positive regulation of brown fat cell differentiation [GO:0090336]; positive regulation of cell migration involved in sprouting angiogenesis [GO:0090050]; positive regulation of fever generation [GO:0031622]; positive regulation of fibroblast growth factor production [GO:0090271]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of platelet-derived growth factor production [GO:0090362]; positive regulation of prostaglandin biosynthetic process [GO:0031394]; positive regulation of protein import into nucleus [GO:0042307]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of smooth muscle contraction [GO:0045987]; positive regulation of synaptic plasticity [GO:0031915]; positive regulation of synaptic transmission, glutamatergic [GO:0051968]; positive regulation of transforming growth factor beta production [GO:0071636]; positive regulation of vascular endothelial growth factor production [GO:0010575]; positive regulation of vasoconstriction [GO:0045907]; prostaglandin biosynthetic process [GO:0001516]; prostaglandin secretion [GO:0032310]; regulation of blood pressure [GO:0008217]; regulation of inflammatory response [GO:0050727]; regulation of neuroinflammatory response [GO:0150077]; response to angiotensin [GO:1990776]; response to estradiol [GO:0032355]; response to fatty acid [GO:0070542]; response to fructose [GO:0009750]; response to glucocorticoid [GO:0051384]; response to lipopolysaccharide [GO:0032496]; response to lithium ion [GO:0010226]; response to manganese ion [GO:0010042]; response to nematode [GO:0009624]; response to oxidative stress [GO:0006979]; response to tumor necrosis factor [GO:0034612]; response to vitamin D [GO:0033280]; response to xenobiotic stimulus [GO:0009410]; sensory perception of pain [GO:0019233]"	caveola [GO:0005901]; cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; endoplasmic reticulum membrane [GO:0005789]; intracellular membrane-bounded organelle [GO:0043231]; neuron projection [GO:0043005]; nuclear inner membrane [GO:0005637]; nuclear outer membrane [GO:0005640]; protein-containing complex [GO:0032991]	"caveola [GO:0005901]; cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; endoplasmic reticulum membrane [GO:0005789]; intracellular membrane-bounded organelle [GO:0043231]; neuron projection [GO:0043005]; nuclear inner membrane [GO:0005637]; nuclear outer membrane [GO:0005640]; protein-containing complex [GO:0032991]; enzyme binding [GO:0019899]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]; peroxidase activity [GO:0004601]; prostaglandin-endoperoxide synthase activity [GO:0004666]; protein homodimerization activity [GO:0042803]; aging [GO:0007568]; angiogenesis [GO:0001525]; bone mineralization [GO:0030282]; brown fat cell differentiation [GO:0050873]; cellular response to ATP [GO:0071318]; cellular response to fluid shear stress [GO:0071498]; cellular response to heat [GO:0034605]; cellular response to hypoxia [GO:0071456]; cellular response to lead ion [GO:0071284]; cellular response to mechanical stimulus [GO:0071260]; cellular response to non-ionic osmotic stress [GO:0071471]; cellular response to UV [GO:0034644]; cyclooxygenase pathway [GO:0019371]; decidualization [GO:0046697]; embryo implantation [GO:0007566]; hair cycle [GO:0042633]; inflammatory response [GO:0006954]; learning [GO:0007612]; maintenance of blood-brain barrier [GO:0035633]; memory [GO:0007613]; negative regulation of calcium ion transport [GO:0051926]; negative regulation of cell cycle [GO:0045786]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [GO:1902219]; negative regulation of smooth muscle contraction [GO:0045986]; negative regulation of synaptic transmission, dopaminergic [GO:0032227]; ovulation [GO:0030728]; positive regulation of apoptotic process [GO:0043065]; positive regulation of brown fat cell differentiation [GO:0090336]; positive regulation of cell migration involved in sprouting angiogenesis [GO:0090050]; positive regulation of fever generation [GO:0031622]; positive regulation of fibroblast growth factor production [GO:0090271]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of platelet-derived growth factor production [GO:0090362]; positive regulation of prostaglandin biosynthetic process [GO:0031394]; positive regulation of protein import into nucleus [GO:0042307]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of smooth muscle contraction [GO:0045987]; positive regulation of synaptic plasticity [GO:0031915]; positive regulation of synaptic transmission, glutamatergic [GO:0051968]; positive regulation of transforming growth factor beta production [GO:0071636]; positive regulation of vascular endothelial growth factor production [GO:0010575]; positive regulation of vasoconstriction [GO:0045907]; prostaglandin biosynthetic process [GO:0001516]; prostaglandin secretion [GO:0032310]; regulation of blood pressure [GO:0008217]; regulation of inflammatory response [GO:0050727]; regulation of neuroinflammatory response [GO:0150077]; response to angiotensin [GO:1990776]; response to estradiol [GO:0032355]; response to fatty acid [GO:0070542]; response to fructose [GO:0009750]; response to glucocorticoid [GO:0051384]; response to lipopolysaccharide [GO:0032496]; response to lithium ion [GO:0010226]; response to manganese ion [GO:0010042]; response to nematode [GO:0009624]; response to oxidative stress [GO:0006979]; response to tumor necrosis factor [GO:0034612]; response to vitamin D [GO:0033280]; response to xenobiotic stimulus [GO:0009410]; sensory perception of pain [GO:0019233]"	"enzyme binding [GO:0019899]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]; peroxidase activity [GO:0004601]; prostaglandin-endoperoxide synthase activity [GO:0004666]; protein homodimerization activity [GO:0042803]"	GO:0001516; GO:0001525; GO:0004601; GO:0004666; GO:0005637; GO:0005640; GO:0005737; GO:0005783; GO:0005788; GO:0005789; GO:0005901; GO:0006954; GO:0006979; GO:0007566; GO:0007568; GO:0007612; GO:0007613; GO:0008217; GO:0008285; GO:0009410; GO:0009624; GO:0009750; GO:0010042; GO:0010226; GO:0010575; GO:0016702; GO:0019233; GO:0019371; GO:0019899; GO:0020037; GO:0030282; GO:0030728; GO:0031394; GO:0031622; GO:0031915; GO:0032227; GO:0032310; GO:0032355; GO:0032496; GO:0032991; GO:0033138; GO:0033280; GO:0034605; GO:0034612; GO:0034644; GO:0035633; GO:0042307; GO:0042633; GO:0042803; GO:0043005; GO:0043065; GO:0043154; GO:0043231; GO:0045429; GO:0045786; GO:0045907; GO:0045986; GO:0045987; GO:0046697; GO:0046872; GO:0048661; GO:0050727; GO:0050873; GO:0051384; GO:0051926; GO:0051968; GO:0070542; GO:0071260; GO:0071284; GO:0071318; GO:0071456; GO:0071471; GO:0071498; GO:0071636; GO:0090050; GO:0090271; GO:0090336; GO:0090362; GO:0150077; GO:1902219; GO:1990776	ALLLCAVLALSHTANPCCSHPCQNR	0.25806	13.7367	12.299	12.8515	12.0166	11.8559	12.7059	12.0112	12.3856	12.5701	13.6641	14.4547	13.7964	12.864	13.1424	12.825
P09429	HMGB1_HUMAN	High mobility group protein B1 (High mobility group protein 1) (HMG-1)	HMGB1 HMG1	Homo sapiens (Human)	"activation of innate immune response [GO:0002218]; apoptotic cell clearance [GO:0043277]; autophagy [GO:0006914]; cellular response to lipopolysaccharide [GO:0071222]; dendritic cell chemotaxis [GO:0002407]; DNA geometric change [GO:0032392]; DNA recombination [GO:0006310]; DNA topological change [GO:0006265]; double-strand break repair via nonhomologous end joining [GO:0006303]; heterochromatin assembly [GO:0031507]; inflammatory response [GO:0006954]; inflammatory response to antigenic stimulus [GO:0002437]; innate immune response [GO:0045087]; myeloid dendritic cell activation [GO:0001773]; negative regulation of apoptotic cell clearance [GO:2000426]; negative regulation of blood vessel endothelial cell migration [GO:0043537]; negative regulation of CD4-positive, alpha-beta T cell differentiation [GO:0043371]; negative regulation of interferon-gamma production [GO:0032689]; negative regulation of RNA polymerase II transcription preinitiation complex assembly [GO:0017055]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neuron projection development [GO:0031175]; neutrophil clearance [GO:0097350]; positive regulation of activated T cell proliferation [GO:0042104]; positive regulation of apoptotic process [GO:0043065]; positive regulation of autophagy [GO:0010508]; positive regulation of blood vessel endothelial cell migration [GO:0043536]; positive regulation of chemokine (C-X-C motif) ligand 2 production [GO:2000343]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of dendritic cell differentiation [GO:2001200]; positive regulation of DNA binding [GO:0043388]; positive regulation of DNA ligation [GO:0051106]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of interleukin-1 production [GO:0032732]; positive regulation of interleukin-10 production [GO:0032733]; positive regulation of interleukin-12 production [GO:0032735]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of JNK cascade [GO:0046330]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of mismatch repair [GO:0032425]; positive regulation of monocyte chemotaxis [GO:0090026]; positive regulation of toll-like receptor 9 signaling pathway [GO:0034165]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of vascular endothelial cell proliferation [GO:1905564]; positive regulation of viral entry into host cell [GO:0046598]; regulation of restriction endodeoxyribonuclease activity [GO:0032072]; regulation of T cell mediated immune response to tumor cell [GO:0002840]; regulation of tolerance induction [GO:0002643]; regulation of transcription by RNA polymerase II [GO:0006357]; T-helper 1 cell activation [GO:0035711]; T-helper 1 cell differentiation [GO:0045063]; V(D)J recombination [GO:0033151]"	alphav-beta3 integrin-HMGB1 complex [GO:0035868]; cell surface [GO:0009986]; condensed chromosome [GO:0000793]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; endosome [GO:0005768]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; secretory granule lumen [GO:0034774]; transcription repressor complex [GO:0017053]	"alphav-beta3 integrin-HMGB1 complex [GO:0035868]; cell surface [GO:0009986]; condensed chromosome [GO:0000793]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; endosome [GO:0005768]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; secretory granule lumen [GO:0034774]; transcription repressor complex [GO:0017053]; bubble DNA binding [GO:0000405]; C-X-C chemokine binding [GO:0019958]; chemoattractant activity [GO:0042056]; cytokine activity [GO:0005125]; damaged DNA binding [GO:0003684]; DNA binding, bending [GO:0008301]; DNA polymerase binding [GO:0070182]; DNA-binding transcription factor binding [GO:0140297]; double-stranded DNA binding [GO:0003690]; four-way junction DNA binding [GO:0000400]; integrin binding [GO:0005178]; lipopolysaccharide binding [GO:0001530]; lyase activity [GO:0016829]; phosphatidylserine binding [GO:0001786]; RAGE receptor binding [GO:0050786]; RNA binding [GO:0003723]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; single-stranded DNA binding [GO:0003697]; supercoiled DNA binding [GO:0097100]; transcription cis-regulatory region binding [GO:0000976]; transcription coactivator activity [GO:0003713]; transcription corepressor activity [GO:0003714]; activation of innate immune response [GO:0002218]; apoptotic cell clearance [GO:0043277]; autophagy [GO:0006914]; cellular response to lipopolysaccharide [GO:0071222]; dendritic cell chemotaxis [GO:0002407]; DNA geometric change [GO:0032392]; DNA recombination [GO:0006310]; DNA topological change [GO:0006265]; double-strand break repair via nonhomologous end joining [GO:0006303]; heterochromatin assembly [GO:0031507]; inflammatory response [GO:0006954]; inflammatory response to antigenic stimulus [GO:0002437]; innate immune response [GO:0045087]; myeloid dendritic cell activation [GO:0001773]; negative regulation of apoptotic cell clearance [GO:2000426]; negative regulation of blood vessel endothelial cell migration [GO:0043537]; negative regulation of CD4-positive, alpha-beta T cell differentiation [GO:0043371]; negative regulation of interferon-gamma production [GO:0032689]; negative regulation of RNA polymerase II transcription preinitiation complex assembly [GO:0017055]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neuron projection development [GO:0031175]; neutrophil clearance [GO:0097350]; positive regulation of activated T cell proliferation [GO:0042104]; positive regulation of apoptotic process [GO:0043065]; positive regulation of autophagy [GO:0010508]; positive regulation of blood vessel endothelial cell migration [GO:0043536]; positive regulation of chemokine (C-X-C motif) ligand 2 production [GO:2000343]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of dendritic cell differentiation [GO:2001200]; positive regulation of DNA binding [GO:0043388]; positive regulation of DNA ligation [GO:0051106]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of interleukin-1 production [GO:0032732]; positive regulation of interleukin-10 production [GO:0032733]; positive regulation of interleukin-12 production [GO:0032735]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of JNK cascade [GO:0046330]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of mismatch repair [GO:0032425]; positive regulation of monocyte chemotaxis [GO:0090026]; positive regulation of toll-like receptor 9 signaling pathway [GO:0034165]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of vascular endothelial cell proliferation [GO:1905564]; positive regulation of viral entry into host cell [GO:0046598]; regulation of restriction endodeoxyribonuclease activity [GO:0032072]; regulation of T cell mediated immune response to tumor cell [GO:0002840]; regulation of tolerance induction [GO:0002643]; regulation of transcription by RNA polymerase II [GO:0006357]; T-helper 1 cell activation [GO:0035711]; T-helper 1 cell differentiation [GO:0045063]; V(D)J recombination [GO:0033151]"	"bubble DNA binding [GO:0000405]; C-X-C chemokine binding [GO:0019958]; chemoattractant activity [GO:0042056]; cytokine activity [GO:0005125]; damaged DNA binding [GO:0003684]; DNA binding, bending [GO:0008301]; DNA polymerase binding [GO:0070182]; DNA-binding transcription factor binding [GO:0140297]; double-stranded DNA binding [GO:0003690]; four-way junction DNA binding [GO:0000400]; integrin binding [GO:0005178]; lipopolysaccharide binding [GO:0001530]; lyase activity [GO:0016829]; phosphatidylserine binding [GO:0001786]; RAGE receptor binding [GO:0050786]; RNA binding [GO:0003723]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; single-stranded DNA binding [GO:0003697]; supercoiled DNA binding [GO:0097100]; transcription cis-regulatory region binding [GO:0000976]; transcription coactivator activity [GO:0003713]; transcription corepressor activity [GO:0003714]"	GO:0000122; GO:0000400; GO:0000405; GO:0000793; GO:0000976; GO:0001530; GO:0001773; GO:0001786; GO:0002218; GO:0002407; GO:0002437; GO:0002643; GO:0002840; GO:0003684; GO:0003690; GO:0003697; GO:0003713; GO:0003714; GO:0003723; GO:0005125; GO:0005178; GO:0005576; GO:0005615; GO:0005634; GO:0005654; GO:0005768; GO:0005793; GO:0006265; GO:0006303; GO:0006310; GO:0006357; GO:0006914; GO:0006954; GO:0007204; GO:0008301; GO:0009986; GO:0010508; GO:0016829; GO:0017053; GO:0017055; GO:0019958; GO:0031175; GO:0031507; GO:0032072; GO:0032392; GO:0032425; GO:0032689; GO:0032732; GO:0032733; GO:0032735; GO:0032755; GO:0032757; GO:0032760; GO:0033151; GO:0034165; GO:0034774; GO:0035711; GO:0035868; GO:0042056; GO:0042104; GO:0043065; GO:0043277; GO:0043280; GO:0043371; GO:0043388; GO:0043410; GO:0043536; GO:0043537; GO:0045063; GO:0045087; GO:0045944; GO:0046330; GO:0046598; GO:0050786; GO:0051106; GO:0061629; GO:0070182; GO:0070374; GO:0071222; GO:0090026; GO:0097100; GO:0097350; GO:0140297; GO:1904813; GO:1905564; GO:2000343; GO:2000426; GO:2001200	ADKARYER	0.99573	14.544	14.2259	12.6218	11.3651	11.0213	13.3291	12.4463	14.3511	12.6894	11.772	13.3019	12.7819	13.0197	13.0394	12.1957
P49754	VPS41_HUMAN	Vacuolar protein sorting-associated protein 41 homolog (S53)	VPS41	Homo sapiens (Human)	cellular response to starvation [GO:0009267]; endosomal vesicle fusion [GO:0034058]; endosome to lysosome transport [GO:0008333]; Golgi vesicle transport [GO:0048193]; late endosome to lysosome transport [GO:1902774]; macroautophagy [GO:0016236]; protein targeting to vacuole [GO:0006623]; regulation of SNARE complex assembly [GO:0035542]; vesicle-mediated transport [GO:0016192]	clathrin-coated vesicle [GO:0030136]; cytosol [GO:0005829]; early endosome membrane [GO:0031901]; endosome membrane [GO:0010008]; Golgi apparatus [GO:0005794]; Golgi-associated vesicle [GO:0005798]; HOPS complex [GO:0030897]; late endosome [GO:0005770]; late endosome membrane [GO:0031902]; lysosomal HOPS complex [GO:1902501]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; membrane [GO:0016020]; microtubule cytoskeleton [GO:0015630]	clathrin-coated vesicle [GO:0030136]; cytosol [GO:0005829]; early endosome membrane [GO:0031901]; endosome membrane [GO:0010008]; Golgi apparatus [GO:0005794]; Golgi-associated vesicle [GO:0005798]; HOPS complex [GO:0030897]; late endosome [GO:0005770]; late endosome membrane [GO:0031902]; lysosomal HOPS complex [GO:1902501]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; membrane [GO:0016020]; microtubule cytoskeleton [GO:0015630]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; microtubule binding [GO:0008017]; cellular response to starvation [GO:0009267]; endosomal vesicle fusion [GO:0034058]; endosome to lysosome transport [GO:0008333]; Golgi vesicle transport [GO:0048193]; late endosome to lysosome transport [GO:1902774]; macroautophagy [GO:0016236]; protein targeting to vacuole [GO:0006623]; regulation of SNARE complex assembly [GO:0035542]; vesicle-mediated transport [GO:0016192]	identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; microtubule binding [GO:0008017]	GO:0005764; GO:0005765; GO:0005770; GO:0005794; GO:0005798; GO:0005829; GO:0006623; GO:0008017; GO:0008333; GO:0009267; GO:0010008; GO:0015630; GO:0016020; GO:0016192; GO:0016236; GO:0030136; GO:0030897; GO:0031901; GO:0031902; GO:0034058; GO:0035542; GO:0042802; GO:0046872; GO:0048193; GO:1902501; GO:1902774	AISPYLPR	1.0049	13.6336	12.202	14.5276	11.518	11.2309	9.96196	12.1504	13.2651	13.6592	15.5198	14.148	13.5398	12.8616	11.8198	12.6577
P49662	CASP4_HUMAN	Caspase-4 (CASP-4) (EC 3.4.22.57) (ICE and Ced-3 homolog 2) (ICH-2) (ICE(rel)-II) (Mih1) (Protease TX) [Cleaved into: Caspase-4 subunit p10; Caspase-4 subunit p20]	CASP4 ICH2	Homo sapiens (Human)	apoptotic process [GO:0006915]; cellular response to amyloid-beta [GO:1904646]; defense response to Gram-positive bacterium [GO:0050830]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; intrinsic apoptotic signaling pathway [GO:0097193]; intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress [GO:0070059]; positive regulation of inflammatory response [GO:0050729]; positive regulation of interleukin-18-mediated signaling pathway [GO:2000494]; positive regulation of tumor necrosis factor-mediated signaling pathway [GO:1903265]; protein autoprocessing [GO:0016540]; proteolysis [GO:0006508]; pyroptosis [GO:0070269]; regulation of apoptotic process [GO:0042981]; regulation of inflammatory response [GO:0050727]	AIM2 inflammasome complex [GO:0097169]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; extracellular region [GO:0005576]; IPAF inflammasome complex [GO:0072557]; mitochondrion [GO:0005739]; NLRP3 inflammasome complex [GO:0072559]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]	AIM2 inflammasome complex [GO:0097169]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; extracellular region [GO:0005576]; IPAF inflammasome complex [GO:0072557]; mitochondrion [GO:0005739]; NLRP3 inflammasome complex [GO:0072559]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; CARD domain binding [GO:0050700]; cysteine-type endopeptidase activity [GO:0004197]; cysteine-type endopeptidase activity involved in apoptotic signaling pathway [GO:0097199]; apoptotic process [GO:0006915]; cellular response to amyloid-beta [GO:1904646]; defense response to Gram-positive bacterium [GO:0050830]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; intrinsic apoptotic signaling pathway [GO:0097193]; intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress [GO:0070059]; positive regulation of inflammatory response [GO:0050729]; positive regulation of interleukin-18-mediated signaling pathway [GO:2000494]; positive regulation of tumor necrosis factor-mediated signaling pathway [GO:1903265]; protein autoprocessing [GO:0016540]; proteolysis [GO:0006508]; pyroptosis [GO:0070269]; regulation of apoptotic process [GO:0042981]; regulation of inflammatory response [GO:0050727]	CARD domain binding [GO:0050700]; cysteine-type endopeptidase activity [GO:0004197]; cysteine-type endopeptidase activity involved in apoptotic signaling pathway [GO:0097199]	GO:0004197; GO:0005576; GO:0005737; GO:0005739; GO:0005783; GO:0005789; GO:0005829; GO:0005886; GO:0006508; GO:0006915; GO:0006954; GO:0016540; GO:0032991; GO:0042981; GO:0045087; GO:0050700; GO:0050727; GO:0050729; GO:0050830; GO:0070059; GO:0070269; GO:0072557; GO:0072559; GO:0097169; GO:0097193; GO:0097199; GO:1903265; GO:1904646; GO:2000494	AEEIYPIKER	1.0108	12.8295	12.8613	12.9961	12.1191	12.3366	12.6911	11.5796	14.8984	14.5741	13.6574	12.7119	13.6857	11.5543	11.3963	12.6791
Q96CW1	AP2M1_HUMAN	AP-2 complex subunit mu (AP-2 mu chain) (Adaptin-mu2) (Adaptor protein complex AP-2 subunit mu) (Adaptor-related protein complex 2 subunit mu) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (HA2 50 kDa subunit) (Plasma membrane adaptor AP-2 50 kDa protein)	AP2M1 CLAPM1 KIAA0109	Homo sapiens (Human)	clathrin-dependent endocytosis [GO:0072583]; endocytosis [GO:0006897]; intracellular protein transport [GO:0006886]; negative regulation of protein localization to plasma membrane [GO:1903077]; positive regulation of receptor internalization [GO:0002092]; positive regulation of synaptic vesicle endocytosis [GO:1900244]; postsynaptic neurotransmitter receptor internalization [GO:0098884]; protein-containing complex assembly [GO:0065003]; receptor internalization [GO:0031623]; regulation of vesicle size [GO:0097494]; synaptic vesicle endocytosis [GO:0048488]; vesicle budding from membrane [GO:0006900]; vesicle-mediated transport [GO:0016192]	AP-2 adaptor complex [GO:0030122]; clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated endocytic vesicle membrane [GO:0030669]; clathrin-coated pit [GO:0005905]; cytoplasmic side of plasma membrane [GO:0009898]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; endocytic vesicle membrane [GO:0030666]; endolysosome membrane [GO:0036020]; extracellular exosome [GO:0070062]; glutamatergic synapse [GO:0098978]; lysosomal membrane [GO:0005765]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; presynapse [GO:0098793]	AP-2 adaptor complex [GO:0030122]; clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated endocytic vesicle membrane [GO:0030669]; clathrin-coated pit [GO:0005905]; cytoplasmic side of plasma membrane [GO:0009898]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; endocytic vesicle membrane [GO:0030666]; endolysosome membrane [GO:0036020]; extracellular exosome [GO:0070062]; glutamatergic synapse [GO:0098978]; lysosomal membrane [GO:0005765]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; presynapse [GO:0098793]; clathrin adaptor activity [GO:0035615]; disordered domain specific binding [GO:0097718]; lipid binding [GO:0008289]; low-density lipoprotein particle receptor binding [GO:0050750]; signal sequence binding [GO:0005048]; transmembrane transporter binding [GO:0044325]; clathrin-dependent endocytosis [GO:0072583]; endocytosis [GO:0006897]; intracellular protein transport [GO:0006886]; negative regulation of protein localization to plasma membrane [GO:1903077]; positive regulation of receptor internalization [GO:0002092]; positive regulation of synaptic vesicle endocytosis [GO:1900244]; postsynaptic neurotransmitter receptor internalization [GO:0098884]; protein-containing complex assembly [GO:0065003]; receptor internalization [GO:0031623]; regulation of vesicle size [GO:0097494]; synaptic vesicle endocytosis [GO:0048488]; vesicle budding from membrane [GO:0006900]; vesicle-mediated transport [GO:0016192]	clathrin adaptor activity [GO:0035615]; disordered domain specific binding [GO:0097718]; lipid binding [GO:0008289]; low-density lipoprotein particle receptor binding [GO:0050750]; signal sequence binding [GO:0005048]; transmembrane transporter binding [GO:0044325]	GO:0002092; GO:0005048; GO:0005765; GO:0005829; GO:0005886; GO:0005905; GO:0006886; GO:0006897; GO:0006900; GO:0008289; GO:0009898; GO:0016192; GO:0030122; GO:0030666; GO:0030669; GO:0031410; GO:0031623; GO:0035615; GO:0036020; GO:0044325; GO:0045334; GO:0048488; GO:0050750; GO:0065003; GO:0070062; GO:0072583; GO:0097494; GO:0097718; GO:0098793; GO:0098794; GO:0098884; GO:0098978; GO:1900244; GO:1903077	AKYKASENAIVWK	1.0191	13.6287	13.9177	13.2101	8.56701	10.8342	13.3548	13.5078	13.1196	12.6645	14.9807	15.276	13.9196	11.6335	12.1711	11.6983
Q02410	APBA1_HUMAN	Amyloid-beta A4 precursor protein-binding family A member 1 (Adapter protein X11alpha) (Neuron-specific X11 protein) (Neuronal Munc18-1-interacting protein 1) (Mint-1)	APBA1 MINT1 X11	Homo sapiens (Human)	axo-dendritic transport [GO:0008088]; cell adhesion [GO:0007155]; chemical synaptic transmission [GO:0007268]; gamma-aminobutyric acid secretion [GO:0014051]; glutamate secretion [GO:0014047]; in utero embryonic development [GO:0001701]; intracellular protein transport [GO:0006886]; locomotory behavior [GO:0007626]; multicellular organism growth [GO:0035264]; nervous system development [GO:0007399]; protein-containing complex assembly [GO:0065003]; regulation of gene expression [GO:0010468]; regulation of synaptic vesicle exocytosis [GO:2000300]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendritic spine [GO:0043197]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; presynaptic active zone membrane [GO:0048787]; Schaffer collateral - CA1 synapse [GO:0098685]; synaptic vesicle [GO:0008021]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendritic spine [GO:0043197]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; presynaptic active zone membrane [GO:0048787]; Schaffer collateral - CA1 synapse [GO:0098685]; synaptic vesicle [GO:0008021]; amyloid-beta binding [GO:0001540]; axo-dendritic transport [GO:0008088]; cell adhesion [GO:0007155]; chemical synaptic transmission [GO:0007268]; gamma-aminobutyric acid secretion [GO:0014051]; glutamate secretion [GO:0014047]; in utero embryonic development [GO:0001701]; intracellular protein transport [GO:0006886]; locomotory behavior [GO:0007626]; multicellular organism growth [GO:0035264]; nervous system development [GO:0007399]; protein-containing complex assembly [GO:0065003]; regulation of gene expression [GO:0010468]; regulation of synaptic vesicle exocytosis [GO:2000300]	amyloid-beta binding [GO:0001540]	GO:0001540; GO:0001701; GO:0005634; GO:0005737; GO:0005794; GO:0005829; GO:0005886; GO:0006886; GO:0007155; GO:0007268; GO:0007399; GO:0007626; GO:0008021; GO:0008088; GO:0010468; GO:0014047; GO:0014051; GO:0035264; GO:0043197; GO:0048471; GO:0048787; GO:0065003; GO:0098685; GO:0098978; GO:2000300	ALEDLRAQLGQEEEER	0.93455	13.4376	11.3249	12.5176	11.9719	11.8061	11.91	13.6724	11.847	13.4045	13.4278	13.8763	13.8263	13.6853	13.0273	12.553
Q9UKF2	ADA30_HUMAN	Disintegrin and metalloproteinase domain-containing protein 30 (ADAM 30) (EC 3.4.24.-)	ADAM30 UNQ2509/PRO5997	Homo sapiens (Human)	proteolysis [GO:0006508]	external side of plasma membrane [GO:0009897]; integral component of membrane [GO:0016021]; late endosome membrane [GO:0031902]; plasma membrane [GO:0005886]; sperm head plasma membrane [GO:1990913]	external side of plasma membrane [GO:0009897]; integral component of membrane [GO:0016021]; late endosome membrane [GO:0031902]; plasma membrane [GO:0005886]; sperm head plasma membrane [GO:1990913]; metalloendopeptidase activity [GO:0004222]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]; proteolysis [GO:0006508]	metalloendopeptidase activity [GO:0004222]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]	GO:0004222; GO:0005886; GO:0006508; GO:0008237; GO:0008270; GO:0009897; GO:0016021; GO:0031902; GO:1990913	AKTEQEESK	1.008	12.9647	13.6976	14.4725	11.2524	10.4503	11.5235	11.5986	13.3028	13.7105	14.0374	14.8456	13.3573	11.8311	12.7961	12.2602
O95992	CH25H_HUMAN	Cholesterol 25-hydroxylase (EC 1.14.99.38) (Cholesterol 25-monooxygenase) (h25OH)	CH25H	Homo sapiens (Human)	B cell chemotaxis [GO:0035754]; cholesterol metabolic process [GO:0008203]; lipid metabolic process [GO:0006629]; negative regulation of fusion of virus membrane with host plasma membrane [GO:1903914]; response to type I interferon [GO:0034340]; sterol biosynthetic process [GO:0016126]	cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; membrane [GO:0016020]	cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; C-4 methylsterol oxidase activity [GO:0000254]; cholesterol 25-hydroxylase activity [GO:0001567]; iron ion binding [GO:0005506]; oxidoreductase activity [GO:0016491]; steroid hydroxylase activity [GO:0008395]; B cell chemotaxis [GO:0035754]; cholesterol metabolic process [GO:0008203]; lipid metabolic process [GO:0006629]; negative regulation of fusion of virus membrane with host plasma membrane [GO:1903914]; response to type I interferon [GO:0034340]; sterol biosynthetic process [GO:0016126]	C-4 methylsterol oxidase activity [GO:0000254]; cholesterol 25-hydroxylase activity [GO:0001567]; iron ion binding [GO:0005506]; oxidoreductase activity [GO:0016491]; steroid hydroxylase activity [GO:0008395]	GO:0000254; GO:0001567; GO:0005506; GO:0005789; GO:0005829; GO:0006629; GO:0008203; GO:0008395; GO:0016020; GO:0016021; GO:0016126; GO:0016491; GO:0034340; GO:0035754; GO:1903914	ILGTLRTASVPAR	0.75285	12.7704	12.8833	12.425	12.8071	12.7079	12.7804	9.53265	13.2046	11.244	14.7873	14.9758	14.7173	14.6079	11.3628	11.2
O43524	FOXO3_HUMAN	Forkhead box protein O3 (AF6q21 protein) (Forkhead in rhabdomyosarcoma-like 1)	FOXO3 FKHRL1 FOXO3A	Homo sapiens (Human)	"aging [GO:0007568]; antral ovarian follicle growth [GO:0001547]; brain morphogenesis [GO:0048854]; canonical Wnt signaling pathway [GO:0060070]; cellular response to amyloid-beta [GO:1904646]; cellular response to corticosterone stimulus [GO:0071386]; cellular response to glucose starvation [GO:0042149]; cellular response to glucose stimulus [GO:0071333]; cellular response to hypoxia [GO:0071456]; cellular response to nerve growth factor stimulus [GO:1990090]; cellular response to oxidative stress [GO:0034599]; DNA damage response, signal transduction by p53 class mediator [GO:0030330]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; initiation of primordial ovarian follicle growth [GO:0001544]; mitochondrial transcription [GO:0006390]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cell migration [GO:0030336]; negative regulation of neuron differentiation [GO:0045665]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neuronal stem cell population maintenance [GO:0097150]; oocyte maturation [GO:0001556]; ovulation from ovarian follicle [GO:0001542]; positive regulation of apoptotic process [GO:0043065]; positive regulation of autophagy [GO:0010508]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of endothelial cell apoptotic process [GO:2000353]; positive regulation of erythrocyte differentiation [GO:0045648]; positive regulation of hydrogen peroxide-mediated programmed cell death [GO:1901300]; positive regulation of miRNA transcription [GO:1902895]; positive regulation of muscle atrophy [GO:0014737]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of reactive oxygen species biosynthetic process [GO:1903428]; positive regulation of regulatory T cell differentiation [GO:0045591]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of neural precursor cell proliferation [GO:2000177]; regulation of transcription by RNA polymerase II [GO:0006357]; regulation of translation [GO:0006417]; response to dexamethasone [GO:0071548]; response to fatty acid [GO:0070542]; response to starvation [GO:0042594]; response to water-immersion restraint stress [GO:1990785]; response to xenobiotic stimulus [GO:0009410]; tumor necrosis factor-mediated signaling pathway [GO:0033209]"	chromatin [GO:0000785]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; mitochondrial outer membrane [GO:0005741]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]; RNA polymerase II transcription repressor complex [GO:0090571]	"chromatin [GO:0000785]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; mitochondrial outer membrane [GO:0005741]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]; RNA polymerase II transcription repressor complex [GO:0090571]; beta-catenin binding [GO:0008013]; chromatin DNA binding [GO:0031490]; DNA binding [GO:0003677]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; mitochondrial transcription factor activity [GO:0034246]; protein kinase binding [GO:0019901]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]; sequence-specific double-stranded DNA binding [GO:1990837]; transcription cis-regulatory region binding [GO:0000976]; transcription coregulator binding [GO:0001221]; aging [GO:0007568]; antral ovarian follicle growth [GO:0001547]; brain morphogenesis [GO:0048854]; canonical Wnt signaling pathway [GO:0060070]; cellular response to amyloid-beta [GO:1904646]; cellular response to corticosterone stimulus [GO:0071386]; cellular response to glucose starvation [GO:0042149]; cellular response to glucose stimulus [GO:0071333]; cellular response to hypoxia [GO:0071456]; cellular response to nerve growth factor stimulus [GO:1990090]; cellular response to oxidative stress [GO:0034599]; DNA damage response, signal transduction by p53 class mediator [GO:0030330]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; initiation of primordial ovarian follicle growth [GO:0001544]; mitochondrial transcription [GO:0006390]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cell migration [GO:0030336]; negative regulation of neuron differentiation [GO:0045665]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neuronal stem cell population maintenance [GO:0097150]; oocyte maturation [GO:0001556]; ovulation from ovarian follicle [GO:0001542]; positive regulation of apoptotic process [GO:0043065]; positive regulation of autophagy [GO:0010508]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of endothelial cell apoptotic process [GO:2000353]; positive regulation of erythrocyte differentiation [GO:0045648]; positive regulation of hydrogen peroxide-mediated programmed cell death [GO:1901300]; positive regulation of miRNA transcription [GO:1902895]; positive regulation of muscle atrophy [GO:0014737]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of reactive oxygen species biosynthetic process [GO:1903428]; positive regulation of regulatory T cell differentiation [GO:0045591]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of neural precursor cell proliferation [GO:2000177]; regulation of transcription by RNA polymerase II [GO:0006357]; regulation of translation [GO:0006417]; response to dexamethasone [GO:0071548]; response to fatty acid [GO:0070542]; response to starvation [GO:0042594]; response to water-immersion restraint stress [GO:1990785]; response to xenobiotic stimulus [GO:0009410]; tumor necrosis factor-mediated signaling pathway [GO:0033209]"	"beta-catenin binding [GO:0008013]; chromatin DNA binding [GO:0031490]; DNA binding [GO:0003677]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; mitochondrial transcription factor activity [GO:0034246]; protein kinase binding [GO:0019901]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]; sequence-specific double-stranded DNA binding [GO:1990837]; transcription cis-regulatory region binding [GO:0000976]; transcription coregulator binding [GO:0001221]"	GO:0000122; GO:0000785; GO:0000976; GO:0000978; GO:0000981; GO:0001221; GO:0001227; GO:0001228; GO:0001542; GO:0001544; GO:0001547; GO:0001556; GO:0003677; GO:0003700; GO:0005634; GO:0005654; GO:0005737; GO:0005741; GO:0005759; GO:0005829; GO:0006357; GO:0006390; GO:0006417; GO:0007568; GO:0008013; GO:0009410; GO:0010508; GO:0014737; GO:0019901; GO:0030330; GO:0030336; GO:0031490; GO:0032991; GO:0033209; GO:0034246; GO:0034599; GO:0042149; GO:0042594; GO:0043065; GO:0043525; GO:0043565; GO:0045591; GO:0045648; GO:0045665; GO:0045893; GO:0045944; GO:0048854; GO:0060070; GO:0070542; GO:0071333; GO:0071386; GO:0071456; GO:0071548; GO:0090090; GO:0090571; GO:0097150; GO:0097192; GO:1901300; GO:1902895; GO:1903428; GO:1904646; GO:1990090; GO:1990785; GO:1990837; GO:2000177; GO:2000353	AALQTAPESADDSPSQLSK	0.97978	12.4228	12.0935	8.98439	11.851	14.3648	12.9253	13.2953	13.6941	12.7494	13.4727	13.2598	14.9481	12.5621	12.7034	12.6679
Q13501	SQSTM_HUMAN	Sequestosome-1 (EBI3-associated protein of 60 kDa) (EBIAP) (p60) (Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa) (Ubiquitin-binding protein p62)	SQSTM1 ORCA OSIL	Homo sapiens (Human)	aggrephagy [GO:0035973]; apoptotic process [GO:0006915]; autophagy [GO:0006914]; autophagy of mitochondrion [GO:0000422]; brown fat cell proliferation [GO:0070342]; cell differentiation [GO:0030154]; endosomal transport [GO:0016197]; endosome organization [GO:0007032]; energy homeostasis [GO:0097009]; immune system process [GO:0002376]; intracellular signal transduction [GO:0035556]; macroautophagy [GO:0016236]; mitophagy [GO:0000423]; negative regulation of protein ubiquitination [GO:0031397]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of apoptotic process [GO:0043065]; positive regulation of long-term synaptic potentiation [GO:1900273]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein import into nucleus [GO:0006606]; protein localization [GO:0008104]; protein localization to perinuclear region of cytoplasm [GO:1905719]; protein phosphorylation [GO:0006468]; regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043122]; regulation of mitochondrion organization [GO:0010821]; regulation of protein complex stability [GO:0061635]; regulation of Ras protein signal transduction [GO:0046578]; response to ischemia [GO:0002931]; response to mitochondrial depolarisation [GO:0098780]; selective autophagy [GO:0061912]; temperature homeostasis [GO:0001659]; transcription by RNA polymerase II [GO:0006366]; ubiquitin-dependent protein catabolic process [GO:0006511]	aggresome [GO:0016235]; amphisome [GO:0044753]; autolysosome [GO:0044754]; autophagosome [GO:0005776]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; extracellular exosome [GO:0070062]; inclusion body [GO:0016234]; intracellular membrane-bounded organelle [GO:0043231]; late endosome [GO:0005770]; Lewy body [GO:0097413]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; P-body [GO:0000932]; phagophore assembly site [GO:0000407]; PML body [GO:0016605]; sarcomere [GO:0030017]; sperm midpiece [GO:0097225]	aggresome [GO:0016235]; amphisome [GO:0044753]; autolysosome [GO:0044754]; autophagosome [GO:0005776]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; extracellular exosome [GO:0070062]; inclusion body [GO:0016234]; intracellular membrane-bounded organelle [GO:0043231]; late endosome [GO:0005770]; Lewy body [GO:0097413]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; P-body [GO:0000932]; phagophore assembly site [GO:0000407]; PML body [GO:0016605]; sarcomere [GO:0030017]; sperm midpiece [GO:0097225]; enzyme binding [GO:0019899]; identical protein binding [GO:0042802]; ionotropic glutamate receptor binding [GO:0035255]; K63-linked polyubiquitin modification-dependent protein binding [GO:0070530]; protein kinase binding [GO:0019901]; protein kinase C binding [GO:0005080]; protein serine/threonine kinase activity [GO:0004674]; protein-containing complex binding [GO:0044877]; receptor tyrosine kinase binding [GO:0030971]; SH2 domain binding [GO:0042169]; ubiquitin binding [GO:0043130]; ubiquitin protein ligase binding [GO:0031625]; zinc ion binding [GO:0008270]; aggrephagy [GO:0035973]; apoptotic process [GO:0006915]; autophagy [GO:0006914]; autophagy of mitochondrion [GO:0000422]; brown fat cell proliferation [GO:0070342]; cell differentiation [GO:0030154]; endosomal transport [GO:0016197]; endosome organization [GO:0007032]; energy homeostasis [GO:0097009]; immune system process [GO:0002376]; intracellular signal transduction [GO:0035556]; macroautophagy [GO:0016236]; mitophagy [GO:0000423]; negative regulation of protein ubiquitination [GO:0031397]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of apoptotic process [GO:0043065]; positive regulation of long-term synaptic potentiation [GO:1900273]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein import into nucleus [GO:0006606]; protein localization [GO:0008104]; protein localization to perinuclear region of cytoplasm [GO:1905719]; protein phosphorylation [GO:0006468]; regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043122]; regulation of mitochondrion organization [GO:0010821]; regulation of protein complex stability [GO:0061635]; regulation of Ras protein signal transduction [GO:0046578]; response to ischemia [GO:0002931]; response to mitochondrial depolarisation [GO:0098780]; selective autophagy [GO:0061912]; temperature homeostasis [GO:0001659]; transcription by RNA polymerase II [GO:0006366]; ubiquitin-dependent protein catabolic process [GO:0006511]	enzyme binding [GO:0019899]; identical protein binding [GO:0042802]; ionotropic glutamate receptor binding [GO:0035255]; K63-linked polyubiquitin modification-dependent protein binding [GO:0070530]; protein kinase binding [GO:0019901]; protein kinase C binding [GO:0005080]; protein serine/threonine kinase activity [GO:0004674]; protein-containing complex binding [GO:0044877]; receptor tyrosine kinase binding [GO:0030971]; SH2 domain binding [GO:0042169]; ubiquitin binding [GO:0043130]; ubiquitin protein ligase binding [GO:0031625]; zinc ion binding [GO:0008270]	GO:0000122; GO:0000407; GO:0000422; GO:0000423; GO:0000932; GO:0001659; GO:0001934; GO:0002376; GO:0002931; GO:0004674; GO:0005080; GO:0005654; GO:0005737; GO:0005739; GO:0005770; GO:0005776; GO:0005783; GO:0005829; GO:0006366; GO:0006468; GO:0006511; GO:0006606; GO:0006914; GO:0006915; GO:0007032; GO:0008104; GO:0008270; GO:0010821; GO:0016197; GO:0016234; GO:0016235; GO:0016236; GO:0016605; GO:0019899; GO:0019901; GO:0030017; GO:0030154; GO:0030971; GO:0031397; GO:0031625; GO:0035255; GO:0035556; GO:0035973; GO:0042169; GO:0042802; GO:0043065; GO:0043122; GO:0043130; GO:0043231; GO:0044753; GO:0044754; GO:0044877; GO:0045944; GO:0046578; GO:0061635; GO:0061912; GO:0070062; GO:0070342; GO:0070530; GO:0097009; GO:0097225; GO:0097413; GO:0098780; GO:1900273; GO:1903078; GO:1905719	AGEARPGPTAESASGPSEDPSVNFLK	0.14851	13.6471	13.9413	13.6344	12.8182	9.58429	9.53557	11.1442	13.2598	13.2998	14.4441	14.425	14.2333	10.3628	13.7506	13.7395
P05067	A4_HUMAN	Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid peptide) (CVAP) (PreA4) (Protease nexin-II) (PN-II) [Cleaved into: N-APP; Soluble APP-alpha (S-APP-alpha); Soluble APP-beta (S-APP-beta); C99 (Beta-secretase C-terminal fragment) (Beta-CTF); Amyloid-beta protein 42 (Abeta42) (Beta-APP42); Amyloid-beta protein 40 (Abeta40) (Beta-APP40); C83 (Alpha-secretase C-terminal fragment) (Alpha-CTF); P3(42); P3(40); C80; Gamma-secretase C-terminal fragment 59 (Amyloid intracellular domain 59) (AICD-59) (AID(59)) (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Amyloid intracellular domain 57) (AICD-57) (AID(57)) (Gamma-CTF(57)); Gamma-secretase C-terminal fragment 50 (Amyloid intracellular domain 50) (AICD-50) (AID(50)) (Gamma-CTF(50)); C31]	APP A4 AD1	Homo sapiens (Human)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway [GO:0007193]; adult locomotory behavior [GO:0008344]; amyloid fibril formation [GO:1990000]; antibacterial humoral response [GO:0019731]; antifungal humoral response [GO:0019732]; antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; associative learning [GO:0008306]; astrocyte activation [GO:0048143]; astrocyte activation involved in immune response [GO:0002265]; axo-dendritic transport [GO:0008088]; axon midline choice point recognition [GO:0016199]; axonogenesis [GO:0007409]; calcium-mediated signaling [GO:0019722]; cell adhesion [GO:0007155]; cellular copper ion homeostasis [GO:0006878]; cellular response to amyloid-beta [GO:1904646]; cellular response to cAMP [GO:0071320]; cellular response to copper ion [GO:0071280]; cellular response to manganese ion [GO:0071287]; cellular response to nerve growth factor stimulus [GO:1990090]; cellular response to norepinephrine stimulus [GO:0071874]; central nervous system development [GO:0007417]; cholesterol metabolic process [GO:0008203]; cognition [GO:0050890]; collateral sprouting in absence of injury [GO:0048669]; defense response to Gram-negative bacterium [GO:0050829]; defense response to Gram-positive bacterium [GO:0050830]; dendrite development [GO:0016358]; endocytosis [GO:0006897]; extracellular matrix organization [GO:0030198]; forebrain development [GO:0030900]; G protein-coupled receptor signaling pathway [GO:0007186]; G2/M transition of mitotic cell cycle [GO:0000086]; innate immune response [GO:0045087]; ionotropic glutamate receptor signaling pathway [GO:0035235]; learning [GO:0007612]; learning or memory [GO:0007611]; lipoprotein metabolic process [GO:0042157]; locomotory behavior [GO:0007626]; mating behavior [GO:0007617]; memory [GO:0007613]; microglia development [GO:0014005]; microglial cell activation [GO:0001774]; modulation of excitatory postsynaptic potential [GO:0098815]; mRNA polyadenylation [GO:0006378]; negative regulation of blood circulation [GO:1903523]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of dendritic spine maintenance [GO:1902951]; negative regulation of gene expression [GO:0010629]; negative regulation of long-term synaptic potentiation [GO:1900272]; negative regulation of miRNA transcription [GO:1902894]; negative regulation of mitochondrion organization [GO:0010823]; negative regulation of neuron death [GO:1901215]; negative regulation of neuron differentiation [GO:0045665]; negative regulation of protein localization to nucleus [GO:1900181]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of Wnt signaling pathway [GO:0030178]; neuromuscular process controlling balance [GO:0050885]; neuron apoptotic process [GO:0051402]; neuron cellular homeostasis [GO:0070050]; neuron projection development [GO:0031175]; neuron projection maintenance [GO:1990535]; neuron remodeling [GO:0016322]; Notch signaling pathway [GO:0007219]; positive regulation of 1-phosphatidylinositol-3-kinase activity [GO:0061903]; positive regulation of amyloid fibril formation [GO:1905908]; positive regulation of apoptotic process [GO:0043065]; positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902961]; positive regulation of cell activation [GO:0050867]; positive regulation of cellular response to thapsigargin [GO:1905893]; positive regulation of cellular response to tunicamycin [GO:1905896]; positive regulation of chemokine production [GO:0032722]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of endothelin production [GO:1904472]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of excitatory postsynaptic potential [GO:2000463]; positive regulation of G protein-coupled receptor internalization [GO:1904022]; positive regulation of G protein-coupled receptor signaling pathway [GO:0045745]; positive regulation of G2/M transition of mitotic cell cycle [GO:0010971]; positive regulation of gene expression [GO:0010628]; positive regulation of glycolytic process [GO:0045821]; positive regulation of histone acetylation [GO:0035066]; positive regulation of inflammatory response [GO:0050729]; positive regulation of interferon-gamma production [GO:0032729]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of JNK cascade [GO:0046330]; positive regulation of long-term synaptic depression [GO:1900454]; positive regulation of long-term synaptic potentiation [GO:1900273]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of membrane protein ectodomain proteolysis [GO:0051044]; positive regulation of mitotic cell cycle [GO:0045931]; positive regulation of monocyte chemotaxis [GO:0090026]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of neuron death [GO:1901216]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of oxidative stress-induced neuron death [GO:1903223]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of peptidyl-threonine phosphorylation [GO:0010800]; positive regulation of phosphorylation [GO:0042327]; positive regulation of protein binding [GO:0032092]; positive regulation of protein import [GO:1904591]; positive regulation of protein kinase A signaling [GO:0010739]; positive regulation of protein kinase B signaling [GO:0051897]; positive regulation of protein metabolic process [GO:0051247]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein tyrosine kinase activity [GO:0061098]; positive regulation of receptor binding [GO:1900122]; positive regulation of response to endoplasmic reticulum stress [GO:1905898]; positive regulation of superoxide anion generation [GO:0032930]; positive regulation of T cell migration [GO:2000406]; positive regulation of tau-protein kinase activity [GO:1902949]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of tumor necrosis factor production [GO:0032760]; protein homooligomerization [GO:0051260]; protein phosphorylation [GO:0006468]; protein tetramerization [GO:0051262]; protein trimerization [GO:0070206]; regulation of acetylcholine-gated cation channel activity [GO:1903048]; regulation of amyloid fibril formation [GO:1905906]; regulation of amyloid-beta clearance [GO:1900221]; regulation of cellular protein metabolic process [GO:0032268]; regulation of dendritic spine maintenance [GO:1902950]; regulation of epidermal growth factor-activated receptor activity [GO:0007176]; regulation of gene expression [GO:0010468]; regulation of long-term neuronal synaptic plasticity [GO:0048169]; regulation of MAPK cascade [GO:0043408]; regulation of multicellular organism growth [GO:0040014]; regulation of NMDA receptor activity [GO:2000310]; regulation of peptidyl-tyrosine phosphorylation [GO:0050730]; regulation of presynapse assembly [GO:1905606]; regulation of protein tyrosine kinase activity [GO:0061097]; regulation of response to calcium ion [GO:1905945]; regulation of signaling receptor activity [GO:0010469]; regulation of spontaneous synaptic transmission [GO:0150003]; regulation of synapse structure or activity [GO:0050803]; regulation of toll-like receptor signaling pathway [GO:0034121]; regulation of transcription by RNA polymerase II [GO:0006357]; regulation of translation [GO:0006417]; regulation of Wnt signaling pathway [GO:0030111]; response to interleukin-1 [GO:0070555]; response to lead ion [GO:0010288]; response to oxidative stress [GO:0006979]; response to yeast [GO:0001878]; smooth endoplasmic reticulum calcium ion homeostasis [GO:0051563]; suckling behavior [GO:0001967]; synapse organization [GO:0050808]; synaptic assembly at neuromuscular junction [GO:0051124]; visual learning [GO:0008542]	amyloid-beta complex [GO:0106003]; apical part of cell [GO:0045177]; astrocyte projection [GO:0097449]; axon [GO:0030424]; cell surface [GO:0009986]; cell-cell junction [GO:0005911]; ciliary rootlet [GO:0035253]; clathrin-coated pit [GO:0005905]; COPII-coated ER to Golgi transport vesicle [GO:0030134]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendritic shaft [GO:0043198]; dendritic spine [GO:0043197]; early endosome [GO:0005769]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; endosome [GO:0005768]; endosome lumen [GO:0031904]; endosome to plasma membrane transport vesicle [GO:0070381]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; Golgi lumen [GO:0005796]; Golgi-associated vesicle [GO:0005798]; growth cone filopodium [GO:1990812]; growth cone lamellipodium [GO:1990761]; high-density lipoprotein particle [GO:0034364]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; intermediate-density lipoprotein particle [GO:0034363]; lipoprotein particle [GO:1990777]; main axon [GO:0044304]; membrane [GO:0016020]; membrane raft [GO:0045121]; mitochondrion [GO:0005739]; neuromuscular junction [GO:0031594]; nuclear envelope lumen [GO:0005641]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; platelet alpha granule lumen [GO:0031093]; presynaptic active zone [GO:0048786]; protein-containing complex [GO:0032991]; receptor complex [GO:0043235]; recycling endosome [GO:0055037]; rough endoplasmic reticulum [GO:0005791]; smooth endoplasmic reticulum [GO:0005790]; spindle midzone [GO:0051233]; synapse [GO:0045202]; synaptic vesicle [GO:0008021]; trans-Golgi network membrane [GO:0032588]	amyloid-beta complex [GO:0106003]; apical part of cell [GO:0045177]; astrocyte projection [GO:0097449]; axon [GO:0030424]; cell surface [GO:0009986]; cell-cell junction [GO:0005911]; ciliary rootlet [GO:0035253]; clathrin-coated pit [GO:0005905]; COPII-coated ER to Golgi transport vesicle [GO:0030134]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendritic shaft [GO:0043198]; dendritic spine [GO:0043197]; early endosome [GO:0005769]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; endosome [GO:0005768]; endosome lumen [GO:0031904]; endosome to plasma membrane transport vesicle [GO:0070381]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; Golgi lumen [GO:0005796]; Golgi-associated vesicle [GO:0005798]; growth cone filopodium [GO:1990812]; growth cone lamellipodium [GO:1990761]; high-density lipoprotein particle [GO:0034364]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; intermediate-density lipoprotein particle [GO:0034363]; lipoprotein particle [GO:1990777]; main axon [GO:0044304]; membrane [GO:0016020]; membrane raft [GO:0045121]; mitochondrion [GO:0005739]; neuromuscular junction [GO:0031594]; nuclear envelope lumen [GO:0005641]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; platelet alpha granule lumen [GO:0031093]; presynaptic active zone [GO:0048786]; protein-containing complex [GO:0032991]; receptor complex [GO:0043235]; recycling endosome [GO:0055037]; rough endoplasmic reticulum [GO:0005791]; smooth endoplasmic reticulum [GO:0005790]; spindle midzone [GO:0051233]; synapse [GO:0045202]; synaptic vesicle [GO:0008021]; trans-Golgi network membrane [GO:0032588]; acetylcholine receptor activator activity [GO:0030549]; acetylcholine receptor binding [GO:0033130]; amylin binding [GO:0097645]; apolipoprotein binding [GO:0034185]; chaperone binding [GO:0051087]; chemoattractant activity [GO:0042056]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; enzyme binding [GO:0019899]; ephrin receptor binding [GO:0046875]; frizzled binding [GO:0005109]; G protein-coupled receptor binding [GO:0001664]; growth factor receptor binding [GO:0070851]; heparan sulfate binding [GO:1904399]; heparan sulfate proteoglycan binding [GO:0043395]; heparin binding [GO:0008201]; identical protein binding [GO:0042802]; insulin receptor binding [GO:0005158]; integrin binding [GO:0005178]; low-density lipoprotein particle receptor binding [GO:0050750]; peptidase activator activity [GO:0016504]; protein dimerization activity [GO:0046983]; protein heterodimerization activity [GO:0046982]; protein homodimerization activity [GO:0042803]; PTB domain binding [GO:0051425]; RAGE receptor binding [GO:0050786]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; serine-type endopeptidase inhibitor activity [GO:0004867]; signaling receptor activator activity [GO:0030546]; signaling receptor binding [GO:0005102]; transition metal ion binding [GO:0046914]; adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway [GO:0007193]; adult locomotory behavior [GO:0008344]; amyloid fibril formation [GO:1990000]; antibacterial humoral response [GO:0019731]; antifungal humoral response [GO:0019732]; antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; associative learning [GO:0008306]; astrocyte activation [GO:0048143]; astrocyte activation involved in immune response [GO:0002265]; axo-dendritic transport [GO:0008088]; axon midline choice point recognition [GO:0016199]; axonogenesis [GO:0007409]; calcium-mediated signaling [GO:0019722]; cell adhesion [GO:0007155]; cellular copper ion homeostasis [GO:0006878]; cellular response to amyloid-beta [GO:1904646]; cellular response to cAMP [GO:0071320]; cellular response to copper ion [GO:0071280]; cellular response to manganese ion [GO:0071287]; cellular response to nerve growth factor stimulus [GO:1990090]; cellular response to norepinephrine stimulus [GO:0071874]; central nervous system development [GO:0007417]; cholesterol metabolic process [GO:0008203]; cognition [GO:0050890]; collateral sprouting in absence of injury [GO:0048669]; defense response to Gram-negative bacterium [GO:0050829]; defense response to Gram-positive bacterium [GO:0050830]; dendrite development [GO:0016358]; endocytosis [GO:0006897]; extracellular matrix organization [GO:0030198]; forebrain development [GO:0030900]; G protein-coupled receptor signaling pathway [GO:0007186]; G2/M transition of mitotic cell cycle [GO:0000086]; innate immune response [GO:0045087]; ionotropic glutamate receptor signaling pathway [GO:0035235]; learning [GO:0007612]; learning or memory [GO:0007611]; lipoprotein metabolic process [GO:0042157]; locomotory behavior [GO:0007626]; mating behavior [GO:0007617]; memory [GO:0007613]; microglia development [GO:0014005]; microglial cell activation [GO:0001774]; modulation of excitatory postsynaptic potential [GO:0098815]; mRNA polyadenylation [GO:0006378]; negative regulation of blood circulation [GO:1903523]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of dendritic spine maintenance [GO:1902951]; negative regulation of gene expression [GO:0010629]; negative regulation of long-term synaptic potentiation [GO:1900272]; negative regulation of miRNA transcription [GO:1902894]; negative regulation of mitochondrion organization [GO:0010823]; negative regulation of neuron death [GO:1901215]; negative regulation of neuron differentiation [GO:0045665]; negative regulation of protein localization to nucleus [GO:1900181]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of Wnt signaling pathway [GO:0030178]; neuromuscular process controlling balance [GO:0050885]; neuron apoptotic process [GO:0051402]; neuron cellular homeostasis [GO:0070050]; neuron projection development [GO:0031175]; neuron projection maintenance [GO:1990535]; neuron remodeling [GO:0016322]; Notch signaling pathway [GO:0007219]; positive regulation of 1-phosphatidylinositol-3-kinase activity [GO:0061903]; positive regulation of amyloid fibril formation [GO:1905908]; positive regulation of apoptotic process [GO:0043065]; positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902961]; positive regulation of cell activation [GO:0050867]; positive regulation of cellular response to thapsigargin [GO:1905893]; positive regulation of cellular response to tunicamycin [GO:1905896]; positive regulation of chemokine production [GO:0032722]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of endothelin production [GO:1904472]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of excitatory postsynaptic potential [GO:2000463]; positive regulation of G protein-coupled receptor internalization [GO:1904022]; positive regulation of G protein-coupled receptor signaling pathway [GO:0045745]; positive regulation of G2/M transition of mitotic cell cycle [GO:0010971]; positive regulation of gene expression [GO:0010628]; positive regulation of glycolytic process [GO:0045821]; positive regulation of histone acetylation [GO:0035066]; positive regulation of inflammatory response [GO:0050729]; positive regulation of interferon-gamma production [GO:0032729]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of JNK cascade [GO:0046330]; positive regulation of long-term synaptic depression [GO:1900454]; positive regulation of long-term synaptic potentiation [GO:1900273]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of membrane protein ectodomain proteolysis [GO:0051044]; positive regulation of mitotic cell cycle [GO:0045931]; positive regulation of monocyte chemotaxis [GO:0090026]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of neuron death [GO:1901216]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of oxidative stress-induced neuron death [GO:1903223]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of peptidyl-threonine phosphorylation [GO:0010800]; positive regulation of phosphorylation [GO:0042327]; positive regulation of protein binding [GO:0032092]; positive regulation of protein import [GO:1904591]; positive regulation of protein kinase A signaling [GO:0010739]; positive regulation of protein kinase B signaling [GO:0051897]; positive regulation of protein metabolic process [GO:0051247]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein tyrosine kinase activity [GO:0061098]; positive regulation of receptor binding [GO:1900122]; positive regulation of response to endoplasmic reticulum stress [GO:1905898]; positive regulation of superoxide anion generation [GO:0032930]; positive regulation of T cell migration [GO:2000406]; positive regulation of tau-protein kinase activity [GO:1902949]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of tumor necrosis factor production [GO:0032760]; protein homooligomerization [GO:0051260]; protein phosphorylation [GO:0006468]; protein tetramerization [GO:0051262]; protein trimerization [GO:0070206]; regulation of acetylcholine-gated cation channel activity [GO:1903048]; regulation of amyloid fibril formation [GO:1905906]; regulation of amyloid-beta clearance [GO:1900221]; regulation of cellular protein metabolic process [GO:0032268]; regulation of dendritic spine maintenance [GO:1902950]; regulation of epidermal growth factor-activated receptor activity [GO:0007176]; regulation of gene expression [GO:0010468]; regulation of long-term neuronal synaptic plasticity [GO:0048169]; regulation of MAPK cascade [GO:0043408]; regulation of multicellular organism growth [GO:0040014]; regulation of NMDA receptor activity [GO:2000310]; regulation of peptidyl-tyrosine phosphorylation [GO:0050730]; regulation of presynapse assembly [GO:1905606]; regulation of protein tyrosine kinase activity [GO:0061097]; regulation of response to calcium ion [GO:1905945]; regulation of signaling receptor activity [GO:0010469]; regulation of spontaneous synaptic transmission [GO:0150003]; regulation of synapse structure or activity [GO:0050803]; regulation of toll-like receptor signaling pathway [GO:0034121]; regulation of transcription by RNA polymerase II [GO:0006357]; regulation of translation [GO:0006417]; regulation of Wnt signaling pathway [GO:0030111]; response to interleukin-1 [GO:0070555]; response to lead ion [GO:0010288]; response to oxidative stress [GO:0006979]; response to yeast [GO:0001878]; smooth endoplasmic reticulum calcium ion homeostasis [GO:0051563]; suckling behavior [GO:0001967]; synapse organization [GO:0050808]; synaptic assembly at neuromuscular junction [GO:0051124]; visual learning [GO:0008542]	acetylcholine receptor activator activity [GO:0030549]; acetylcholine receptor binding [GO:0033130]; amylin binding [GO:0097645]; apolipoprotein binding [GO:0034185]; chaperone binding [GO:0051087]; chemoattractant activity [GO:0042056]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; enzyme binding [GO:0019899]; ephrin receptor binding [GO:0046875]; frizzled binding [GO:0005109]; G protein-coupled receptor binding [GO:0001664]; growth factor receptor binding [GO:0070851]; heparan sulfate binding [GO:1904399]; heparan sulfate proteoglycan binding [GO:0043395]; heparin binding [GO:0008201]; identical protein binding [GO:0042802]; insulin receptor binding [GO:0005158]; integrin binding [GO:0005178]; low-density lipoprotein particle receptor binding [GO:0050750]; peptidase activator activity [GO:0016504]; protein dimerization activity [GO:0046983]; protein heterodimerization activity [GO:0046982]; protein homodimerization activity [GO:0042803]; PTB domain binding [GO:0051425]; RAGE receptor binding [GO:0050786]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; serine-type endopeptidase inhibitor activity [GO:0004867]; signaling receptor activator activity [GO:0030546]; signaling receptor binding [GO:0005102]; transition metal ion binding [GO:0046914]	GO:0000086; GO:0000122; GO:0000978; GO:0001664; GO:0001774; GO:0001878; GO:0001934; GO:0001967; GO:0002265; GO:0003677; GO:0003682; GO:0004867; GO:0005102; GO:0005109; GO:0005158; GO:0005178; GO:0005576; GO:0005615; GO:0005634; GO:0005641; GO:0005737; GO:0005739; GO:0005768; GO:0005769; GO:0005783; GO:0005788; GO:0005790; GO:0005791; GO:0005794; GO:0005796; GO:0005798; GO:0005829; GO:0005886; GO:0005887; GO:0005905; GO:0005911; GO:0006357; GO:0006378; GO:0006417; GO:0006468; GO:0006878; GO:0006897; GO:0006979; GO:0007155; GO:0007176; GO:0007186; GO:0007189; GO:0007193; GO:0007204; GO:0007219; GO:0007409; GO:0007417; GO:0007611; GO:0007612; GO:0007613; GO:0007617; GO:0007626; GO:0008021; GO:0008088; GO:0008201; GO:0008203; GO:0008285; GO:0008306; GO:0008344; GO:0008542; GO:0009986; GO:0010288; GO:0010468; GO:0010469; GO:0010628; GO:0010629; GO:0010739; GO:0010800; GO:0010823; GO:0010971; GO:0014005; GO:0016020; GO:0016021; GO:0016199; GO:0016322; GO:0016358; GO:0016504; GO:0019722; GO:0019731; GO:0019732; GO:0019899; GO:0030111; GO:0030134; GO:0030178; GO:0030198; GO:0030424; GO:0030546; GO:0030549; GO:0030900; GO:0031093; GO:0031175; GO:0031594; GO:0031904; GO:0032092; GO:0032268; GO:0032588; GO:0032722; GO:0032729; GO:0032731; GO:0032755; GO:0032760; GO:0032930; GO:0032991; GO:0033130; GO:0033138; GO:0034121; GO:0034185; GO:0034363; GO:0034364; GO:0035066; GO:0035235; GO:0035253; GO:0040014; GO:0042056; GO:0042157; GO:0042327; GO:0042802; GO:0042803; GO:0043065; GO:0043197; GO:0043198; GO:0043204; GO:0043235; GO:0043280; GO:0043395; GO:0043406; GO:0043408; GO:0043410; GO:0043525; GO:0044304; GO:0045087; GO:0045121; GO:0045177; GO:0045202; GO:0045429; GO:0045665; GO:0045666; GO:0045745; GO:0045821; GO:0045931; GO:0045944; GO:0046330; GO:0046875; GO:0046914; GO:0046982; GO:0046983; GO:0048143; GO:0048169; GO:0048471; GO:0048669; GO:0048786; GO:0050729; GO:0050730; GO:0050750; GO:0050786; GO:0050803; GO:0050808; GO:0050829; GO:0050830; GO:0050867; GO:0050885; GO:0050890; GO:0051044; GO:0051087; GO:0051091; GO:0051092; GO:0051124; GO:0051233; GO:0051247; GO:0051260; GO:0051262; GO:0051402; GO:0051425; GO:0051563; GO:0051897; GO:0055037; GO:0061097; GO:0061098; GO:0061844; GO:0061903; GO:0070050; GO:0070062; GO:0070206; GO:0070374; GO:0070381; GO:0070555; GO:0070851; GO:0071280; GO:0071287; GO:0071320; GO:0071874; GO:0090026; GO:0090090; GO:0097449; GO:0097645; GO:0098815; GO:0106003; GO:0150003; GO:1900122; GO:1900181; GO:1900221; GO:1900272; GO:1900273; GO:1900454; GO:1901215; GO:1901216; GO:1901224; GO:1902894; GO:1902949; GO:1902950; GO:1902951; GO:1902961; GO:1903048; GO:1903223; GO:1903523; GO:1904022; GO:1904399; GO:1904472; GO:1904591; GO:1904646; GO:1905606; GO:1905893; GO:1905896; GO:1905898; GO:1905906; GO:1905908; GO:1905945; GO:1990000; GO:1990090; GO:1990535; GO:1990761; GO:1990777; GO:1990812; GO:2000310; GO:2000406; GO:2000463	AAQIRSQVMTHLR	1.0242	13.3958	13.3351	13.4497	9.27854	11.0263	12.0645	11.8023	13.3962	12.7135	13.4463	13.6147	13.9216	13.6919	13.9009	12.6469
Q13564	ULA1_HUMAN	"NEDD8-activating enzyme E1 regulatory subunit (Amyloid beta precursor protein-binding protein 1, 59 kDa) (APP-BP1) (Amyloid protein-binding protein 1) (Proto-oncogene protein 1)"	NAE1 APPBP1 HPP1	Homo sapiens (Human)	mitotic DNA replication checkpoint signaling [GO:0033314]; neuron apoptotic process [GO:0051402]; protein modification by small protein conjugation [GO:0032446]; protein neddylation [GO:0045116]; regulation of apoptotic process [GO:0042981]; regulation of neuron apoptotic process [GO:0043523]; signal transduction [GO:0007165]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; NEDD8 activating enzyme activity [GO:0019781]; protein heterodimerization activity [GO:0046982]; ubiquitin protein ligase binding [GO:0031625]; mitotic DNA replication checkpoint signaling [GO:0033314]; neuron apoptotic process [GO:0051402]; protein modification by small protein conjugation [GO:0032446]; protein neddylation [GO:0045116]; regulation of apoptotic process [GO:0042981]; regulation of neuron apoptotic process [GO:0043523]; signal transduction [GO:0007165]	NEDD8 activating enzyme activity [GO:0019781]; protein heterodimerization activity [GO:0046982]; ubiquitin protein ligase binding [GO:0031625]	GO:0005737; GO:0005829; GO:0005886; GO:0007165; GO:0019781; GO:0031625; GO:0032446; GO:0032991; GO:0033314; GO:0042981; GO:0043523; GO:0045116; GO:0046982; GO:0051402	AKKDAAAVGNHVAK	1.0101	14.058	14.1659	14.2866	13.0904	12.153	11.7578	13.0237	12.6494	13.6114	11.9291	12.5867	11.9318	12.8754	10.7817	12.7647
P02794	FRIH_HUMAN	"Ferritin heavy chain (Ferritin H subunit) (EC 1.16.3.1) (Cell proliferation-inducing gene 15 protein) [Cleaved into: Ferritin heavy chain, N-terminally processed]"	FTH1 FTH FTHL6 OK/SW-cl.84 PIG15	Homo sapiens (Human)	cellular iron ion homeostasis [GO:0006879]; immune response [GO:0006955]; intracellular sequestering of iron ion [GO:0006880]; iron ion transport [GO:0006826]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of fibroblast proliferation [GO:0048147]	autolysosome [GO:0044754]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; ficolin-1-rich granule lumen [GO:1904813]; intracellular ferritin complex [GO:0008043]; nucleus [GO:0005634]; tertiary granule lumen [GO:1904724]	autolysosome [GO:0044754]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; ficolin-1-rich granule lumen [GO:1904813]; intracellular ferritin complex [GO:0008043]; nucleus [GO:0005634]; tertiary granule lumen [GO:1904724]; ferric iron binding [GO:0008199]; ferrous iron binding [GO:0008198]; ferroxidase activity [GO:0004322]; identical protein binding [GO:0042802]; iron ion binding [GO:0005506]; cellular iron ion homeostasis [GO:0006879]; immune response [GO:0006955]; intracellular sequestering of iron ion [GO:0006880]; iron ion transport [GO:0006826]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of fibroblast proliferation [GO:0048147]	ferric iron binding [GO:0008199]; ferrous iron binding [GO:0008198]; ferroxidase activity [GO:0004322]; identical protein binding [GO:0042802]; iron ion binding [GO:0005506]	GO:0004322; GO:0005506; GO:0005576; GO:0005634; GO:0005737; GO:0005829; GO:0006826; GO:0006879; GO:0006880; GO:0006955; GO:0008043; GO:0008198; GO:0008199; GO:0008285; GO:0042802; GO:0044754; GO:0048147; GO:0070062; GO:1904724; GO:1904813	AIKELGDHVTNLR	0.88344	13.8974	13.5919	13.8802	13.7731	0	13.3301	13.6577	13.5523	13.7641	12.035	14.5919	14.5983	14.0737	13.9242	12.3104
Q6ZT62	BGIN_HUMAN	Bargin (Chimeric SH3BP1-PDXP protein)	BARGIN	Homo sapiens (Human)	negative regulation of small GTPase mediated signal transduction [GO:0051058]; positive regulation of GTPase activity [GO:0043547]; regulation of actin cytoskeleton organization [GO:0032956]; regulation of Rac protein signal transduction [GO:0035020]; signal transduction [GO:0007165]	cytosol [GO:0005829]; extrinsic component of plasma membrane [GO:0019897]	cytosol [GO:0005829]; extrinsic component of plasma membrane [GO:0019897]; GTPase activator activity [GO:0005096]; linear polyubiquitin binding [GO:1990450]; negative regulation of small GTPase mediated signal transduction [GO:0051058]; positive regulation of GTPase activity [GO:0043547]; regulation of actin cytoskeleton organization [GO:0032956]; regulation of Rac protein signal transduction [GO:0035020]; signal transduction [GO:0007165]	GTPase activator activity [GO:0005096]; linear polyubiquitin binding [GO:1990450]	GO:0005096; GO:0005829; GO:0007165; GO:0019897; GO:0032956; GO:0035020; GO:0043547; GO:0051058; GO:1990450	AASLKEPGAR	0.9	11.2395	10.2417	11.5103	11.8995	11.676	10.8573	12.8103	11.2286	14.7417	12.9931	14.2374	12.0274	14.5234	14.8728	16.029
P68036	UB2L3_HUMAN	Ubiquitin-conjugating enzyme E2 L3 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme L3) (L-UBC) (UbcH7) (Ubiquitin carrier protein L3) (Ubiquitin-conjugating enzyme E2-F1) (Ubiquitin-protein ligase L3)	UBE2L3 UBCE7 UBCH7	Homo sapiens (Human)	cell cycle phase transition [GO:0044770]; cell population proliferation [GO:0008283]; cellular response to glucocorticoid stimulus [GO:0071385]; cellular response to steroid hormone stimulus [GO:0071383]; positive regulation of protein targeting to mitochondrion [GO:1903955]; positive regulation of protein ubiquitination [GO:0031398]; positive regulation of ubiquitin-protein transferase activity [GO:0051443]; protein K11-linked ubiquitination [GO:0070979]; protein modification process [GO:0036211]; protein polyubiquitination [GO:0000209]; protein ubiquitination [GO:0016567]; regulation of DNA-templated transcription [GO:0006355]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; ubiquitin ligase complex [GO:0000151]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; ubiquitin ligase complex [GO:0000151]; ATP binding [GO:0005524]; enzyme binding [GO:0019899]; RNA binding [GO:0003723]; transcription coactivator activity [GO:0003713]; ubiquitin conjugating enzyme activity [GO:0061631]; ubiquitin protein ligase binding [GO:0031625]; ubiquitin-protein transferase activator activity [GO:0097027]; ubiquitin-protein transferase activity [GO:0004842]; cell cycle phase transition [GO:0044770]; cell population proliferation [GO:0008283]; cellular response to glucocorticoid stimulus [GO:0071385]; cellular response to steroid hormone stimulus [GO:0071383]; positive regulation of protein targeting to mitochondrion [GO:1903955]; positive regulation of protein ubiquitination [GO:0031398]; positive regulation of ubiquitin-protein transferase activity [GO:0051443]; protein K11-linked ubiquitination [GO:0070979]; protein modification process [GO:0036211]; protein polyubiquitination [GO:0000209]; protein ubiquitination [GO:0016567]; regulation of DNA-templated transcription [GO:0006355]; ubiquitin-dependent protein catabolic process [GO:0006511]	ATP binding [GO:0005524]; enzyme binding [GO:0019899]; RNA binding [GO:0003723]; transcription coactivator activity [GO:0003713]; ubiquitin conjugating enzyme activity [GO:0061631]; ubiquitin protein ligase binding [GO:0031625]; ubiquitin-protein transferase activator activity [GO:0097027]; ubiquitin-protein transferase activity [GO:0004842]	GO:0000151; GO:0000209; GO:0003713; GO:0003723; GO:0004842; GO:0005524; GO:0005634; GO:0005654; GO:0005737; GO:0005829; GO:0006355; GO:0006511; GO:0008283; GO:0016567; GO:0019899; GO:0031398; GO:0031625; GO:0036211; GO:0044770; GO:0051443; GO:0061631; GO:0070979; GO:0071383; GO:0071385; GO:0097027; GO:1903955	ADLAEEYSKDR	0.99358	12.4707	12.65	8.60474	11.6401	11.9545	11.0705	11.9887	13.5906	13.3426	14.763	14.6527	15.3126	12.3809	12.2801	13.975
P08047	SP1_HUMAN	Transcription factor Sp1	SP1 TSFP1	Homo sapiens (Human)	cellular response to insulin stimulus [GO:0032869]; cellular response to zinc ion starvation [GO:0034224]; positive regulation by host of viral transcription [GO:0043923]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of angiogenesis [GO:0045766]; positive regulation of blood vessel endothelial cell migration [GO:0043536]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of gene expression [GO:0010628]; positive regulation of hydrogen sulfide biosynthetic process [GO:1904828]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of vascular endothelial cell proliferation [GO:1905564]; regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase II [GO:0006357]; response to hydroperoxide [GO:0033194]; rhythmic process [GO:0048511]	chromatin [GO:0000785]; cytoplasm [GO:0005737]; euchromatin [GO:0000791]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein-DNA complex [GO:0032993]; transcription repressor complex [GO:0017053]	"chromatin [GO:0000785]; cytoplasm [GO:0005737]; euchromatin [GO:0000791]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein-DNA complex [GO:0032993]; transcription repressor complex [GO:0017053]; bHLH transcription factor binding [GO:0043425]; DNA binding [GO:0003677]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription factor binding [GO:0140297]; double-stranded DNA binding [GO:0003690]; histone acetyltransferase binding [GO:0035035]; histone deacetylase binding [GO:0042826]; HMG box domain binding [GO:0071837]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; molecular adaptor activity [GO:0060090]; protein C-terminus binding [GO:0008022]; protein homodimerization activity [GO:0042803]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; sequence-specific DNA binding [GO:0043565]; sequence-specific double-stranded DNA binding [GO:1990837]; transcription cis-regulatory region binding [GO:0000976]; transcription coregulator binding [GO:0001221]; cellular response to insulin stimulus [GO:0032869]; cellular response to zinc ion starvation [GO:0034224]; positive regulation by host of viral transcription [GO:0043923]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of angiogenesis [GO:0045766]; positive regulation of blood vessel endothelial cell migration [GO:0043536]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of gene expression [GO:0010628]; positive regulation of hydrogen sulfide biosynthetic process [GO:1904828]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of vascular endothelial cell proliferation [GO:1905564]; regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase II [GO:0006357]; response to hydroperoxide [GO:0033194]; rhythmic process [GO:0048511]"	"bHLH transcription factor binding [GO:0043425]; DNA binding [GO:0003677]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription factor binding [GO:0140297]; double-stranded DNA binding [GO:0003690]; histone acetyltransferase binding [GO:0035035]; histone deacetylase binding [GO:0042826]; HMG box domain binding [GO:0071837]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; molecular adaptor activity [GO:0060090]; protein C-terminus binding [GO:0008022]; protein homodimerization activity [GO:0042803]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; sequence-specific DNA binding [GO:0043565]; sequence-specific double-stranded DNA binding [GO:1990837]; transcription cis-regulatory region binding [GO:0000976]; transcription coregulator binding [GO:0001221]"	GO:0000785; GO:0000791; GO:0000976; GO:0000977; GO:0000978; GO:0000981; GO:0001221; GO:0001228; GO:0003677; GO:0003690; GO:0003700; GO:0005634; GO:0005654; GO:0005737; GO:0006355; GO:0006357; GO:0008022; GO:0010628; GO:0017053; GO:0032869; GO:0032993; GO:0033194; GO:0034224; GO:0035035; GO:0042802; GO:0042803; GO:0042826; GO:0043425; GO:0043536; GO:0043565; GO:0043923; GO:0045766; GO:0045893; GO:0045944; GO:0046872; GO:0048511; GO:0060090; GO:0061629; GO:0071837; GO:0140297; GO:1902004; GO:1904828; GO:1905564; GO:1990837	AHLRWHTGERPFMCTWSYCGK	0.99244	12.3573	11.238	13.1598	12.5786	12.408	11.3328	13.6542	13.395	13.0462	12.5255	12.5236	13.502	12.998	12.2855	13.4066
Q16643	DREB_HUMAN	Drebrin (Developmentally-regulated brain protein)	DBN1 D0S117E	Homo sapiens (Human)	actin filament organization [GO:0007015]; cell communication by chemical coupling [GO:0010643]; cell communication by electrical coupling [GO:0010644]; cytoplasmic sequestering of protein [GO:0051220]; in utero embryonic development [GO:0001701]; maintenance of protein location in cell [GO:0032507]; neural precursor cell proliferation [GO:0061351]; neuron projection morphogenesis [GO:0048812]; positive regulation of axon extension [GO:0045773]; positive regulation of dendritic spine morphogenesis [GO:0061003]; positive regulation of receptor localization to synapse [GO:1902685]; positive regulation of synaptic plasticity [GO:0031915]; postsynaptic actin cytoskeleton organization [GO:0098974]; regulation of actin filament polymerization [GO:0030833]; regulation of dendrite development [GO:0050773]; regulation of neuronal synaptic plasticity [GO:0048168]	actin cytoskeleton [GO:0015629]; actomyosin [GO:0042641]; cortical actin cytoskeleton [GO:0030864]; cortical cytoskeleton [GO:0030863]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; dendrite [GO:0030425]; gap junction [GO:0005921]; glutamatergic synapse [GO:0098978]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; plasma membrane [GO:0005886]; postsynaptic cytosol [GO:0099524]; postsynaptic density [GO:0014069]; postsynaptic membrane [GO:0045211]; site of polarized growth [GO:0030427]	actin cytoskeleton [GO:0015629]; actomyosin [GO:0042641]; cortical actin cytoskeleton [GO:0030864]; cortical cytoskeleton [GO:0030863]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; dendrite [GO:0030425]; gap junction [GO:0005921]; glutamatergic synapse [GO:0098978]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; plasma membrane [GO:0005886]; postsynaptic cytosol [GO:0099524]; postsynaptic density [GO:0014069]; postsynaptic membrane [GO:0045211]; site of polarized growth [GO:0030427]; actin binding [GO:0003779]; actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; profilin binding [GO:0005522]; actin filament organization [GO:0007015]; cell communication by chemical coupling [GO:0010643]; cell communication by electrical coupling [GO:0010644]; cytoplasmic sequestering of protein [GO:0051220]; in utero embryonic development [GO:0001701]; maintenance of protein location in cell [GO:0032507]; neural precursor cell proliferation [GO:0061351]; neuron projection morphogenesis [GO:0048812]; positive regulation of axon extension [GO:0045773]; positive regulation of dendritic spine morphogenesis [GO:0061003]; positive regulation of receptor localization to synapse [GO:1902685]; positive regulation of synaptic plasticity [GO:0031915]; postsynaptic actin cytoskeleton organization [GO:0098974]; regulation of actin filament polymerization [GO:0030833]; regulation of dendrite development [GO:0050773]; regulation of neuronal synaptic plasticity [GO:0048168]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; profilin binding [GO:0005522]	GO:0001701; GO:0003779; GO:0005522; GO:0005737; GO:0005856; GO:0005886; GO:0005921; GO:0007015; GO:0010643; GO:0010644; GO:0014069; GO:0015629; GO:0030027; GO:0030425; GO:0030426; GO:0030427; GO:0030833; GO:0030863; GO:0030864; GO:0031915; GO:0032507; GO:0042641; GO:0045211; GO:0045296; GO:0045773; GO:0048168; GO:0048812; GO:0050773; GO:0051015; GO:0051220; GO:0061003; GO:0061351; GO:0098974; GO:0098978; GO:0099524; GO:1902685	AGVSFSGHR	0.94076	12.6421	11.019	12.7353	14.0681	11.3211	11.7576	13.9147	13.4506	12.7933	13.6864	13.182	13.1829	11.7467	11.9572	12.7986
B4DFM2	B4DFM2_HUMAN	"cDNA FLJ59227, highly similar to Kelch domain-containing protein 8B"		Homo sapiens (Human)						AFAWQVFPPMPTCR	0.21429	14.2706	14.4542	14.5062	14.4587	14.3391	14.3703	14.7289	14.7417	14.7461	15.1329	0	0	14.674	14.7662	14.7208
B7Z1Y9	B7Z1Y9_HUMAN	"cDNA FLJ56342, highly similar to Rhomboid-related protein 2"		Homo sapiens (Human)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; serine-type endopeptidase activity [GO:0004252]	serine-type endopeptidase activity [GO:0004252]	GO:0004252; GO:0016021	ALESSRCAR	0.98619	15.7337	10.6829	13.3226	14.895	11.9665	11.3992	11.6374	11.687	12.7597	12.0309	13.2114	11.2554	12.8155	13.0712	12.9308
C8CJL6	C8CJL6_HUMAN	Estrogen receptor alpha delta 4 +49 isoform	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQCTIDK	0.90932	11.0759	11.4546	16.6446	10.2033	9.48878	10.2148	10.8754	9.03538	15.4241	15.5514	11.484	10.6354	17.2622	12.5745	17.4631
B4DGF9	B4DGF9_HUMAN	"cDNA FLJ56609, highly similar to RB1-inducible coiled-coil protein 1"		Homo sapiens (Human)	autophagosome assembly [GO:0000045]; autophagy of mitochondrion [GO:0000422]		autophagosome assembly [GO:0000045]; autophagy of mitochondrion [GO:0000422]		GO:0000045; GO:0000422	AVSWNKKV	1.0176	0	12.5432	19.0672	11.0777	11.9434	12.41	11.3628	18.6997	10.7829	19.7485	13.4883	13.3655	11.9862	12.5082	10.3466
P01160	ANF_HUMAN	Natriuretic peptides A (Atrial natriuretic factor prohormone) (proANF) (Atrial natriuretic peptide prohormone) (preproANP) (proANP) (Atriopeptigen) (Cardiodilatin) (CDD) (preproCDD-ANF) [Cleaved into: Long-acting natriuretic peptide (LANP) (Long-acting natriuretic hormone) (LANH) (Pro atrial natriuretic factor 1-30) (proANF 1-30) (Pro atrial natriuretic peptide 1-30) (proANP 1-30); Vessel dilator (VSDL) (Pro atrial natriuretic factor 31-67) (proANF 31-67) (Pro atrial natriuretic peptide 31-67) (proANP 31-67); Kaliuretic peptide (KP) (Pro atrial natriuretic factor 79-98) (proANF 79-98) (Pro atrial natriuretic peptide 79-98) (proANP 79-98); Urodilatin (URO) (CDD 95-126) (CDD-ANP (95-126)) (Pro atrial natriuretic peptide 95-126) (proANP 95-126); Auriculin-C (Atrial natriuretic factor 1-33) (ANF 1-33); Auriculin-D (Atrial natriuretic factor 3-33) (ANF 3-33); Atrial natriuretic peptide (ANP) (Alpha-atrial natriuretic peptide) (Alpha-hANP) (Atrial natriuretic factor) (ANF) (CDD-ANF) (CDD-ANP (99-126)) (Cardionatrin) (Pro atrial natriuretic factor 99-126) (proANF 99-126); Auriculin-B (Atrial natriuretic factor 8-33) (ANF 8-33); Auriculin-A; Atriopeptin-1 (Atriopeptin I); Atriopeptin-2 (Atriopeptin II); Atriopeptin-3 (Atriopeptin III)]	NPPA ANP PND	Homo sapiens (Human)	aortic valve morphogenesis [GO:0003180]; cardiac conduction system development [GO:0003161]; cardiac muscle hypertrophy in response to stress [GO:0014898]; cGMP biosynthetic process [GO:0006182]; cGMP-mediated signaling [GO:0019934]; female pregnancy [GO:0007565]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of epidermal growth factor receptor signaling pathway [GO:0042059]; negative regulation of JUN kinase activity [GO:0043508]; negative regulation of systemic arterial blood pressure [GO:0003085]; neuropeptide signaling pathway [GO:0007218]; positive regulation of cardiac muscle contraction [GO:0060452]; positive regulation of delayed rectifier potassium channel activity [GO:1902261]; positive regulation of heart rate [GO:0010460]; positive regulation of potassium ion export across plasma membrane [GO:1903766]; protein folding [GO:0006457]; receptor guanylyl cyclase signaling pathway [GO:0007168]; regulation of atrial cardiac muscle cell membrane repolarization [GO:0060372]; regulation of blood pressure [GO:0008217]; regulation of calcium ion transmembrane transport via high voltage-gated calcium channel [GO:1902514]; regulation of high voltage-gated calcium channel activity [GO:1901841]; response to muscle stretch [GO:0035994]; sodium ion export across plasma membrane [GO:0036376]; vasodilation [GO:0042311]	cell projection [GO:0042995]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nucleus [GO:0005634]; perikaryon [GO:0043204]; protein-containing complex [GO:0032991]	cell projection [GO:0042995]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nucleus [GO:0005634]; perikaryon [GO:0043204]; protein-containing complex [GO:0032991]; hormone activity [GO:0005179]; hormone receptor binding [GO:0051427]; neuropeptide hormone activity [GO:0005184]; neuropeptide receptor binding [GO:0071855]; signaling receptor binding [GO:0005102]; aortic valve morphogenesis [GO:0003180]; cardiac conduction system development [GO:0003161]; cardiac muscle hypertrophy in response to stress [GO:0014898]; cGMP biosynthetic process [GO:0006182]; cGMP-mediated signaling [GO:0019934]; female pregnancy [GO:0007565]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of epidermal growth factor receptor signaling pathway [GO:0042059]; negative regulation of JUN kinase activity [GO:0043508]; negative regulation of systemic arterial blood pressure [GO:0003085]; neuropeptide signaling pathway [GO:0007218]; positive regulation of cardiac muscle contraction [GO:0060452]; positive regulation of delayed rectifier potassium channel activity [GO:1902261]; positive regulation of heart rate [GO:0010460]; positive regulation of potassium ion export across plasma membrane [GO:1903766]; protein folding [GO:0006457]; receptor guanylyl cyclase signaling pathway [GO:0007168]; regulation of atrial cardiac muscle cell membrane repolarization [GO:0060372]; regulation of blood pressure [GO:0008217]; regulation of calcium ion transmembrane transport via high voltage-gated calcium channel [GO:1902514]; regulation of high voltage-gated calcium channel activity [GO:1901841]; response to muscle stretch [GO:0035994]; sodium ion export across plasma membrane [GO:0036376]; vasodilation [GO:0042311]	hormone activity [GO:0005179]; hormone receptor binding [GO:0051427]; neuropeptide hormone activity [GO:0005184]; neuropeptide receptor binding [GO:0071855]; signaling receptor binding [GO:0005102]	GO:0003085; GO:0003161; GO:0003180; GO:0005102; GO:0005179; GO:0005184; GO:0005576; GO:0005615; GO:0005634; GO:0005737; GO:0006182; GO:0006457; GO:0007168; GO:0007218; GO:0007565; GO:0008217; GO:0010460; GO:0014898; GO:0019934; GO:0032991; GO:0035994; GO:0036376; GO:0042059; GO:0042311; GO:0042995; GO:0043204; GO:0043508; GO:0051427; GO:0060372; GO:0060452; GO:0062023; GO:0071855; GO:0090090; GO:1901841; GO:1902261; GO:1902514; GO:1903766	ANPMYNAVSNADLMDFK	0.90547	14.2161	13.772	13.6711	14.2731	14.6954	13.8262	9.32735	12.4441	10.4711	9.96867	13.3346	10.036	13.0764	12.9436	13.2528
O15270	SPTC2_HUMAN	Serine palmitoyltransferase 2 (EC 2.3.1.50) (Long chain base biosynthesis protein 2) (LCB 2) (Long chain base biosynthesis protein 2a) (LCB2a) (Serine-palmitoyl-CoA transferase 2) (SPT 2)	SPTLC2 KIAA0526 LCB2	Homo sapiens (Human)	adipose tissue development [GO:0060612]; ceramide biosynthetic process [GO:0046513]; positive regulation of lipophagy [GO:1904504]; sphinganine biosynthetic process [GO:0046511]; sphingolipid biosynthetic process [GO:0030148]; sphingomyelin biosynthetic process [GO:0006686]; sphingosine biosynthetic process [GO:0046512]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; serine C-palmitoyltransferase complex [GO:0017059]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; serine C-palmitoyltransferase complex [GO:0017059]; pyridoxal phosphate binding [GO:0030170]; serine C-palmitoyltransferase activity [GO:0004758]; adipose tissue development [GO:0060612]; ceramide biosynthetic process [GO:0046513]; positive regulation of lipophagy [GO:1904504]; sphinganine biosynthetic process [GO:0046511]; sphingolipid biosynthetic process [GO:0030148]; sphingomyelin biosynthetic process [GO:0006686]; sphingosine biosynthetic process [GO:0046512]	pyridoxal phosphate binding [GO:0030170]; serine C-palmitoyltransferase activity [GO:0004758]	GO:0004758; GO:0005789; GO:0006686; GO:0016021; GO:0017059; GO:0030148; GO:0030170; GO:0046511; GO:0046512; GO:0046513; GO:0060612; GO:1904504	ANGCVANGEVR	1.0092	12.2517	12.9908	13.2485	13.2464	12.4171	12.5762	13.6201	12.5376	13.4747	14.0487	11.8936	13.5416	11.4719	12.1901	9.58528
Q04609	FOLH1_HUMAN	Glutamate carboxypeptidase 2 (EC 3.4.17.21) (Cell growth-inhibiting gene 27 protein) (Folate hydrolase 1) (Folylpoly-gamma-glutamate carboxypeptidase) (FGCP) (Glutamate carboxypeptidase II) (GCPII) (Membrane glutamate carboxypeptidase) (mGCP) (N-acetylated-alpha-linked acidic dipeptidase I) (NAALADase I) (Prostate-specific membrane antigen) (PSM) (PSMA) (Pteroylpoly-gamma-glutamate carboxypeptidase)	FOLH1 FOLH NAALAD1 PSM PSMA GIG27	Homo sapiens (Human)	C-terminal protein deglutamylation [GO:0035609]; folic acid-containing compound metabolic process [GO:0006760]; proteolysis [GO:0006508]	cell surface [GO:0009986]; cytoplasm [GO:0005737]; extracellular exosome [GO:0070062]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; plasma membrane [GO:0005886]	cell surface [GO:0009986]; cytoplasm [GO:0005737]; extracellular exosome [GO:0070062]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; plasma membrane [GO:0005886]; Ac-Asp-Glu binding [GO:1904492]; carboxypeptidase activity [GO:0004180]; dipeptidase activity [GO:0016805]; metal ion binding [GO:0046872]; metallocarboxypeptidase activity [GO:0004181]; peptidase activity [GO:0008233]; tetrahydrofolyl-poly(glutamate) polymer binding [GO:1904493]; C-terminal protein deglutamylation [GO:0035609]; folic acid-containing compound metabolic process [GO:0006760]; proteolysis [GO:0006508]	Ac-Asp-Glu binding [GO:1904492]; carboxypeptidase activity [GO:0004180]; dipeptidase activity [GO:0016805]; metal ion binding [GO:0046872]; metallocarboxypeptidase activity [GO:0004181]; peptidase activity [GO:0008233]; tetrahydrofolyl-poly(glutamate) polymer binding [GO:1904493]	GO:0004180; GO:0004181; GO:0005737; GO:0005886; GO:0005887; GO:0006508; GO:0006760; GO:0008233; GO:0009986; GO:0016020; GO:0016805; GO:0035609; GO:0046872; GO:0070062; GO:1904492; GO:1904493	AFIDPLGLPDRPFYR	0.99815	11.8143	14.5501	11.7121	10.2101	11.3338	12.218	13.0272	11.793	11.875	12.9525	15.2451	12.7441	11.9954	13.8095	13.47
P38935	SMBP2_HUMAN	DNA-binding protein SMUBP-2 (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent helicase IGHMBP2) (Glial factor 1) (GF-1) (Immunoglobulin mu-binding protein 2)	IGHMBP2 SMBP2 SMUBP2	Homo sapiens (Human)	DNA duplex unwinding [GO:0032508]; RNA secondary structure unwinding [GO:0010501]	axon [GO:0030424]; cytoplasm [GO:0005737]; growth cone [GO:0030426]; membrane [GO:0016020]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]	"axon [GO:0030424]; cytoplasm [GO:0005737]; growth cone [GO:0030426]; membrane [GO:0016020]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]; 5'-3' DNA helicase activity [GO:0043139]; 5'-3' RNA helicase activity [GO:0032574]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent activity, acting on DNA [GO:0008094]; ATP-dependent activity, acting on RNA [GO:0008186]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; double-stranded DNA helicase activity [GO:0036121]; identical protein binding [GO:0042802]; ribosome binding [GO:0043022]; RNA binding [GO:0003723]; single-stranded DNA binding [GO:0003697]; single-stranded RNA binding [GO:0003727]; transcription factor binding [GO:0008134]; tRNA binding [GO:0000049]; zinc ion binding [GO:0008270]; DNA duplex unwinding [GO:0032508]; RNA secondary structure unwinding [GO:0010501]"	"5'-3' DNA helicase activity [GO:0043139]; 5'-3' RNA helicase activity [GO:0032574]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent activity, acting on DNA [GO:0008094]; ATP-dependent activity, acting on RNA [GO:0008186]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; double-stranded DNA helicase activity [GO:0036121]; identical protein binding [GO:0042802]; ribosome binding [GO:0043022]; RNA binding [GO:0003723]; single-stranded DNA binding [GO:0003697]; single-stranded RNA binding [GO:0003727]; transcription factor binding [GO:0008134]; tRNA binding [GO:0000049]; zinc ion binding [GO:0008270]"	GO:0000049; GO:0003677; GO:0003678; GO:0003697; GO:0003723; GO:0003727; GO:0005524; GO:0005634; GO:0005654; GO:0005737; GO:0008094; GO:0008134; GO:0008186; GO:0008270; GO:0010501; GO:0016020; GO:0016604; GO:0016887; GO:0030424; GO:0030426; GO:0032508; GO:0032574; GO:0036121; GO:0042802; GO:0043022; GO:0043139; GO:1990904	AALAGLSLSLMER	1.0047	11.9732	14.6786	12.7099	11.1126	10.9354	10.5509	12.7956	12.8693	11.4827	13.6724	15.6885	12.5495	12.711	12.6108	12.3231
B4DFK9	B4DFK9_HUMAN	"cDNA FLJ57964, highly similar to Heterogeneous nuclear ribonucleoprotein H'"		Homo sapiens (Human)		nucleoplasm [GO:0005654]; ribonucleoprotein complex [GO:1990904]	nucleoplasm [GO:0005654]; ribonucleoprotein complex [GO:1990904]; RNA binding [GO:0003723]	RNA binding [GO:0003723]	GO:0003723; GO:0005654; GO:1990904	AEVRTHYDPPR	0.99223	13.9966	10.7759	14.1129	10.8003	14.1204	12.8662	12.8556	11.6832	12.1	13.2782	12.2477	11.5857	11.7004	14.1769	12.15
B4DFK4	B4DFK4_HUMAN	"cDNA FLJ55537, highly similar to Anaphase-promoting complex subunit 5 (APC5)(Cyclosome subunit 5)"		Homo sapiens (Human)	cell cycle [GO:0007049]; cell division [GO:0051301]; protein ubiquitination [GO:0016567]	anaphase-promoting complex [GO:0005680]	anaphase-promoting complex [GO:0005680]; cell cycle [GO:0007049]; cell division [GO:0051301]; protein ubiquitination [GO:0016567]		GO:0005680; GO:0007049; GO:0016567; GO:0051301	AEALEAAIENLNEAK	0.91404	12.0662	13.2199	12.4181	12.2243	12.6157	11.7638	12.668	9.08942	13.5977	13.0888	13.0987	12.8079	13.1347	13.5783	12.6114
Q9BTA9	WAC_HUMAN	WW domain-containing adapter protein with coiled-coil	WAC KIAA1844	Homo sapiens (Human)	cellular response to DNA damage stimulus [GO:0006974]; chromatin organization [GO:0006325]; histone H2B conserved C-terminal lysine ubiquitination [GO:0071894]; histone monoubiquitination [GO:0010390]; mitotic G1 DNA damage checkpoint signaling [GO:0031571]; negative regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032435]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of macroautophagy [GO:0016239]; positive regulation of TORC1 signaling [GO:1904263]; regulation of autophagy [GO:0010506]	nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; spliceosomal complex [GO:0005681]	nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; spliceosomal complex [GO:0005681]; chromatin binding [GO:0003682]; RNA polymerase II complex binding [GO:0000993]; cellular response to DNA damage stimulus [GO:0006974]; chromatin organization [GO:0006325]; histone H2B conserved C-terminal lysine ubiquitination [GO:0071894]; histone monoubiquitination [GO:0010390]; mitotic G1 DNA damage checkpoint signaling [GO:0031571]; negative regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032435]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of macroautophagy [GO:0016239]; positive regulation of TORC1 signaling [GO:1904263]; regulation of autophagy [GO:0010506]	chromatin binding [GO:0003682]; RNA polymerase II complex binding [GO:0000993]	GO:0000993; GO:0003682; GO:0005634; GO:0005654; GO:0005681; GO:0006325; GO:0006974; GO:0010390; GO:0010506; GO:0016239; GO:0016607; GO:0031571; GO:0032435; GO:0045893; GO:0071894; GO:1904263	DAGDPSPPNK	1.0049	11.5149	13.0539	11.5501	12.9923	10.3805	10.3853	12.0771	13.0235	13.478	12.0433	13.2316	14.3071	13.1789	12.8317	12.9832
P62258	1433E_HUMAN	14-3-3 protein epsilon (14-3-3E)	YWHAE	Homo sapiens (Human)	cellular response to heat [GO:0034605]; cerebral cortex development [GO:0021987]; hippocampus development [GO:0021766]; intracellular signal transduction [GO:0035556]; MAPK cascade [GO:0000165]; membrane repolarization during cardiac muscle cell action potential [GO:0086013]; negative regulation of calcium ion export across plasma membrane [GO:1905913]; negative regulation of calcium ion transmembrane transporter activity [GO:1901020]; negative regulation of peptidyl-serine dephosphorylation [GO:1902309]; neuron migration [GO:0001764]; positive regulation of protein export from nucleus [GO:0046827]; protein localization [GO:0008104]; protein localization to nucleus [GO:0034504]; protein targeting [GO:0006605]; regulation of cytosolic calcium ion concentration [GO:0051480]; regulation of heart rate by cardiac conduction [GO:0086091]; regulation of heart rate by hormone [GO:0003064]; regulation of membrane repolarization [GO:0060306]; regulation of mitotic cell cycle [GO:0007346]; regulation of potassium ion transmembrane transporter activity [GO:1901016]; signal transduction [GO:0007165]; substantia nigra development [GO:0021762]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; melanosome [GO:0042470]; membrane [GO:0016020]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; melanosome [GO:0042470]; membrane [GO:0016020]; nucleus [GO:0005634]; cadherin binding [GO:0045296]; calcium channel regulator activity [GO:0005246]; enzyme binding [GO:0019899]; histone deacetylase binding [GO:0042826]; identical protein binding [GO:0042802]; MHC class II protein complex binding [GO:0023026]; phosphoprotein binding [GO:0051219]; phosphoserine residue binding [GO:0050815]; potassium channel regulator activity [GO:0015459]; protein domain specific binding [GO:0019904]; protein heterodimerization activity [GO:0046982]; protein phosphatase binding [GO:0019903]; RNA binding [GO:0003723]; scaffold protein binding [GO:0097110]; transmembrane transporter binding [GO:0044325]; ubiquitin protein ligase binding [GO:0031625]; cellular response to heat [GO:0034605]; cerebral cortex development [GO:0021987]; hippocampus development [GO:0021766]; intracellular signal transduction [GO:0035556]; MAPK cascade [GO:0000165]; membrane repolarization during cardiac muscle cell action potential [GO:0086013]; negative regulation of calcium ion export across plasma membrane [GO:1905913]; negative regulation of calcium ion transmembrane transporter activity [GO:1901020]; negative regulation of peptidyl-serine dephosphorylation [GO:1902309]; neuron migration [GO:0001764]; positive regulation of protein export from nucleus [GO:0046827]; protein localization [GO:0008104]; protein localization to nucleus [GO:0034504]; protein targeting [GO:0006605]; regulation of cytosolic calcium ion concentration [GO:0051480]; regulation of heart rate by cardiac conduction [GO:0086091]; regulation of heart rate by hormone [GO:0003064]; regulation of membrane repolarization [GO:0060306]; regulation of mitotic cell cycle [GO:0007346]; regulation of potassium ion transmembrane transporter activity [GO:1901016]; signal transduction [GO:0007165]; substantia nigra development [GO:0021762]	cadherin binding [GO:0045296]; calcium channel regulator activity [GO:0005246]; enzyme binding [GO:0019899]; histone deacetylase binding [GO:0042826]; identical protein binding [GO:0042802]; MHC class II protein complex binding [GO:0023026]; phosphoprotein binding [GO:0051219]; phosphoserine residue binding [GO:0050815]; potassium channel regulator activity [GO:0015459]; protein domain specific binding [GO:0019904]; protein heterodimerization activity [GO:0046982]; protein phosphatase binding [GO:0019903]; RNA binding [GO:0003723]; scaffold protein binding [GO:0097110]; transmembrane transporter binding [GO:0044325]; ubiquitin protein ligase binding [GO:0031625]	GO:0000165; GO:0001764; GO:0003064; GO:0003723; GO:0005246; GO:0005634; GO:0005737; GO:0005829; GO:0005925; GO:0006605; GO:0007165; GO:0007346; GO:0008104; GO:0015459; GO:0016020; GO:0019899; GO:0019903; GO:0019904; GO:0021762; GO:0021766; GO:0021987; GO:0023026; GO:0031625; GO:0034504; GO:0034605; GO:0035556; GO:0042470; GO:0042802; GO:0042826; GO:0044325; GO:0045296; GO:0046827; GO:0046982; GO:0050815; GO:0051219; GO:0051480; GO:0060306; GO:0070062; GO:0086013; GO:0086091; GO:0097110; GO:1901016; GO:1901020; GO:1902309; GO:1905913	AAFDDAIAELDTLSEESYKDSTLIMQLLR	0.92252	13.2197	9.52527	13.3585	12.4735	8.88448	12.5614	12.8211	12.873	11.1901	14.3317	14.0361	14.2044	9.72501	13.4372	13.327
P49753	ACOT2_HUMAN	"Acyl-coenzyme A thioesterase 2, mitochondrial (Acyl-CoA thioesterase 2) (EC 3.1.2.2) (Acyl-coenzyme A thioester hydrolase 2a) (CTE-Ia) (Long-chain acyl-CoA thioesterase 2) (ZAP128)"	ACOT2 PTE2 PTE2A	Homo sapiens (Human)	acyl-CoA metabolic process [GO:0006637]; fatty acid metabolic process [GO:0006631]; long-chain fatty acid metabolic process [GO:0001676]; very long-chain fatty acid metabolic process [GO:0000038]	cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]; peroxisomal matrix [GO:0005782]	cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]; peroxisomal matrix [GO:0005782]; acyl-CoA hydrolase activity [GO:0047617]; carboxylic ester hydrolase activity [GO:0052689]; myristoyl-CoA hydrolase activity [GO:0102991]; palmitoyl-CoA hydrolase activity [GO:0016290]; acyl-CoA metabolic process [GO:0006637]; fatty acid metabolic process [GO:0006631]; long-chain fatty acid metabolic process [GO:0001676]; very long-chain fatty acid metabolic process [GO:0000038]	acyl-CoA hydrolase activity [GO:0047617]; carboxylic ester hydrolase activity [GO:0052689]; myristoyl-CoA hydrolase activity [GO:0102991]; palmitoyl-CoA hydrolase activity [GO:0016290]	GO:0000038; GO:0001676; GO:0005739; GO:0005759; GO:0005782; GO:0005829; GO:0006631; GO:0006637; GO:0016290; GO:0047617; GO:0052689; GO:0102991	AESTFLFLVGQDDHNWK	0.92214	12.2091	13.3498	11.5558	11.8636	11.2892	11.9203	11.9338	12.9469	12.5764	13.5905	13.2247	11.9427	12.4279	11.7863	12.0124
P62760	VISL1_HUMAN	Visinin-like protein 1 (VILIP) (VLP-1) (Hippocalcin-like protein 3) (HLP3)	VSNL1 VISL1	Homo sapiens (Human)	negative regulation of insulin secretion [GO:0046676]; positive regulation of exocytosis [GO:0045921]; positive regulation of insulin secretion involved in cellular response to glucose stimulus [GO:0035774]	cytosol [GO:0005829]; membrane [GO:0016020]	cytosol [GO:0005829]; membrane [GO:0016020]; calcium ion binding [GO:0005509]; negative regulation of insulin secretion [GO:0046676]; positive regulation of exocytosis [GO:0045921]; positive regulation of insulin secretion involved in cellular response to glucose stimulus [GO:0035774]	calcium ion binding [GO:0005509]	GO:0005509; GO:0005829; GO:0016020; GO:0035774; GO:0045921; GO:0046676	DCPSGRLNLEEFQQLYVK	0.98846	13.3784	12.0015	13.2875	13.3228	11.2305	10.1298	12.4519	12.7118	12.0722	12.5327	14.221	12.1204	9.97241	12.5795	12.235
Q9BXS0	COPA1_HUMAN	Collagen alpha-1(XXV) chain (Alzheimer disease amyloid-associated protein) (AMY) (CLAC-P) [Cleaved into: Collagen-like Alzheimer amyloid plaque component (CLAC)]	COL25A1	Homo sapiens (Human)		collagen trimer [GO:0005581]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]	collagen trimer [GO:0005581]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; amyloid-beta binding [GO:0001540]; heparin binding [GO:0008201]; identical protein binding [GO:0042802]	amyloid-beta binding [GO:0001540]; heparin binding [GO:0008201]; identical protein binding [GO:0042802]	GO:0001540; GO:0005576; GO:0005581; GO:0005615; GO:0005788; GO:0005886; GO:0005887; GO:0008201; GO:0016021; GO:0042802; GO:0062023	DGEPGLDGFPGPR	1.0049	13.3038	11.7459	13.6972	10.0305	11.8673	12.0967	12.776	11.2835	12.1506	13.1856	12.1342	13.5689	11.81	11.5333	12.8532
B7Z1Z1	B7Z1Z1_HUMAN	Stress-activated protein kinase JNK (EC 2.7.11.24)		Homo sapiens (Human)	protein phosphorylation [GO:0006468]; rhythmic process [GO:0048511]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; MAP kinase activity [GO:0004707]; protein serine kinase activity [GO:0106310]; protein phosphorylation [GO:0006468]; rhythmic process [GO:0048511]	ATP binding [GO:0005524]; MAP kinase activity [GO:0004707]; protein serine kinase activity [GO:0106310]	GO:0004707; GO:0005524; GO:0005737; GO:0006468; GO:0048511; GO:0106310	APEVILGMGYK	0.98211	12.351	12.7799	11.3877	11.9754	11.0206	11.3618	12.2501	13.0404	12.0346	12.666	12.9043	12.7276	11.6861	12.7815	12.7549
Q14192	FHL2_HUMAN	Four and a half LIM domains protein 2 (FHL-2) (LIM domain protein DRAL) (Skeletal muscle LIM-protein 3) (SLIM-3)	FHL2 DRAL SLIM3	Homo sapiens (Human)	atrial cardiac muscle cell development [GO:0055014]; heart trabecula formation [GO:0060347]; negative regulation of apoptotic process [GO:0043066]; negative regulation of calcineurin-NFAT signaling cascade [GO:0070885]; negative regulation of transcription by RNA polymerase II [GO:0000122]; osteoblast differentiation [GO:0001649]; response to hormone [GO:0009725]; ventricular cardiac muscle cell development [GO:0055015]	focal adhesion [GO:0005925]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; Z disc [GO:0030018]	focal adhesion [GO:0005925]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; Z disc [GO:0030018]; bHLH transcription factor binding [GO:0043425]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; transcription coregulator activity [GO:0003712]; transcription corepressor activity [GO:0003714]; transcription factor binding [GO:0008134]; atrial cardiac muscle cell development [GO:0055014]; heart trabecula formation [GO:0060347]; negative regulation of apoptotic process [GO:0043066]; negative regulation of calcineurin-NFAT signaling cascade [GO:0070885]; negative regulation of transcription by RNA polymerase II [GO:0000122]; osteoblast differentiation [GO:0001649]; response to hormone [GO:0009725]; ventricular cardiac muscle cell development [GO:0055015]	bHLH transcription factor binding [GO:0043425]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; transcription coregulator activity [GO:0003712]; transcription corepressor activity [GO:0003714]; transcription factor binding [GO:0008134]	GO:0000122; GO:0001649; GO:0003712; GO:0003714; GO:0005634; GO:0005654; GO:0005925; GO:0008134; GO:0009725; GO:0030018; GO:0042802; GO:0043066; GO:0043425; GO:0046872; GO:0055014; GO:0055015; GO:0060347; GO:0070885	CAGCTNPISGLGGTK	0.83051	12.444	13.012	12.5489	10.6347	9.18795	11.2382	11.6714	12.7277	13.9324	13.3552	12.6323	13.6051	12.3678	11.2651	12.7126
Q16555	DPYL2_HUMAN	Dihydropyrimidinase-related protein 2 (DRP-2) (Collapsin response mediator protein 2) (CRMP-2) (N2A3) (Unc-33-like phosphoprotein 2) (ULIP-2)	DPYSL2 CRMP2 ULIP2	Homo sapiens (Human)	axon guidance [GO:0007411]; brain development [GO:0007420]; cytoskeleton organization [GO:0007010]; endocytosis [GO:0006897]; nervous system development [GO:0007399]; nucleobase-containing compound metabolic process [GO:0006139]; regulation of axon extension [GO:0030516]; regulation of neuron differentiation [GO:0045664]; signal transduction [GO:0007165]	cytoskeleton [GO:0005856]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; plasma membrane [GO:0005886]	cytoskeleton [GO:0005856]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; plasma membrane [GO:0005886]; dihydropyrimidinase activity [GO:0004157]; identical protein binding [GO:0042802]; microtubule binding [GO:0008017]; axon guidance [GO:0007411]; brain development [GO:0007420]; cytoskeleton organization [GO:0007010]; endocytosis [GO:0006897]; nervous system development [GO:0007399]; nucleobase-containing compound metabolic process [GO:0006139]; regulation of axon extension [GO:0030516]; regulation of neuron differentiation [GO:0045664]; signal transduction [GO:0007165]	dihydropyrimidinase activity [GO:0004157]; identical protein binding [GO:0042802]; microtubule binding [GO:0008017]	GO:0004157; GO:0005829; GO:0005856; GO:0005886; GO:0006139; GO:0006897; GO:0007010; GO:0007165; GO:0007399; GO:0007411; GO:0007420; GO:0008017; GO:0030516; GO:0042802; GO:0045664; GO:0070062	AITIANQTNCPLYITK	0.91354	12.6712	11.4865	12.9628	9.62244	0	9.63961	9.07066	15.0628	15.0221	15.3709	15.1894	14.8505	14.0997	13.0585	14.7458
O15294	OGT1_HUMAN	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (EC 2.4.1.255) (O-GlcNAc transferase subunit p110) (O-linked N-acetylglucosamine transferase 110 kDa subunit) (OGT)	OGT	Homo sapiens (Human)	apoptotic process [GO:0006915]; chromatin organization [GO:0006325]; circadian regulation of gene expression [GO:0032922]; hemopoiesis [GO:0030097]; histone H3-K4 trimethylation [GO:0080182]; histone H4-K16 acetylation [GO:0043984]; histone H4-K5 acetylation [GO:0043981]; histone H4-K8 acetylation [GO:0043982]; mitophagy [GO:0000423]; negative regulation of cell migration [GO:0030336]; negative regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032435]; negative regulation of protein ubiquitination [GO:0031397]; negative regulation of stem cell population maintenance [GO:1902455]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transforming growth factor beta receptor signaling pathway [GO:0030512]; phosphatidylinositol-mediated signaling [GO:0048015]; positive regulation of cold-induced thermogenesis [GO:0120162]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of histone H3-K27 methylation [GO:0061087]; positive regulation of histone H3-K4 methylation [GO:0051571]; positive regulation of proteolysis [GO:0045862]; positive regulation of stem cell population maintenance [GO:1902459]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein O-linked glycosylation [GO:0006493]; protein processing [GO:0016485]; regulation of dosage compensation by inactivation of X chromosome [GO:1900095]; regulation of gluconeogenesis [GO:0006111]; regulation of glycolytic process [GO:0006110]; regulation of insulin receptor signaling pathway [GO:0046626]; regulation of necroptotic process [GO:0060544]; regulation of Rac protein signal transduction [GO:0035020]; regulation of transcription by RNA polymerase II [GO:0006357]; response to insulin [GO:0032868]; response to nutrient [GO:0007584]; signal transduction [GO:0007165]	cell projection [GO:0042995]; cytosol [GO:0005829]; histone acetyltransferase complex [GO:0000123]; mitochondrial membrane [GO:0031966]; NSL complex [GO:0044545]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; protein N-acetylglucosaminyltransferase complex [GO:0017122]; protein-containing complex [GO:0032991]; Sin3 complex [GO:0016580]	"cell projection [GO:0042995]; cytosol [GO:0005829]; histone acetyltransferase complex [GO:0000123]; mitochondrial membrane [GO:0031966]; NSL complex [GO:0044545]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; protein N-acetylglucosaminyltransferase complex [GO:0017122]; protein-containing complex [GO:0032991]; Sin3 complex [GO:0016580]; acetylglucosaminyltransferase activity [GO:0008375]; chromatin DNA binding [GO:0031490]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547]; protein N-acetylglucosaminyltransferase activity [GO:0016262]; protein O-GlcNAc transferase activity [GO:0097363]; apoptotic process [GO:0006915]; chromatin organization [GO:0006325]; circadian regulation of gene expression [GO:0032922]; hemopoiesis [GO:0030097]; histone H3-K4 trimethylation [GO:0080182]; histone H4-K16 acetylation [GO:0043984]; histone H4-K5 acetylation [GO:0043981]; histone H4-K8 acetylation [GO:0043982]; mitophagy [GO:0000423]; negative regulation of cell migration [GO:0030336]; negative regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032435]; negative regulation of protein ubiquitination [GO:0031397]; negative regulation of stem cell population maintenance [GO:1902455]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transforming growth factor beta receptor signaling pathway [GO:0030512]; phosphatidylinositol-mediated signaling [GO:0048015]; positive regulation of cold-induced thermogenesis [GO:0120162]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of histone H3-K27 methylation [GO:0061087]; positive regulation of histone H3-K4 methylation [GO:0051571]; positive regulation of proteolysis [GO:0045862]; positive regulation of stem cell population maintenance [GO:1902459]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein O-linked glycosylation [GO:0006493]; protein processing [GO:0016485]; regulation of dosage compensation by inactivation of X chromosome [GO:1900095]; regulation of gluconeogenesis [GO:0006111]; regulation of glycolytic process [GO:0006110]; regulation of insulin receptor signaling pathway [GO:0046626]; regulation of necroptotic process [GO:0060544]; regulation of Rac protein signal transduction [GO:0035020]; regulation of transcription by RNA polymerase II [GO:0006357]; response to insulin [GO:0032868]; response to nutrient [GO:0007584]; signal transduction [GO:0007165]"	"acetylglucosaminyltransferase activity [GO:0008375]; chromatin DNA binding [GO:0031490]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547]; protein N-acetylglucosaminyltransferase activity [GO:0016262]; protein O-GlcNAc transferase activity [GO:0097363]"	GO:0000122; GO:0000123; GO:0000423; GO:0005547; GO:0005634; GO:0005654; GO:0005829; GO:0005886; GO:0006110; GO:0006111; GO:0006325; GO:0006357; GO:0006493; GO:0006915; GO:0007165; GO:0007584; GO:0008375; GO:0016262; GO:0016485; GO:0016580; GO:0017122; GO:0030097; GO:0030336; GO:0030512; GO:0031397; GO:0031490; GO:0031966; GO:0032435; GO:0032868; GO:0032922; GO:0032991; GO:0035020; GO:0042995; GO:0043981; GO:0043982; GO:0043984; GO:0044545; GO:0045862; GO:0045893; GO:0045944; GO:0046626; GO:0048015; GO:0051571; GO:0060544; GO:0061087; GO:0080182; GO:0097363; GO:0120162; GO:1900095; GO:1902455; GO:1902459	AADRIHQDGIHILVNMNGYTKGAR	0.85197	12.2914	13.0929	13.227	11.938	11.9484	9.95383	12.469	11.9868	13.1908	12.8277	13.0656	12.4428	9.74401	12.1067	12.1297
Q9NR71	ASAH2_HUMAN	Neutral ceramidase (N-CDase) (NCDase) (EC 3.5.1.-) (EC 3.5.1.23) (Acylsphingosine deacylase 2) (BCDase) (LCDase) (hCD) (N-acylsphingosine amidohydrolase 2) (Non-lysosomal ceramidase) [Cleaved into: Neutral ceramidase soluble form]	ASAH2 HNAC1	Homo sapiens (Human)	apoptotic process [GO:0006915]; cellular response to cytokine stimulus [GO:0071345]; ceramide biosynthetic process [GO:0046513]; ceramide catabolic process [GO:0046514]; ceramide metabolic process [GO:0006672]; lipid digestion [GO:0044241]; long-chain fatty acid biosynthetic process [GO:0042759]; negative regulation of apoptotic signaling pathway [GO:2001234]; regulation of mitotic cell cycle [GO:0007346]; sphingosine biosynthetic process [GO:0046512]; sphingosine metabolic process [GO:0006670]	caveola [GO:0005901]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of plasma membrane [GO:0005887]; mitochondrion [GO:0005739]; plasma membrane [GO:0005886]	caveola [GO:0005901]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of plasma membrane [GO:0005887]; mitochondrion [GO:0005739]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; ceramidase activity [GO:0102121]; N-acylsphingosine amidohydrolase activity [GO:0017040]; zinc ion binding [GO:0008270]; apoptotic process [GO:0006915]; cellular response to cytokine stimulus [GO:0071345]; ceramide biosynthetic process [GO:0046513]; ceramide catabolic process [GO:0046514]; ceramide metabolic process [GO:0006672]; lipid digestion [GO:0044241]; long-chain fatty acid biosynthetic process [GO:0042759]; negative regulation of apoptotic signaling pathway [GO:2001234]; regulation of mitotic cell cycle [GO:0007346]; sphingosine biosynthetic process [GO:0046512]; sphingosine metabolic process [GO:0006670]	calcium ion binding [GO:0005509]; ceramidase activity [GO:0102121]; N-acylsphingosine amidohydrolase activity [GO:0017040]; zinc ion binding [GO:0008270]	GO:0000139; GO:0005509; GO:0005576; GO:0005739; GO:0005794; GO:0005886; GO:0005887; GO:0005901; GO:0006670; GO:0006672; GO:0006915; GO:0007346; GO:0008270; GO:0017040; GO:0042759; GO:0044241; GO:0046512; GO:0046513; GO:0046514; GO:0070062; GO:0071345; GO:0102121; GO:2001234	ADCTGQVADINLMGYGK	0.9443	12.8589	13.5767	12.0072	11.3523	10.0678	12.812	11.2422	12.5389	12.0551	13.3756	13.7659	12.9061	9.67599	12.7144	11.3523
A0A024R3E8	A0A024R3E8_HUMAN	Beta-secretase 1 (EC 3.4.23.46) (Beta-site amyloid precursor protein cleaving enzyme 1) (Memapsin-2) (Membrane-associated aspartic protease 2)	BACE1 hCG_37942	Homo sapiens (Human)	proteolysis [GO:0006508]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]; aspartic-type endopeptidase activity [GO:0004190]; proteolysis [GO:0006508]	aspartic-type endopeptidase activity [GO:0004190]	GO:0004190; GO:0005770; GO:0005794; GO:0006508; GO:0016021; GO:0045121; GO:0055037	AASSTEK	0.94102	11.8793	15.4615	14.8415	10.0877	15.3875	14.9297	12.8269	0	11.521	12.2325	13.4302	12.9083	11.7567	10.4085	14.4573
P06276	CHLE_HUMAN	Cholinesterase (EC 3.1.1.8) (Acylcholine acylhydrolase) (Butyrylcholine esterase) (Choline esterase II) (Pseudocholinesterase)	BCHE CHE1	Homo sapiens (Human)	acetylcholine catabolic process [GO:0006581]; choline metabolic process [GO:0019695]; cocaine metabolic process [GO:0050783]; learning [GO:0007612]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of synaptic transmission [GO:0050805]; neuroblast differentiation [GO:0014016]; peptide hormone processing [GO:0016486]; response to alkaloid [GO:0043279]; response to folic acid [GO:0051593]; response to glucocorticoid [GO:0051384]; xenobiotic metabolic process [GO:0006805]	blood microparticle [GO:0072562]; endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nuclear envelope lumen [GO:0005641]; plasma membrane [GO:0005886]	"blood microparticle [GO:0072562]; endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nuclear envelope lumen [GO:0005641]; plasma membrane [GO:0005886]; acetylcholinesterase activity [GO:0003990]; amyloid-beta binding [GO:0001540]; carboxylic ester hydrolase activity [GO:0052689]; catalytic activity [GO:0003824]; choline binding [GO:0033265]; cholinesterase activity [GO:0004104]; enzyme binding [GO:0019899]; hydrolase activity, acting on ester bonds [GO:0016788]; identical protein binding [GO:0042802]; acetylcholine catabolic process [GO:0006581]; choline metabolic process [GO:0019695]; cocaine metabolic process [GO:0050783]; learning [GO:0007612]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of synaptic transmission [GO:0050805]; neuroblast differentiation [GO:0014016]; peptide hormone processing [GO:0016486]; response to alkaloid [GO:0043279]; response to folic acid [GO:0051593]; response to glucocorticoid [GO:0051384]; xenobiotic metabolic process [GO:0006805]"	"acetylcholinesterase activity [GO:0003990]; amyloid-beta binding [GO:0001540]; carboxylic ester hydrolase activity [GO:0052689]; catalytic activity [GO:0003824]; choline binding [GO:0033265]; cholinesterase activity [GO:0004104]; enzyme binding [GO:0019899]; hydrolase activity, acting on ester bonds [GO:0016788]; identical protein binding [GO:0042802]"	GO:0001540; GO:0003824; GO:0003990; GO:0004104; GO:0005576; GO:0005615; GO:0005641; GO:0005788; GO:0005886; GO:0006581; GO:0006805; GO:0007612; GO:0008285; GO:0014016; GO:0016486; GO:0016788; GO:0019695; GO:0019899; GO:0033265; GO:0042802; GO:0043279; GO:0050783; GO:0050805; GO:0051384; GO:0051593; GO:0052689; GO:0072562	AEEILSR	1.0022	14.185	14.0906	14.1133	8.44191	10.0222	0	15.1231	15.302	11.8198	14.5002	13.0926	14.7321	9.68027	11.6584	14.6288
Q9NZQ3	SPN90_HUMAN	NCK-interacting protein with SH3 domain (54 kDa VacA-interacting protein) (54 kDa vimentin-interacting protein) (VIP54) (90 kDa SH3 protein interacting with Nck) (AF3p21) (Dia-interacting protein 1) (DIP-1) (Diaphanous protein-interacting protein) (SH3 adapter protein SPIN90) (WASP-interacting SH3-domain protein) (WISH) (Wiskott-Aldrich syndrome protein-interacting protein)	NCKIPSD AF3P21 SPIN90	Homo sapiens (Human)	cytoskeleton organization [GO:0007010]; endocytosis [GO:0006897]; positive regulation of neuron projection development [GO:0010976]	cytosol [GO:0005829]; intermediate filament [GO:0005882]; nucleus [GO:0005634]	cytosol [GO:0005829]; intermediate filament [GO:0005882]; nucleus [GO:0005634]; Arp2/3 complex binding [GO:0071933]; cytoskeletal protein binding [GO:0008092]; SH3 domain binding [GO:0017124]; cytoskeleton organization [GO:0007010]; endocytosis [GO:0006897]; positive regulation of neuron projection development [GO:0010976]	Arp2/3 complex binding [GO:0071933]; cytoskeletal protein binding [GO:0008092]; SH3 domain binding [GO:0017124]	GO:0005634; GO:0005829; GO:0005882; GO:0006897; GO:0007010; GO:0008092; GO:0010976; GO:0017124; GO:0071933	AAAEAAVPR	0.98337	12.7163	12.0244	13.8646	10.1538	8.2943	11.2857	13.8364	12.4505	11.4399	13.3859	13.4218	12.2142	12.9048	11.8046	11.1103
P30304	MPIP1_HUMAN	M-phase inducer phosphatase 1 (EC 3.1.3.48) (Dual specificity phosphatase Cdc25A)	CDC25A	Homo sapiens (Human)	cell division [GO:0051301]; cell population proliferation [GO:0008283]; cellular response to UV [GO:0034644]; G1/S transition of mitotic cell cycle [GO:0000082]; G2/M transition of mitotic cell cycle [GO:0000086]; positive regulation of G2/M transition of mitotic cell cycle [GO:0010971]; positive regulation of G2/MI transition of meiotic cell cycle [GO:0110032]; protein dephosphorylation [GO:0006470]; regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]; response to radiation [GO:0009314]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; chaperone binding [GO:0051087]; phosphoprotein phosphatase activity [GO:0004721]; protein kinase binding [GO:0019901]; protein tyrosine phosphatase activity [GO:0004725]; cell division [GO:0051301]; cell population proliferation [GO:0008283]; cellular response to UV [GO:0034644]; G1/S transition of mitotic cell cycle [GO:0000082]; G2/M transition of mitotic cell cycle [GO:0000086]; positive regulation of G2/M transition of mitotic cell cycle [GO:0010971]; positive regulation of G2/MI transition of meiotic cell cycle [GO:0110032]; protein dephosphorylation [GO:0006470]; regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]; response to radiation [GO:0009314]	chaperone binding [GO:0051087]; phosphoprotein phosphatase activity [GO:0004721]; protein kinase binding [GO:0019901]; protein tyrosine phosphatase activity [GO:0004725]	GO:0000079; GO:0000082; GO:0000086; GO:0004721; GO:0004725; GO:0005634; GO:0005654; GO:0005737; GO:0005829; GO:0006470; GO:0008283; GO:0009314; GO:0010971; GO:0019901; GO:0034644; GO:0051087; GO:0051301; GO:0110032	AHETLHQSLSLASSPK	0.98773	13.1543	13.1909	13.3531	0	10.1872	11.4656	12.5911	13.1156	13.3306	14.5693	14.0781	14.7887	11.8556	13.0357	11.8093
B7Z1Z4	B7Z1Z4_HUMAN	"cDNA FLJ54346, highly similar to Hyaluronan and proteoglycan link protein 2"		Homo sapiens (Human)	cell adhesion [GO:0007155]		hyaluronic acid binding [GO:0005540]; cell adhesion [GO:0007155]	hyaluronic acid binding [GO:0005540]	GO:0005540; GO:0007155	APCGGRGRPGIR	0.98548	12.3251	11.2644	11.1606	11.1652	11.8889	9.69711	10.9566	13.2252	12.8055	13.1996	12.1451	13.9011	12.278	11.1524	12.5651
P17542	TAL1_HUMAN	T-cell acute lymphocytic leukemia protein 1 (TAL-1) (Class A basic helix-loop-helix protein 17) (bHLHa17) (Stem cell protein) (T-cell leukemia/lymphoma protein 5)	TAL1 BHLHA17 SCL TCL5	Homo sapiens (Human)	basophil differentiation [GO:0030221]; cell fate commitment [GO:0045165]; embryonic hemopoiesis [GO:0035162]; erythrocyte differentiation [GO:0030218]; hemopoiesis [GO:0030097]; megakaryocyte differentiation [GO:0030219]; positive regulation of cell division [GO:0051781]; positive regulation of chromatin organization [GO:1905269]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of erythrocyte differentiation [GO:0045648]; positive regulation of mitotic cell cycle [GO:0045931]; positive regulation of protein-containing complex assembly [GO:0031334]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	"chromatin [GO:0000785]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]; chromatin binding [GO:0003682]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; E-box binding [GO:0070888]; enzyme binding [GO:0019899]; histone deacetylase binding [GO:0042826]; protein dimerization activity [GO:0046983]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; transcription cis-regulatory region binding [GO:0000976]; basophil differentiation [GO:0030221]; cell fate commitment [GO:0045165]; embryonic hemopoiesis [GO:0035162]; erythrocyte differentiation [GO:0030218]; hemopoiesis [GO:0030097]; megakaryocyte differentiation [GO:0030219]; positive regulation of cell division [GO:0051781]; positive regulation of chromatin organization [GO:1905269]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of erythrocyte differentiation [GO:0045648]; positive regulation of mitotic cell cycle [GO:0045931]; positive regulation of protein-containing complex assembly [GO:0031334]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of transcription by RNA polymerase II [GO:0006357]"	"chromatin binding [GO:0003682]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; E-box binding [GO:0070888]; enzyme binding [GO:0019899]; histone deacetylase binding [GO:0042826]; protein dimerization activity [GO:0046983]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; transcription cis-regulatory region binding [GO:0000976]"	GO:0000785; GO:0000976; GO:0000978; GO:0000981; GO:0003682; GO:0003700; GO:0005634; GO:0005654; GO:0005667; GO:0006357; GO:0019899; GO:0030097; GO:0030218; GO:0030219; GO:0030221; GO:0031334; GO:0035162; GO:0042826; GO:0045165; GO:0045648; GO:0045893; GO:0045931; GO:0045944; GO:0046983; GO:0051781; GO:0061629; GO:0070888; GO:1905269	DAATAEAR	0.9852	12.694	11.6985	12.0368	11.3656	10.0692	10.0305	12.6086	12.2797	11.8103	12.7493	12.9592	13.1625	12.8654	11.4586	11.8139
A8K0M5	A8K0M5_HUMAN	cDNA FLJ76374		Homo sapiens (Human)			GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GO:0003924; GO:0005525	CAGSGGQLDSILPHQSPAWGPWGCK	0.22414	13.0037	12.0297	11.8339	11.0512	10.9854	10.3137	12.3136	12.3425	12.4114	11.5215	12.4476	12.7974	11.7283	12.5514	11.8523
P10909	CLUS_HUMAN	"Clusterin (Aging-associated gene 4 protein) (Apolipoprotein J) (Apo-J) (Complement cytolysis inhibitor) (CLI) (Complement-associated protein SP-40,40) (Ku70-binding protein 1) (NA1/NA2) (Sulfated glycoprotein 2) (SGP-2) (Testosterone-repressed prostate message 2) (TRPM-2) [Cleaved into: Clusterin beta chain (ApoJalpha) (Complement cytolysis inhibitor a chain); Clusterin alpha chain (ApoJbeta) (Complement cytolysis inhibitor b chain)]"	CLU APOJ CLI KUB1 AAG4	Homo sapiens (Human)	"cell morphogenesis [GO:0000902]; central nervous system myelin maintenance [GO:0032286]; chaperone-mediated protein complex assembly [GO:0051131]; chaperone-mediated protein folding [GO:0061077]; complement activation [GO:0006956]; complement activation, classical pathway [GO:0006958]; immune complex clearance [GO:0002434]; innate immune response [GO:0045087]; intrinsic apoptotic signaling pathway [GO:0097193]; lipid metabolic process [GO:0006629]; microglial cell activation [GO:0001774]; microglial cell proliferation [GO:0061518]; negative regulation of amyloid fibril formation [GO:1905907]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of cell death [GO:0060548]; negative regulation of cellular response to thapsigargin [GO:1905892]; negative regulation of cellular response to tunicamycin [GO:1905895]; negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage [GO:1902230]; negative regulation of protein-containing complex assembly [GO:0031333]; negative regulation of release of cytochrome c from mitochondria [GO:0090201]; negative regulation of response to endoplasmic reticulum stress [GO:1903573]; positive regulation of amyloid fibril formation [GO:1905908]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of apoptotic process [GO:0043065]; positive regulation of gene expression [GO:0010628]; positive regulation of intrinsic apoptotic signaling pathway [GO:2001244]; positive regulation of neurofibrillary tangle assembly [GO:1902998]; positive regulation of neuron death [GO:1901216]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein-containing complex assembly [GO:0031334]; positive regulation of receptor-mediated endocytosis [GO:0048260]; positive regulation of tau-protein kinase activity [GO:1902949]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of ubiquitin-dependent protein catabolic process [GO:2000060]; protein import [GO:0017038]; protein stabilization [GO:0050821]; protein targeting to lysosome involved in chaperone-mediated autophagy [GO:0061740]; regulation of amyloid-beta clearance [GO:1900221]; regulation of apoptotic process [GO:0042981]; regulation of cell population proliferation [GO:0042127]; regulation of neuron death [GO:1901214]; regulation of neuronal signal transduction [GO:1902847]; release of cytochrome c from mitochondria [GO:0001836]; response to misfolded protein [GO:0051788]; response to virus [GO:0009615]; reverse cholesterol transport [GO:0043691]"	apical dendrite [GO:0097440]; blood microparticle [GO:0072562]; cell surface [GO:0009986]; chromaffin granule [GO:0042583]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]; neurofibrillary tangle [GO:0097418]; nucleus [GO:0005634]; perinuclear endoplasmic reticulum lumen [GO:0099020]; perinuclear region of cytoplasm [GO:0048471]; platelet alpha granule lumen [GO:0031093]; protein-containing complex [GO:0032991]; spherical high-density lipoprotein particle [GO:0034366]; synapse [GO:0045202]	"apical dendrite [GO:0097440]; blood microparticle [GO:0072562]; cell surface [GO:0009986]; chromaffin granule [GO:0042583]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]; neurofibrillary tangle [GO:0097418]; nucleus [GO:0005634]; perinuclear endoplasmic reticulum lumen [GO:0099020]; perinuclear region of cytoplasm [GO:0048471]; platelet alpha granule lumen [GO:0031093]; protein-containing complex [GO:0032991]; spherical high-density lipoprotein particle [GO:0034366]; synapse [GO:0045202]; amyloid-beta binding [GO:0001540]; chaperone binding [GO:0051087]; low-density lipoprotein particle receptor binding [GO:0050750]; misfolded protein binding [GO:0051787]; protein carrier chaperone [GO:0140597]; protein heterodimerization activity [GO:0046982]; protein-containing complex binding [GO:0044877]; signaling receptor binding [GO:0005102]; tau protein binding [GO:0048156]; ubiquitin protein ligase binding [GO:0031625]; unfolded protein binding [GO:0051082]; cell morphogenesis [GO:0000902]; central nervous system myelin maintenance [GO:0032286]; chaperone-mediated protein complex assembly [GO:0051131]; chaperone-mediated protein folding [GO:0061077]; complement activation [GO:0006956]; complement activation, classical pathway [GO:0006958]; immune complex clearance [GO:0002434]; innate immune response [GO:0045087]; intrinsic apoptotic signaling pathway [GO:0097193]; lipid metabolic process [GO:0006629]; microglial cell activation [GO:0001774]; microglial cell proliferation [GO:0061518]; negative regulation of amyloid fibril formation [GO:1905907]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of cell death [GO:0060548]; negative regulation of cellular response to thapsigargin [GO:1905892]; negative regulation of cellular response to tunicamycin [GO:1905895]; negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage [GO:1902230]; negative regulation of protein-containing complex assembly [GO:0031333]; negative regulation of release of cytochrome c from mitochondria [GO:0090201]; negative regulation of response to endoplasmic reticulum stress [GO:1903573]; positive regulation of amyloid fibril formation [GO:1905908]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of apoptotic process [GO:0043065]; positive regulation of gene expression [GO:0010628]; positive regulation of intrinsic apoptotic signaling pathway [GO:2001244]; positive regulation of neurofibrillary tangle assembly [GO:1902998]; positive regulation of neuron death [GO:1901216]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein-containing complex assembly [GO:0031334]; positive regulation of receptor-mediated endocytosis [GO:0048260]; positive regulation of tau-protein kinase activity [GO:1902949]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of ubiquitin-dependent protein catabolic process [GO:2000060]; protein import [GO:0017038]; protein stabilization [GO:0050821]; protein targeting to lysosome involved in chaperone-mediated autophagy [GO:0061740]; regulation of amyloid-beta clearance [GO:1900221]; regulation of apoptotic process [GO:0042981]; regulation of cell population proliferation [GO:0042127]; regulation of neuron death [GO:1901214]; regulation of neuronal signal transduction [GO:1902847]; release of cytochrome c from mitochondria [GO:0001836]; response to misfolded protein [GO:0051788]; response to virus [GO:0009615]; reverse cholesterol transport [GO:0043691]"	amyloid-beta binding [GO:0001540]; chaperone binding [GO:0051087]; low-density lipoprotein particle receptor binding [GO:0050750]; misfolded protein binding [GO:0051787]; protein carrier chaperone [GO:0140597]; protein heterodimerization activity [GO:0046982]; protein-containing complex binding [GO:0044877]; signaling receptor binding [GO:0005102]; tau protein binding [GO:0048156]; ubiquitin protein ligase binding [GO:0031625]; unfolded protein binding [GO:0051082]	GO:0000902; GO:0001540; GO:0001774; GO:0001836; GO:0002434; GO:0005102; GO:0005576; GO:0005615; GO:0005634; GO:0005737; GO:0005739; GO:0005743; GO:0005794; GO:0005829; GO:0006629; GO:0006956; GO:0006958; GO:0009615; GO:0009986; GO:0010628; GO:0017038; GO:0031093; GO:0031333; GO:0031334; GO:0031625; GO:0032286; GO:0032436; GO:0032760; GO:0032991; GO:0034366; GO:0042127; GO:0042583; GO:0042981; GO:0043065; GO:0043231; GO:0043691; GO:0044877; GO:0045087; GO:0045202; GO:0045429; GO:0046982; GO:0048156; GO:0048260; GO:0048471; GO:0050750; GO:0050821; GO:0051082; GO:0051087; GO:0051092; GO:0051131; GO:0051787; GO:0051788; GO:0060548; GO:0061077; GO:0061518; GO:0061740; GO:0062023; GO:0070062; GO:0072562; GO:0090201; GO:0097193; GO:0097418; GO:0097440; GO:0099020; GO:0140597; GO:1900221; GO:1901214; GO:1901216; GO:1902004; GO:1902230; GO:1902430; GO:1902847; GO:1902949; GO:1902998; GO:1903573; GO:1905892; GO:1905895; GO:1905907; GO:1905908; GO:2000060; GO:2001244	CREILSVDCSTNNPSQAK	1.0063	12.3404	14.1089	11.1859	10.5533	10.0207	10.8752	12.3694	13.0987	11.0485	10.7912	10.9057	13.0959	12.4207	11.7698	14.3633
Q9UBT3	DKK4_HUMAN	Dickkopf-related protein 4 (Dickkopf-4) (Dkk-4) (hDkk-4) [Cleaved into: Dickkopf-related protein 4 short form]	DKK4	Homo sapiens (Human)	negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of hair follicle placode formation [GO:0061170]; negative regulation of Wnt signaling pathway [GO:0030178]; Wnt signaling pathway [GO:0016055]	extracellular space [GO:0005615]	extracellular space [GO:0005615]; co-receptor binding [GO:0039706]; receptor antagonist activity [GO:0048019]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of hair follicle placode formation [GO:0061170]; negative regulation of Wnt signaling pathway [GO:0030178]; Wnt signaling pathway [GO:0016055]	co-receptor binding [GO:0039706]; receptor antagonist activity [GO:0048019]	GO:0005615; GO:0016055; GO:0030178; GO:0039706; GO:0048019; GO:0061170; GO:0090090	CDCGPGLLCRSQLTSNR	0.99782	13.3088	12.2782	12.616	9.98085	9.66099	9.48142	12.6211	12.825	11.7295	12.7456	12.6877	11.6825	12.3334	11.364	12.4062
B4DFF5	B4DFF5_HUMAN	"cDNA FLJ57915, highly similar to Kelch-like protein 26"		Homo sapiens (Human)						AESGGSSGGAGGGGAFGAGPGPERPNSTADK	0.072917	12.1615	12.0291	12.0893	11.5093	11.5603	11.2827	10.7274	11.356	11.4081	12.2103	12.2712	11.8412	12.2492	11.9415	12.2106
Q08209	PP2BA_HUMAN	Protein phosphatase 3 catalytic subunit alpha (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calcineurin A alpha) (Calmodulin-dependent calcineurin A subunit alpha isoform) (CNA alpha) (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform)	PPP3CA CALNA CNA	Homo sapiens (Human)	aging [GO:0007568]; brain development [GO:0007420]; calcineurin-mediated signaling [GO:0097720]; calcineurin-NFAT signaling cascade [GO:0033173]; calcium ion transport [GO:0006816]; cardiac muscle hypertrophy in response to stress [GO:0014898]; cellular response to glucose stimulus [GO:0071333]; dendrite morphogenesis [GO:0048813]; dephosphorylation [GO:0016311]; epidermis development [GO:0008544]; excitatory postsynaptic potential [GO:0060079]; G1/S transition of mitotic cell cycle [GO:0000082]; keratinocyte differentiation [GO:0030216]; modulation of chemical synaptic transmission [GO:0050804]; multicellular organismal response to stress [GO:0033555]; negative regulation of calcium ion import across plasma membrane [GO:1905949]; negative regulation of chromatin binding [GO:0035562]; negative regulation of dendrite morphogenesis [GO:0050774]; negative regulation of insulin secretion [GO:0046676]; negative regulation of miRNA maturation [GO:1903799]; negative regulation of signaling [GO:0023057]; negative regulation of voltage-gated calcium channel activity [GO:1901386]; peptidyl-serine dephosphorylation [GO:0070262]; positive regulation of activated T cell proliferation [GO:0042104]; positive regulation of calcineurin-NFAT signaling cascade [GO:0070886]; positive regulation of calcium ion import across plasma membrane [GO:1905665]; positive regulation of cardiac muscle hypertrophy in response to stress [GO:1903244]; positive regulation of cell adhesion [GO:0045785]; positive regulation of cell migration [GO:0030335]; positive regulation of connective tissue replacement [GO:1905205]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of endocytosis [GO:0045807]; positive regulation of glomerulus development [GO:0090193]; positive regulation of osteoblast differentiation [GO:0045669]; positive regulation of osteoclast differentiation [GO:0045672]; positive regulation of saliva secretion [GO:0046878]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of voltage-gated calcium channel activity [GO:1901387]; postsynaptic modulation of chemical synaptic transmission [GO:0099170]; protein dephosphorylation [GO:0006470]; protein import into nucleus [GO:0006606]; regulation of cell proliferation involved in kidney morphogenesis [GO:0061006]; renal filtration [GO:0097205]; response to amphetamine [GO:0001975]; response to calcium ion [GO:0051592]; skeletal muscle fiber development [GO:0048741]; skeletal muscle tissue regeneration [GO:0043403]; T cell activation [GO:0042110]; transition between fast and slow fiber [GO:0014883]; wound healing [GO:0042060]	calcineurin complex [GO:0005955]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendritic spine [GO:0043197]; extrinsic component of plasma membrane [GO:0019897]; glutamatergic synapse [GO:0098978]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; protein serine/threonine phosphatase complex [GO:0008287]; sarcolemma [GO:0042383]; Schaffer collateral - CA1 synapse [GO:0098685]; slit diaphragm [GO:0036057]; Z disc [GO:0030018]	calcineurin complex [GO:0005955]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendritic spine [GO:0043197]; extrinsic component of plasma membrane [GO:0019897]; glutamatergic synapse [GO:0098978]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; protein serine/threonine phosphatase complex [GO:0008287]; sarcolemma [GO:0042383]; Schaffer collateral - CA1 synapse [GO:0098685]; slit diaphragm [GO:0036057]; Z disc [GO:0030018]; ATPase binding [GO:0051117]; calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516]; calmodulin-dependent protein phosphatase activity [GO:0033192]; cyclosporin A binding [GO:0016018]; enzyme binding [GO:0019899]; molecular function activator activity [GO:0140677]; myosin phosphatase activity [GO:0017018]; protein dimerization activity [GO:0046983]; protein serine/threonine phosphatase activity [GO:0004722]; protein-containing complex binding [GO:0044877]; aging [GO:0007568]; brain development [GO:0007420]; calcineurin-mediated signaling [GO:0097720]; calcineurin-NFAT signaling cascade [GO:0033173]; calcium ion transport [GO:0006816]; cardiac muscle hypertrophy in response to stress [GO:0014898]; cellular response to glucose stimulus [GO:0071333]; dendrite morphogenesis [GO:0048813]; dephosphorylation [GO:0016311]; epidermis development [GO:0008544]; excitatory postsynaptic potential [GO:0060079]; G1/S transition of mitotic cell cycle [GO:0000082]; keratinocyte differentiation [GO:0030216]; modulation of chemical synaptic transmission [GO:0050804]; multicellular organismal response to stress [GO:0033555]; negative regulation of calcium ion import across plasma membrane [GO:1905949]; negative regulation of chromatin binding [GO:0035562]; negative regulation of dendrite morphogenesis [GO:0050774]; negative regulation of insulin secretion [GO:0046676]; negative regulation of miRNA maturation [GO:1903799]; negative regulation of signaling [GO:0023057]; negative regulation of voltage-gated calcium channel activity [GO:1901386]; peptidyl-serine dephosphorylation [GO:0070262]; positive regulation of activated T cell proliferation [GO:0042104]; positive regulation of calcineurin-NFAT signaling cascade [GO:0070886]; positive regulation of calcium ion import across plasma membrane [GO:1905665]; positive regulation of cardiac muscle hypertrophy in response to stress [GO:1903244]; positive regulation of cell adhesion [GO:0045785]; positive regulation of cell migration [GO:0030335]; positive regulation of connective tissue replacement [GO:1905205]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of endocytosis [GO:0045807]; positive regulation of glomerulus development [GO:0090193]; positive regulation of osteoblast differentiation [GO:0045669]; positive regulation of osteoclast differentiation [GO:0045672]; positive regulation of saliva secretion [GO:0046878]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of voltage-gated calcium channel activity [GO:1901387]; postsynaptic modulation of chemical synaptic transmission [GO:0099170]; protein dephosphorylation [GO:0006470]; protein import into nucleus [GO:0006606]; regulation of cell proliferation involved in kidney morphogenesis [GO:0061006]; renal filtration [GO:0097205]; response to amphetamine [GO:0001975]; response to calcium ion [GO:0051592]; skeletal muscle fiber development [GO:0048741]; skeletal muscle tissue regeneration [GO:0043403]; T cell activation [GO:0042110]; transition between fast and slow fiber [GO:0014883]; wound healing [GO:0042060]	ATPase binding [GO:0051117]; calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516]; calmodulin-dependent protein phosphatase activity [GO:0033192]; cyclosporin A binding [GO:0016018]; enzyme binding [GO:0019899]; molecular function activator activity [GO:0140677]; myosin phosphatase activity [GO:0017018]; protein dimerization activity [GO:0046983]; protein serine/threonine phosphatase activity [GO:0004722]; protein-containing complex binding [GO:0044877]	GO:0000082; GO:0001975; GO:0004722; GO:0005509; GO:0005516; GO:0005654; GO:0005737; GO:0005739; GO:0005829; GO:0005886; GO:0005955; GO:0006470; GO:0006606; GO:0006816; GO:0007420; GO:0007568; GO:0008287; GO:0008544; GO:0014883; GO:0014898; GO:0016018; GO:0016311; GO:0017018; GO:0019897; GO:0019899; GO:0023057; GO:0030018; GO:0030216; GO:0030335; GO:0033173; GO:0033192; GO:0033555; GO:0035562; GO:0036057; GO:0042060; GO:0042104; GO:0042110; GO:0042383; GO:0043197; GO:0043403; GO:0044877; GO:0045669; GO:0045672; GO:0045785; GO:0045807; GO:0045944; GO:0046676; GO:0046878; GO:0046983; GO:0048741; GO:0048813; GO:0050774; GO:0050804; GO:0051091; GO:0051117; GO:0051592; GO:0060079; GO:0061006; GO:0070262; GO:0070886; GO:0071333; GO:0090193; GO:0097205; GO:0097720; GO:0098685; GO:0098978; GO:0099170; GO:0140677; GO:1901386; GO:1901387; GO:1903244; GO:1903799; GO:1905205; GO:1905665; GO:1905949	AHEAQDAGYR	1.0106	10.9586	12.7029	10.8123	11.573	11.9701	11.2815	12.0741	8.79893	12.1424	12.4101	12.2796	11.8774	12.7725	12.5183	12.657
B7Z1Y5	B7Z1Y5_HUMAN	Protein Wnt		Homo sapiens (Human)	Wnt signaling pathway [GO:0016055]	extracellular region [GO:0005576]	extracellular region [GO:0005576]; signaling receptor binding [GO:0005102]; Wnt signaling pathway [GO:0016055]	signaling receptor binding [GO:0005102]	GO:0005102; GO:0005576; GO:0016055	AVYKMADVACK	0.91379	11.1522	13.9119	13.6629	11.6365	11.3925	9.14868	12.9329	12.3514	11.3897	14.3329	11.0252	13.3953	9.9452	9.59848	10.895
Q8N6D2	RN182_HUMAN	E3 ubiquitin-protein ligase RNF182 (EC 2.3.2.27) (RING finger protein 182) (RING-type E3 ubiquitin transferase RNF182)	RNF182	Homo sapiens (Human)	protein ubiquitination [GO:0016567]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]; protein ubiquitination [GO:0016567]	metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]	GO:0004842; GO:0005737; GO:0016021; GO:0016567; GO:0046872	ASQPPEDTAESQASDELECK	0.92898	12.4365	12.4932	13.1446	11.5883	12.6812	0	13.3629	12.7858	13.3559	9.965	12.3591	13.4342	13.2805	12.7513	12.8397
B7Z1Z0	B7Z1Z0_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 (SUB1 homolog)		Homo sapiens (Human)	positive regulation of transcription initiation by RNA polymerase II [GO:0060261]	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; transcription coactivator activity [GO:0003713]; positive regulation of transcription initiation by RNA polymerase II [GO:0060261]	DNA binding [GO:0003677]; transcription coactivator activity [GO:0003713]	GO:0003677; GO:0003713; GO:0005634; GO:0060261	ALSSSKQSSSSR	0.98425	11.8915	11.7997	11.3201	12.6877	8.58692	11.2627	12.0539	12.7258	12.9559	12.8729	11.3479	12.1974	10.58	11.313	12.8509
B7Z9I1	B7Z9I1_HUMAN	"Medium-chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.7)"		Homo sapiens (Human)	fatty acid beta-oxidation [GO:0006635]	mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]	mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]; flavin adenine dinucleotide binding [GO:0050660]; medium-chain-acyl-CoA dehydrogenase activity [GO:0070991]; fatty acid beta-oxidation [GO:0006635]	flavin adenine dinucleotide binding [GO:0050660]; medium-chain-acyl-CoA dehydrogenase activity [GO:0070991]	GO:0005739; GO:0005759; GO:0006635; GO:0050660; GO:0070991	AAWEVDSGR	1.0108	12.5097	12.7834	12.6438	0	12.499	11.4102	11.0874	14.2191	13.5377	10.0228	12.0577	13.0158	11.5827	13.8103	14.8238
Q8N8Z6	DCBD1_HUMAN	"Discoidin, CUB and LCCL domain-containing protein 1"	DCBLD1	Homo sapiens (Human)		integral component of plasma membrane [GO:0005887]	integral component of plasma membrane [GO:0005887]; signaling receptor activity [GO:0038023]	signaling receptor activity [GO:0038023]	GO:0005887; GO:0038023	AAIHAGIIADELGGQISVLQRK	0.92439	13.0419	12.1168	12.4007	12.1912	0	0	13.3009	13.9822	14.3518	14.2453	14.027	14.3814	13.5207	13.7983	14.2128
P20138	CD33_HUMAN	Myeloid cell surface antigen CD33 (Sialic acid-binding Ig-like lectin 3) (Siglec-3) (gp67) (CD antigen CD33)	CD33 SIGLEC3	Homo sapiens (Human)	cell adhesion [GO:0007155]; cell-cell adhesion [GO:0098609]; cell-cell signaling [GO:0007267]; immune response-inhibiting signal transduction [GO:0002765]; negative regulation of calcium ion transport [GO:0051926]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of interleukin-1 beta production [GO:0032691]; negative regulation of interleukin-8 production [GO:0032717]; negative regulation of monocyte activation [GO:0150102]; negative regulation of tumor necrosis factor production [GO:0032720]; positive regulation of protein secretion [GO:0050714]; positive regulation of protein tyrosine phosphatase activity [GO:1903615]; signal transduction [GO:0007165]	cell surface [GO:0009986]; external side of plasma membrane [GO:0009897]; Golgi apparatus [GO:0005794]; integral component of plasma membrane [GO:0005887]; nucleoplasm [GO:0005654]; peroxisome [GO:0005777]; plasma membrane [GO:0005886]; specific granule membrane [GO:0035579]; tertiary granule membrane [GO:0070821]	cell surface [GO:0009986]; external side of plasma membrane [GO:0009897]; Golgi apparatus [GO:0005794]; integral component of plasma membrane [GO:0005887]; nucleoplasm [GO:0005654]; peroxisome [GO:0005777]; plasma membrane [GO:0005886]; specific granule membrane [GO:0035579]; tertiary granule membrane [GO:0070821]; carbohydrate binding [GO:0030246]; protein phosphatase binding [GO:0019903]; sialic acid binding [GO:0033691]; signaling receptor activity [GO:0038023]; cell adhesion [GO:0007155]; cell-cell adhesion [GO:0098609]; cell-cell signaling [GO:0007267]; immune response-inhibiting signal transduction [GO:0002765]; negative regulation of calcium ion transport [GO:0051926]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of interleukin-1 beta production [GO:0032691]; negative regulation of interleukin-8 production [GO:0032717]; negative regulation of monocyte activation [GO:0150102]; negative regulation of tumor necrosis factor production [GO:0032720]; positive regulation of protein secretion [GO:0050714]; positive regulation of protein tyrosine phosphatase activity [GO:1903615]; signal transduction [GO:0007165]	carbohydrate binding [GO:0030246]; protein phosphatase binding [GO:0019903]; sialic acid binding [GO:0033691]; signaling receptor activity [GO:0038023]	GO:0002765; GO:0005654; GO:0005777; GO:0005794; GO:0005886; GO:0005887; GO:0007155; GO:0007165; GO:0007267; GO:0008285; GO:0009897; GO:0009986; GO:0019903; GO:0030246; GO:0032691; GO:0032717; GO:0032720; GO:0033691; GO:0035579; GO:0038023; GO:0050714; GO:0051926; GO:0070821; GO:0098609; GO:0150102; GO:1903615	AARTAVGR	0.89474	13.5252	11.7584	9.60953	11.3973	9.61486	10.6037	9.10923	12.2007	12.6488	14.2277	12.0565	11.5529	12.9705	12.8286	11.3549
P08247	SYPH_HUMAN	Synaptophysin (Major synaptic vesicle protein p38)	SYP	Homo sapiens (Human)	cellular response to organic substance [GO:0071310]; endocytosis [GO:0006897]; regulation of long-term neuronal synaptic plasticity [GO:0048169]; regulation of neuronal synaptic plasticity [GO:0048168]; regulation of opioid receptor signaling pathway [GO:2000474]; regulation of short-term neuronal synaptic plasticity [GO:0048172]; regulation of synaptic vesicle exocytosis [GO:2000300]; synaptic vesicle endocytosis [GO:0048488]; synaptic vesicle maturation [GO:0016188]; synaptic vesicle membrane organization [GO:0048499]	anchoring junction [GO:0070161]; excitatory synapse [GO:0060076]; integral component of synaptic vesicle membrane [GO:0030285]; neuromuscular junction [GO:0031594]; neuron projection [GO:0043005]; perinuclear region of cytoplasm [GO:0048471]; presynaptic active zone [GO:0048786]; presynaptic membrane [GO:0042734]; Schaffer collateral - CA1 synapse [GO:0098685]; synaptic vesicle [GO:0008021]; synaptic vesicle membrane [GO:0030672]; terminal bouton [GO:0043195]	anchoring junction [GO:0070161]; excitatory synapse [GO:0060076]; integral component of synaptic vesicle membrane [GO:0030285]; neuromuscular junction [GO:0031594]; neuron projection [GO:0043005]; perinuclear region of cytoplasm [GO:0048471]; presynaptic active zone [GO:0048786]; presynaptic membrane [GO:0042734]; Schaffer collateral - CA1 synapse [GO:0098685]; synaptic vesicle [GO:0008021]; synaptic vesicle membrane [GO:0030672]; terminal bouton [GO:0043195]; cholesterol binding [GO:0015485]; identical protein binding [GO:0042802]; protein self-association [GO:0043621]; SH2 domain binding [GO:0042169]; cellular response to organic substance [GO:0071310]; endocytosis [GO:0006897]; regulation of long-term neuronal synaptic plasticity [GO:0048169]; regulation of neuronal synaptic plasticity [GO:0048168]; regulation of opioid receptor signaling pathway [GO:2000474]; regulation of short-term neuronal synaptic plasticity [GO:0048172]; regulation of synaptic vesicle exocytosis [GO:2000300]; synaptic vesicle endocytosis [GO:0048488]; synaptic vesicle maturation [GO:0016188]; synaptic vesicle membrane organization [GO:0048499]	cholesterol binding [GO:0015485]; identical protein binding [GO:0042802]; protein self-association [GO:0043621]; SH2 domain binding [GO:0042169]	GO:0006897; GO:0008021; GO:0015485; GO:0016188; GO:0030285; GO:0030672; GO:0031594; GO:0042169; GO:0042734; GO:0042802; GO:0043005; GO:0043195; GO:0043621; GO:0048168; GO:0048169; GO:0048172; GO:0048471; GO:0048488; GO:0048499; GO:0048786; GO:0060076; GO:0070161; GO:0071310; GO:0098685; GO:2000300; GO:2000474	APPGAPEK	0.8811	12.4705	12.9682	12.6233	0	9.9747	10.0007	12.3869	13.9714	11.8238	14.6368	13.5125	14.6452	12.2771	11.3179	12.6689
O94973	AP2A2_HUMAN	AP-2 complex subunit alpha-2 (100 kDa coated vesicle protein C) (Adaptor protein complex AP-2 subunit alpha-2) (Adaptor-related protein complex 2 subunit alpha-2) (Alpha-adaptin C) (Alpha2-adaptin) (Clathrin assembly protein complex 2 alpha-C large chain) (Huntingtin yeast partner J) (Huntingtin-interacting protein 9) (HIP-9) (Huntingtin-interacting protein J) (Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit)	AP2A2 ADTAB CLAPA2 HIP9 HYPJ KIAA0899	Homo sapiens (Human)	clathrin-dependent endocytosis [GO:0072583]; intracellular protein transport [GO:0006886]; postsynaptic neurotransmitter receptor internalization [GO:0098884]; receptor-mediated endocytosis [GO:0006898]; vesicle-mediated transport [GO:0016192]	AP-2 adaptor complex [GO:0030122]; clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated endocytic vesicle membrane [GO:0030669]; cytoplasmic side of plasma membrane [GO:0009898]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; endocytic vesicle membrane [GO:0030666]; endolysosome membrane [GO:0036020]; ficolin-1-rich granule membrane [GO:0101003]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; secretory granule membrane [GO:0030667]	AP-2 adaptor complex [GO:0030122]; clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated endocytic vesicle membrane [GO:0030669]; cytoplasmic side of plasma membrane [GO:0009898]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; endocytic vesicle membrane [GO:0030666]; endolysosome membrane [GO:0036020]; ficolin-1-rich granule membrane [GO:0101003]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; secretory granule membrane [GO:0030667]; cargo adaptor activity [GO:0140312]; clathrin adaptor activity [GO:0035615]; disordered domain specific binding [GO:0097718]; lipid binding [GO:0008289]; protein kinase binding [GO:0019901]; clathrin-dependent endocytosis [GO:0072583]; intracellular protein transport [GO:0006886]; postsynaptic neurotransmitter receptor internalization [GO:0098884]; receptor-mediated endocytosis [GO:0006898]; vesicle-mediated transport [GO:0016192]	cargo adaptor activity [GO:0140312]; clathrin adaptor activity [GO:0035615]; disordered domain specific binding [GO:0097718]; lipid binding [GO:0008289]; protein kinase binding [GO:0019901]	GO:0005829; GO:0005886; GO:0006886; GO:0006898; GO:0008289; GO:0009898; GO:0016192; GO:0019901; GO:0030122; GO:0030666; GO:0030667; GO:0030669; GO:0031410; GO:0035615; GO:0036020; GO:0045334; GO:0072583; GO:0097718; GO:0098794; GO:0098884; GO:0101003; GO:0140312	ACNQLGQFLQHR	0.99559	13.6198	13.3287	13.711	0	8.96483	10.5361	14.3073	14.2951	14.4477	12.716	13.0546	13.1795	10.1235	11.0632	11.8332
B4DFH8	B4DFH8_HUMAN	"cDNA FLJ52270, highly similar to Fragile X mental retardation 1 protein"		Homo sapiens (Human)	regulation of translation [GO:0006417]		mRNA binding [GO:0003729]; regulation of translation [GO:0006417]	mRNA binding [GO:0003729]	GO:0003729; GO:0006417	DSIANATVLLDYHLNYLK	0.99445	13.1074	12.2483	12.5651	0	11.2996	12.0633	12.2054	12.0893	12.6793	14.2017	11.7353	12.2471	12.3927	12.9072	12.738
B4DFI6	B4DFI6_HUMAN	60S ribosomal protein L4		Homo sapiens (Human)	translation [GO:0006412]	ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840]	ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	GO:0003735; GO:0005840; GO:0006412; GO:1990904	ACARPLISVYSEK	0.98729	0	12.7956	12.7064	11.4445	11.5126	11.6076	13.1306	13.3154	9.59753	13.9966	13.5344	13.7604	9.79048	13.325	13.0426
P09936	UCHL1_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCH-L1) (EC 3.4.19.12) (Neuron cytoplasmic protein 9.5) (PGP 9.5) (PGP9.5) (Ubiquitin thioesterase L1)	UCHL1	Homo sapiens (Human)	adult walking behavior [GO:0007628]; axon target recognition [GO:0007412]; axonal transport of mitochondrion [GO:0019896]; cellular response to xenobiotic stimulus [GO:0071466]; eating behavior [GO:0042755]; male germ cell proliferation [GO:0002176]; muscle cell development [GO:0055001]; negative regulation of MAP kinase activity [GO:0043407]; neuromuscular process [GO:0050905]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein deubiquitination [GO:0016579]; regulation of macroautophagy [GO:0016241]; response to ischemia [GO:0002931]; sensory perception of pain [GO:0019233]	axon cytoplasm [GO:1904115]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; neuron projection terminus [GO:0044306]; neuronal cell body [GO:0043025]; nucleoplasm [GO:0005654]	axon cytoplasm [GO:1904115]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; neuron projection terminus [GO:0044306]; neuronal cell body [GO:0043025]; nucleoplasm [GO:0005654]; alpha-2A adrenergic receptor binding [GO:0031694]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; ligase activity [GO:0016874]; omega peptidase activity [GO:0008242]; ubiquitin binding [GO:0043130]; ubiquitin protein ligase binding [GO:0031625]; adult walking behavior [GO:0007628]; axon target recognition [GO:0007412]; axonal transport of mitochondrion [GO:0019896]; cellular response to xenobiotic stimulus [GO:0071466]; eating behavior [GO:0042755]; male germ cell proliferation [GO:0002176]; muscle cell development [GO:0055001]; negative regulation of MAP kinase activity [GO:0043407]; neuromuscular process [GO:0050905]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein deubiquitination [GO:0016579]; regulation of macroautophagy [GO:0016241]; response to ischemia [GO:0002931]; sensory perception of pain [GO:0019233]	alpha-2A adrenergic receptor binding [GO:0031694]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; ligase activity [GO:0016874]; omega peptidase activity [GO:0008242]; ubiquitin binding [GO:0043130]; ubiquitin protein ligase binding [GO:0031625]	GO:0002176; GO:0002931; GO:0004197; GO:0004843; GO:0005654; GO:0005737; GO:0005789; GO:0005829; GO:0007412; GO:0007628; GO:0008242; GO:0016241; GO:0016579; GO:0016874; GO:0019233; GO:0019896; GO:0031625; GO:0031694; GO:0042755; GO:0043025; GO:0043130; GO:0043161; GO:0043407; GO:0044306; GO:0050905; GO:0055001; GO:0071466; GO:1904115	AKCFEKNEAIQAAHDAVAQEGQCR	0.94884	12.2266	10.707	12.3366	11.476	11.2345	11.4292	8.20765	12.4185	12.3518	12.4294	9.33307	13.0769	12.4046	12.0035	11.3336
B2RAA8	B2RAA8_HUMAN	Acyl-CoA-binding domain-containing protein 6		Homo sapiens (Human)			fatty-acyl-CoA binding [GO:0000062]	fatty-acyl-CoA binding [GO:0000062]	GO:0000062	ALGDSSPSQAMQEYIAVVK	0.87387	13.0951	12.9028	12.7422	11.8094	10.8064	0	12.0501	11.4211	14.4581	10.5481	13.6278	11.9983	13.3385	12.8236	11.3144
B4DFF1	B4DFF1_HUMAN	Heterogeneous nuclear ribonucleoprotein K		Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]; RNA processing [GO:0006396]	cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]; podosome [GO:0002102]; spliceosomal complex [GO:0005681]	cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]; podosome [GO:0002102]; spliceosomal complex [GO:0005681]; DNA binding [GO:0003677]; RNA binding [GO:0003723]; regulation of transcription by RNA polymerase II [GO:0006357]; RNA processing [GO:0006396]	DNA binding [GO:0003677]; RNA binding [GO:0003723]	GO:0002102; GO:0003677; GO:0003723; GO:0005654; GO:0005681; GO:0005737; GO:0006357; GO:0006396	DLAGSIIGK	1.009	10.8726	10.5293	12.088	11.852	10.9343	10.7838	11.9365	11.2487	12.0876	13.032	12.1867	12.7261	10.6008	11.7246	9.7751
A8K0P2	A8K0P2_HUMAN	Inorganic diphosphatase (EC 3.6.1.1)		Homo sapiens (Human)	phosphate-containing compound metabolic process [GO:0006796]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; inorganic diphosphate phosphatase activity [GO:0004427]; magnesium ion binding [GO:0000287]; phosphate-containing compound metabolic process [GO:0006796]	inorganic diphosphate phosphatase activity [GO:0004427]; magnesium ion binding [GO:0000287]	GO:0000287; GO:0004427; GO:0005737; GO:0006796	AFALEVIK	0.98354	14.5769	11.8333	10.7734	9.19434	10.3123	10.2883	15.2467	10.0612	10.0425	10.4653	10.8852	13.2745	11.114	11.977	12.2014
O95185	UNC5C_HUMAN	Netrin receptor UNC5C (Protein unc-5 homolog 3) (Protein unc-5 homolog C)	UNC5C UNC5H3	Homo sapiens (Human)	anterior/posterior axon guidance [GO:0033564]; apoptotic process [GO:0006915]; axon guidance [GO:0007411]; brain development [GO:0007420]; chemorepulsion of axon [GO:0061643]; dorsal root ganglion development [GO:1990791]; ectopic germ cell programmed cell death [GO:0035234]; positive regulation of apoptotic process [GO:0043065]; positive regulation of developmental process [GO:0051094]; positive regulation of reproductive process [GO:2000243]; regulation of neuron migration [GO:2001222]	anchoring junction [GO:0070161]; cell surface [GO:0009986]; dendrite [GO:0030425]; filopodium [GO:0030175]; growth cone [GO:0030426]; integral component of membrane [GO:0016021]; lamellipodium [GO:0030027]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886]; synapse [GO:0045202]	anchoring junction [GO:0070161]; cell surface [GO:0009986]; dendrite [GO:0030425]; filopodium [GO:0030175]; growth cone [GO:0030426]; integral component of membrane [GO:0016021]; lamellipodium [GO:0030027]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886]; synapse [GO:0045202]; netrin receptor activity [GO:0005042]; netrin receptor activity involved in chemorepulsion [GO:0005043]; protein kinase binding [GO:0019901]; tubulin binding [GO:0015631]; anterior/posterior axon guidance [GO:0033564]; apoptotic process [GO:0006915]; axon guidance [GO:0007411]; brain development [GO:0007420]; chemorepulsion of axon [GO:0061643]; dorsal root ganglion development [GO:1990791]; ectopic germ cell programmed cell death [GO:0035234]; positive regulation of apoptotic process [GO:0043065]; positive regulation of developmental process [GO:0051094]; positive regulation of reproductive process [GO:2000243]; regulation of neuron migration [GO:2001222]	netrin receptor activity [GO:0005042]; netrin receptor activity involved in chemorepulsion [GO:0005043]; protein kinase binding [GO:0019901]; tubulin binding [GO:0015631]	GO:0005042; GO:0005043; GO:0005886; GO:0006915; GO:0007411; GO:0007420; GO:0009986; GO:0015631; GO:0016021; GO:0019901; GO:0030027; GO:0030175; GO:0030425; GO:0030426; GO:0033564; GO:0035234; GO:0043025; GO:0043065; GO:0045202; GO:0051094; GO:0061643; GO:0070161; GO:1990791; GO:2000243; GO:2001222	AARQDLLAVPPDLTSAAAMYR	0.60731	13.7342	13.8447	13.3157	13.0406	12.8385	9.71108	14.0972	13.8656	14.1926	14.1244	14.337	11.2989	0	0	13.7198
B2R5W6	B2R5W6_HUMAN	"cDNA, FLJ92661, highly similar to Homo sapiens microtubule-associated protein, RP/EB family, member 3 (MAPRE3), mRNA"		Homo sapiens (Human)	cell cycle [GO:0007049]; cell division [GO:0051301]	cytoplasm [GO:0005737]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; microtubule binding [GO:0008017]; cell cycle [GO:0007049]; cell division [GO:0051301]	microtubule binding [GO:0008017]	GO:0005737; GO:0005874; GO:0007049; GO:0008017; GO:0051301	DFYFSKLR	0.90909	11.6085	11.1658	11.6974	12.2783	12.2505	14.7484	10.6905	10.9572	11.4824	9.2543	10.8031	13.0502	10.7785	11.0262	10.1481
Q6GTS8	P20D1_HUMAN	N-fatty-acyl-amino acid synthase/hydrolase PM20D1 (EC 3.5.1.114) (EC 3.5.1.14) (Peptidase M20 domain-containing protein 1)	PM20D1	Homo sapiens (Human)	adaptive thermogenesis [GO:1990845]; amide biosynthetic process [GO:0043604]; cellular amide catabolic process [GO:0043605]; cellular amino acid metabolic process [GO:0006520]; cellular lipid metabolic process [GO:0044255]; energy homeostasis [GO:0097009]; fatty acid metabolic process [GO:0006631]; negative regulation of neuron death [GO:1901215]; nitrogen compound metabolic process [GO:0006807]; proteolysis [GO:0006508]; regulation of oxidative phosphorylation uncoupler activity [GO:2000275]	extracellular exosome [GO:0070062]; extracellular region [GO:0005576]	"extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; aminoacylase activity [GO:0004046]; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [GO:0016811]; lyase activity [GO:0016829]; metal ion binding [GO:0046872]; peptidase activity [GO:0008233]; adaptive thermogenesis [GO:1990845]; amide biosynthetic process [GO:0043604]; cellular amide catabolic process [GO:0043605]; cellular amino acid metabolic process [GO:0006520]; cellular lipid metabolic process [GO:0044255]; energy homeostasis [GO:0097009]; fatty acid metabolic process [GO:0006631]; negative regulation of neuron death [GO:1901215]; nitrogen compound metabolic process [GO:0006807]; proteolysis [GO:0006508]; regulation of oxidative phosphorylation uncoupler activity [GO:2000275]"	"aminoacylase activity [GO:0004046]; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [GO:0016811]; lyase activity [GO:0016829]; metal ion binding [GO:0046872]; peptidase activity [GO:0008233]"	GO:0004046; GO:0005576; GO:0006508; GO:0006520; GO:0006631; GO:0006807; GO:0008233; GO:0016811; GO:0016829; GO:0043604; GO:0043605; GO:0044255; GO:0046872; GO:0070062; GO:0097009; GO:1901215; GO:1990845; GO:2000275	AGVKFNVIPPVAQATVNFR	0.87179	13.7977	12.7574	12.0792	11.6559	0	11.677	11.9531	12.1293	11.9347	15.1434	10.6913	14.1392	12.1158	10.4977	11.0037
Q15109	RAGE_HUMAN	Advanced glycosylation end product-specific receptor (Receptor for advanced glycosylation end products)	AGER RAGE	Homo sapiens (Human)	"astrocyte activation [GO:0048143]; cell surface receptor signaling pathway [GO:0007166]; cellular response to amyloid-beta [GO:1904646]; glucose mediated signaling pathway [GO:0010255]; induction of positive chemotaxis [GO:0050930]; inflammatory response [GO:0006954]; learning or memory [GO:0007611]; microglial cell activation [GO:0001774]; negative regulation of blood circulation [GO:1903523]; negative regulation of interleukin-10 production [GO:0032693]; negative regulation of long-term synaptic depression [GO:1900453]; negative regulation of long-term synaptic potentiation [GO:1900272]; neuron projection development [GO:0031175]; positive regulation of activated T cell proliferation [GO:0042104]; positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902961]; positive regulation of chemokine production [GO:0032722]; positive regulation of dendritic cell differentiation [GO:2001200]; positive regulation of endothelin production [GO:1904472]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of heterotypic cell-cell adhesion [GO:0034116]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-12 production [GO:0032735]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of JNK cascade [GO:0046330]; positive regulation of JUN kinase activity [GO:0043507]; positive regulation of monocyte chemotactic protein-1 production [GO:0071639]; positive regulation of monocyte extravasation [GO:2000439]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of p38MAPK cascade [GO:1900745]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of tumor necrosis factor production [GO:0032760]; protein localization to membrane [GO:0072657]; regulation of CD4-positive, alpha-beta T cell activation [GO:2000514]; regulation of DNA binding [GO:0051101]; regulation of inflammatory response [GO:0050727]; regulation of long-term synaptic potentiation [GO:1900271]; regulation of NIK/NF-kappaB signaling [GO:1901222]; regulation of p38MAPK cascade [GO:1900744]; regulation of spontaneous synaptic transmission [GO:0150003]; regulation of synaptic plasticity [GO:0048167]; regulation of T cell mediated cytotoxicity [GO:0001914]; response to amyloid-beta [GO:1904645]; response to hypoxia [GO:0001666]; response to wounding [GO:0009611]; transcytosis [GO:0045056]; transport across blood-brain barrier [GO:0150104]"	apical plasma membrane [GO:0016324]; cell junction [GO:0030054]; cell surface [GO:0009986]; extracellular region [GO:0005576]; fibrillar center [GO:0001650]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]	"apical plasma membrane [GO:0016324]; cell junction [GO:0030054]; cell surface [GO:0009986]; extracellular region [GO:0005576]; fibrillar center [GO:0001650]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; advanced glycation end-product receptor activity [GO:0050785]; amyloid-beta binding [GO:0001540]; identical protein binding [GO:0042802]; molecular adaptor activity [GO:0060090]; protein-containing complex binding [GO:0044877]; S100 protein binding [GO:0044548]; scavenger receptor activity [GO:0005044]; signaling receptor activity [GO:0038023]; transmembrane signaling receptor activity [GO:0004888]; astrocyte activation [GO:0048143]; cell surface receptor signaling pathway [GO:0007166]; cellular response to amyloid-beta [GO:1904646]; glucose mediated signaling pathway [GO:0010255]; induction of positive chemotaxis [GO:0050930]; inflammatory response [GO:0006954]; learning or memory [GO:0007611]; microglial cell activation [GO:0001774]; negative regulation of blood circulation [GO:1903523]; negative regulation of interleukin-10 production [GO:0032693]; negative regulation of long-term synaptic depression [GO:1900453]; negative regulation of long-term synaptic potentiation [GO:1900272]; neuron projection development [GO:0031175]; positive regulation of activated T cell proliferation [GO:0042104]; positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902961]; positive regulation of chemokine production [GO:0032722]; positive regulation of dendritic cell differentiation [GO:2001200]; positive regulation of endothelin production [GO:1904472]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of heterotypic cell-cell adhesion [GO:0034116]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-12 production [GO:0032735]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of JNK cascade [GO:0046330]; positive regulation of JUN kinase activity [GO:0043507]; positive regulation of monocyte chemotactic protein-1 production [GO:0071639]; positive regulation of monocyte extravasation [GO:2000439]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of p38MAPK cascade [GO:1900745]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of tumor necrosis factor production [GO:0032760]; protein localization to membrane [GO:0072657]; regulation of CD4-positive, alpha-beta T cell activation [GO:2000514]; regulation of DNA binding [GO:0051101]; regulation of inflammatory response [GO:0050727]; regulation of long-term synaptic potentiation [GO:1900271]; regulation of NIK/NF-kappaB signaling [GO:1901222]; regulation of p38MAPK cascade [GO:1900744]; regulation of spontaneous synaptic transmission [GO:0150003]; regulation of synaptic plasticity [GO:0048167]; regulation of T cell mediated cytotoxicity [GO:0001914]; response to amyloid-beta [GO:1904645]; response to hypoxia [GO:0001666]; response to wounding [GO:0009611]; transcytosis [GO:0045056]; transport across blood-brain barrier [GO:0150104]"	advanced glycation end-product receptor activity [GO:0050785]; amyloid-beta binding [GO:0001540]; identical protein binding [GO:0042802]; molecular adaptor activity [GO:0060090]; protein-containing complex binding [GO:0044877]; S100 protein binding [GO:0044548]; scavenger receptor activity [GO:0005044]; signaling receptor activity [GO:0038023]; transmembrane signaling receptor activity [GO:0004888]	GO:0001540; GO:0001650; GO:0001666; GO:0001774; GO:0001914; GO:0001934; GO:0004888; GO:0005044; GO:0005576; GO:0005886; GO:0005887; GO:0006954; GO:0007166; GO:0007611; GO:0009611; GO:0009986; GO:0010255; GO:0016324; GO:0030054; GO:0031175; GO:0032693; GO:0032722; GO:0032731; GO:0032735; GO:0032755; GO:0032760; GO:0034116; GO:0038023; GO:0042104; GO:0042802; GO:0043507; GO:0044548; GO:0044877; GO:0045056; GO:0046330; GO:0048143; GO:0048167; GO:0050727; GO:0050785; GO:0050930; GO:0051092; GO:0051101; GO:0060090; GO:0070374; GO:0071639; GO:0072657; GO:0098794; GO:0150003; GO:0150104; GO:1900271; GO:1900272; GO:1900453; GO:1900744; GO:1900745; GO:1901222; GO:1901224; GO:1902961; GO:1903523; GO:1904472; GO:1904645; GO:1904646; GO:2000439; GO:2000514; GO:2001200	APENQEEEEER	1	14.5755	10.6183	10.8288	8.87593	9.69251	10.6267	12.2612	13.0022	13.1863	11.9508	13.8456	9.82683	11.8398	10.1893	10.1895
O43521	B2L11_HUMAN	Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)	BCL2L11 BIM	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; apoptotic process [GO:0006915]; apoptotic process involved in embryonic digit morphogenesis [GO:1902263]; B cell homeostasis [GO:0001782]; brain development [GO:0007420]; cell-matrix adhesion [GO:0007160]; cellular response to amyloid-beta [GO:1904646]; cellular response to estradiol stimulus [GO:0071392]; cellular response to glucocorticoid stimulus [GO:0071385]; developmental pigmentation [GO:0048066]; ear development [GO:0043583]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; in utero embryonic development [GO:0001701]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; kidney development [GO:0001822]; male gonad development [GO:0008584]; mammary gland development [GO:0030879]; meiosis I [GO:0007127]; myeloid cell homeostasis [GO:0002262]; odontogenesis of dentin-containing tooth [GO:0042475]; positive regulation of apoptotic process [GO:0043065]; positive regulation of autophagy in response to ER overload [GO:0034263]; positive regulation of cell cycle [GO:0045787]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [GO:1902237]; positive regulation of fibroblast apoptotic process [GO:2000271]; positive regulation of intrinsic apoptotic signaling pathway [GO:2001244]; positive regulation of IRE1-mediated unfolded protein response [GO:1903896]; positive regulation of mitochondrial membrane permeability involved in apoptotic process [GO:1902110]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of protein-containing complex assembly [GO:0031334]; positive regulation of release of cytochrome c from mitochondria [GO:0090200]; positive regulation of T cell apoptotic process [GO:0070234]; post-embryonic animal organ morphogenesis [GO:0048563]; regulation of apoptotic process [GO:0042981]; regulation of developmental pigmentation [GO:0048070]; regulation of organ growth [GO:0046620]; response to endoplasmic reticulum stress [GO:0034976]; spermatogenesis [GO:0007283]; spleen development [GO:0048536]; T cell homeostasis [GO:0043029]; thymocyte apoptotic process [GO:0070242]; thymus development [GO:0048538]; tube formation [GO:0035148]	Bcl-2 family protein complex [GO:0097136]; BIM-BCL-2 complex [GO:0097141]; BIM-BCL-xl complex [GO:0097140]; cytosol [GO:0005829]; endomembrane system [GO:0012505]; extrinsic component of membrane [GO:0019898]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]	Bcl-2 family protein complex [GO:0097136]; BIM-BCL-2 complex [GO:0097141]; BIM-BCL-xl complex [GO:0097140]; cytosol [GO:0005829]; endomembrane system [GO:0012505]; extrinsic component of membrane [GO:0019898]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; microtubule binding [GO:0008017]; molecular adaptor activity [GO:0060090]; protein kinase binding [GO:0019901]; activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; apoptotic process [GO:0006915]; apoptotic process involved in embryonic digit morphogenesis [GO:1902263]; B cell homeostasis [GO:0001782]; brain development [GO:0007420]; cell-matrix adhesion [GO:0007160]; cellular response to amyloid-beta [GO:1904646]; cellular response to estradiol stimulus [GO:0071392]; cellular response to glucocorticoid stimulus [GO:0071385]; developmental pigmentation [GO:0048066]; ear development [GO:0043583]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; in utero embryonic development [GO:0001701]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; kidney development [GO:0001822]; male gonad development [GO:0008584]; mammary gland development [GO:0030879]; meiosis I [GO:0007127]; myeloid cell homeostasis [GO:0002262]; odontogenesis of dentin-containing tooth [GO:0042475]; positive regulation of apoptotic process [GO:0043065]; positive regulation of autophagy in response to ER overload [GO:0034263]; positive regulation of cell cycle [GO:0045787]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [GO:1902237]; positive regulation of fibroblast apoptotic process [GO:2000271]; positive regulation of intrinsic apoptotic signaling pathway [GO:2001244]; positive regulation of IRE1-mediated unfolded protein response [GO:1903896]; positive regulation of mitochondrial membrane permeability involved in apoptotic process [GO:1902110]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of protein-containing complex assembly [GO:0031334]; positive regulation of release of cytochrome c from mitochondria [GO:0090200]; positive regulation of T cell apoptotic process [GO:0070234]; post-embryonic animal organ morphogenesis [GO:0048563]; regulation of apoptotic process [GO:0042981]; regulation of developmental pigmentation [GO:0048070]; regulation of organ growth [GO:0046620]; response to endoplasmic reticulum stress [GO:0034976]; spermatogenesis [GO:0007283]; spleen development [GO:0048536]; T cell homeostasis [GO:0043029]; thymocyte apoptotic process [GO:0070242]; thymus development [GO:0048538]; tube formation [GO:0035148]	microtubule binding [GO:0008017]; molecular adaptor activity [GO:0060090]; protein kinase binding [GO:0019901]	GO:0001701; GO:0001782; GO:0001822; GO:0002262; GO:0005739; GO:0005741; GO:0005829; GO:0006915; GO:0006919; GO:0007127; GO:0007160; GO:0007283; GO:0007420; GO:0008017; GO:0008584; GO:0008630; GO:0012505; GO:0019898; GO:0019901; GO:0030879; GO:0031334; GO:0034263; GO:0034976; GO:0035148; GO:0042475; GO:0042981; GO:0043029; GO:0043065; GO:0043280; GO:0043525; GO:0043583; GO:0045787; GO:0046620; GO:0048066; GO:0048070; GO:0048536; GO:0048538; GO:0048563; GO:0060090; GO:0070234; GO:0070242; GO:0071385; GO:0071392; GO:0090200; GO:0097136; GO:0097140; GO:0097141; GO:0097192; GO:1902110; GO:1902237; GO:1902263; GO:1903896; GO:1904646; GO:2000271; GO:2001244	AKQPSDVSSECDR	0.92288	11.7049	11.62	11.6203	11.5959	11.249	12.0477	13.0605	12.9102	0	12.5755	12.7305	12.5699	12.2367	11.9176	12.8946
Q9NY61	AATF_HUMAN	Protein AATF (Apoptosis-antagonizing transcription factor) (Rb-binding protein Che-1)	AATF CHE1 DED HSPC277	Homo sapiens (Human)	cell adhesion [GO:0007155]; cellular response to DNA damage stimulus [GO:0006974]; embryonic cleavage [GO:0040016]; negative regulation of amyloid precursor protein biosynthetic process [GO:0042985]; negative regulation of apoptotic process [GO:0043066]; negative regulation of apoptotic signaling pathway [GO:2001234]; negative regulation of reactive oxygen species metabolic process [GO:2000378]; negative regulation of superoxide anion generation [GO:0032929]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of mitotic cell cycle [GO:0007346]; regulation of transcription by RNA polymerase II [GO:0006357]; ribosome biogenesis [GO:0042254]	cytoplasm [GO:0005737]; Golgi apparatus [GO:0005794]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	cytoplasm [GO:0005737]; Golgi apparatus [GO:0005794]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]; leucine zipper domain binding [GO:0043522]; protein kinase binding [GO:0019901]; RNA binding [GO:0003723]; tau protein binding [GO:0048156]; cell adhesion [GO:0007155]; cellular response to DNA damage stimulus [GO:0006974]; embryonic cleavage [GO:0040016]; negative regulation of amyloid precursor protein biosynthetic process [GO:0042985]; negative regulation of apoptotic process [GO:0043066]; negative regulation of apoptotic signaling pathway [GO:2001234]; negative regulation of reactive oxygen species metabolic process [GO:2000378]; negative regulation of superoxide anion generation [GO:0032929]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of mitotic cell cycle [GO:0007346]; regulation of transcription by RNA polymerase II [GO:0006357]; ribosome biogenesis [GO:0042254]	leucine zipper domain binding [GO:0043522]; protein kinase binding [GO:0019901]; RNA binding [GO:0003723]; tau protein binding [GO:0048156]	GO:0003723; GO:0005634; GO:0005654; GO:0005667; GO:0005730; GO:0005737; GO:0005794; GO:0006357; GO:0006974; GO:0007155; GO:0007346; GO:0019901; GO:0032929; GO:0040016; GO:0042254; GO:0042985; GO:0043066; GO:0043522; GO:0045944; GO:0048156; GO:2000378; GO:2001234	AGDRNSEDDGVVMTFSSVK	1.0084	11.3933	10.8491	11.783	8.97608	9.2246	10.6057	10.5771	11.009	12.9553	11.0994	11.8634	12.3551	12.7643	13.3351	11.8862
P01112	RASH_HUMAN	"GTPase HRas (EC 3.6.5.2) (H-Ras-1) (Ha-Ras) (Transforming protein p21) (c-H-ras) (p21ras) [Cleaved into: GTPase HRas, N-terminally processed]"	HRAS HRAS1	Homo sapiens (Human)	adipose tissue development [GO:0060612]; animal organ morphogenesis [GO:0009887]; cell surface receptor signaling pathway [GO:0007166]; cellular response to gamma radiation [GO:0071480]; cellular senescence [GO:0090398]; chemotaxis [GO:0006935]; defense response to protozoan [GO:0042832]; endocytosis [GO:0006897]; fibroblast proliferation [GO:0048144]; intrinsic apoptotic signaling pathway [GO:0097193]; MAPK cascade [GO:0000165]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of gene expression [GO:0010629]; negative regulation of GTPase activity [GO:0034260]; negative regulation of neuron apoptotic process [GO:0043524]; neuron apoptotic process [GO:0051402]; positive regulation of actin cytoskeleton reorganization [GO:2000251]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of epithelial cell proliferation [GO:0050679]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of fibroblast proliferation [GO:0048146]; positive regulation of GTPase activity [GO:0043547]; positive regulation of interferon-gamma production [GO:0032729]; positive regulation of JNK cascade [GO:0046330]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of miRNA metabolic process [GO:2000630]; positive regulation of phospholipase C activity [GO:0010863]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein targeting to membrane [GO:0090314]; positive regulation of ruffle assembly [GO:1900029]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of wound healing [GO:0090303]; Ras protein signal transduction [GO:0007265]; regulation of cell cycle [GO:0051726]; regulation of cell population proliferation [GO:0042127]; regulation of long-term neuronal synaptic plasticity [GO:0048169]; regulation of MAP kinase activity [GO:0043405]; regulation of neurotransmitter receptor localization to postsynaptic specialization membrane [GO:0098696]; regulation of transcription by RNA polymerase II [GO:0006357]; signal transduction [GO:0007165]; T cell receptor signaling pathway [GO:0050852]; T-helper 1 type immune response [GO:0042088]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; GTPase complex [GO:1905360]; nucleoplasm [GO:0005654]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; GTPase complex [GO:1905360]; nucleoplasm [GO:0005654]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; G protein activity [GO:0003925]; GDP binding [GO:0019003]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; protein C-terminus binding [GO:0008022]; adipose tissue development [GO:0060612]; animal organ morphogenesis [GO:0009887]; cell surface receptor signaling pathway [GO:0007166]; cellular response to gamma radiation [GO:0071480]; cellular senescence [GO:0090398]; chemotaxis [GO:0006935]; defense response to protozoan [GO:0042832]; endocytosis [GO:0006897]; fibroblast proliferation [GO:0048144]; intrinsic apoptotic signaling pathway [GO:0097193]; MAPK cascade [GO:0000165]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of gene expression [GO:0010629]; negative regulation of GTPase activity [GO:0034260]; negative regulation of neuron apoptotic process [GO:0043524]; neuron apoptotic process [GO:0051402]; positive regulation of actin cytoskeleton reorganization [GO:2000251]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of epithelial cell proliferation [GO:0050679]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of fibroblast proliferation [GO:0048146]; positive regulation of GTPase activity [GO:0043547]; positive regulation of interferon-gamma production [GO:0032729]; positive regulation of JNK cascade [GO:0046330]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of miRNA metabolic process [GO:2000630]; positive regulation of phospholipase C activity [GO:0010863]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein targeting to membrane [GO:0090314]; positive regulation of ruffle assembly [GO:1900029]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of wound healing [GO:0090303]; Ras protein signal transduction [GO:0007265]; regulation of cell cycle [GO:0051726]; regulation of cell population proliferation [GO:0042127]; regulation of long-term neuronal synaptic plasticity [GO:0048169]; regulation of MAP kinase activity [GO:0043405]; regulation of neurotransmitter receptor localization to postsynaptic specialization membrane [GO:0098696]; regulation of transcription by RNA polymerase II [GO:0006357]; signal transduction [GO:0007165]; T cell receptor signaling pathway [GO:0050852]; T-helper 1 type immune response [GO:0042088]	G protein activity [GO:0003925]; GDP binding [GO:0019003]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; protein C-terminus binding [GO:0008022]	GO:0000139; GO:0000165; GO:0001934; GO:0003924; GO:0003925; GO:0005525; GO:0005654; GO:0005737; GO:0005789; GO:0005794; GO:0005829; GO:0005886; GO:0006357; GO:0006897; GO:0006935; GO:0007165; GO:0007166; GO:0007265; GO:0008022; GO:0008284; GO:0008285; GO:0009887; GO:0010629; GO:0010863; GO:0019003; GO:0030335; GO:0032729; GO:0034260; GO:0042088; GO:0042127; GO:0042832; GO:0043405; GO:0043406; GO:0043410; GO:0043524; GO:0043547; GO:0045944; GO:0046330; GO:0048144; GO:0048146; GO:0048169; GO:0048471; GO:0050679; GO:0050852; GO:0051402; GO:0051726; GO:0060612; GO:0070374; GO:0071480; GO:0090303; GO:0090314; GO:0090398; GO:0097193; GO:0098696; GO:0098978; GO:1900029; GO:1905360; GO:2000251; GO:2000630	CDLAARTVESR	0.92476	12.0242	13.5479	11.5958	12.276	12.4268	0	12.6226	13.1617	12.9903	12.7929	12.793	13.0491	9.7226	11.1062	10.3326
A0A218KGP0	A0A218KGP0_HUMAN	Presenilin (EC 3.4.23.-)	PSEN1	Homo sapiens (Human)	amyloid precursor protein catabolic process [GO:0042987]; apoptotic process [GO:0006915]; cell adhesion [GO:0007155]; intracellular signal transduction [GO:0035556]; Notch signaling pathway [GO:0007219]; protein processing [GO:0016485]	anchoring junction [GO:0070161]; axon [GO:0030424]; early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; synapse [GO:0045202]	"anchoring junction [GO:0070161]; axon [GO:0030424]; early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; synapse [GO:0045202]; aspartic endopeptidase activity, intramembrane cleaving [GO:0042500]; amyloid precursor protein catabolic process [GO:0042987]; apoptotic process [GO:0006915]; cell adhesion [GO:0007155]; intracellular signal transduction [GO:0035556]; Notch signaling pathway [GO:0007219]; protein processing [GO:0016485]"	"aspartic endopeptidase activity, intramembrane cleaving [GO:0042500]"	GO:0000139; GO:0005789; GO:0005886; GO:0006915; GO:0007155; GO:0007219; GO:0016021; GO:0016485; GO:0030424; GO:0031901; GO:0035556; GO:0042500; GO:0042987; GO:0045202; GO:0070161	AAVQELSSSILAGEDPEERGVK	0.94355	9.90811	12.6977	11.1502	0	11.8353	11.9	12.3693	10.1499	12.8716	13.6119	11.066	13.871	12.8928	13.0702	12.9982
O75509	TNR21_HUMAN	Tumor necrosis factor receptor superfamily member 21 (Death receptor 6) (CD antigen CD358)	TNFRSF21 DR6 UNQ437/PRO868	Homo sapiens (Human)	adaptive immune response [GO:0002250]; apoptotic process [GO:0006915]; axonal fasciculation [GO:0007413]; B cell apoptotic process [GO:0001783]; cellular response to tumor necrosis factor [GO:0071356]; humoral immune response [GO:0006959]; myelination [GO:0042552]; negative regulation of B cell proliferation [GO:0030889]; negative regulation of interleukin-10 production [GO:0032693]; negative regulation of interleukin-13 production [GO:0032696]; negative regulation of interleukin-5 production [GO:0032714]; negative regulation of myelination [GO:0031642]; negative regulation of T cell proliferation [GO:0042130]; neuron apoptotic process [GO:0051402]; oligodendrocyte apoptotic process [GO:0097252]; regulation of oligodendrocyte differentiation [GO:0048713]; T cell receptor signaling pathway [GO:0050852]	axon [GO:0030424]; cytoplasm [GO:0005737]; integral component of plasma membrane [GO:0005887]; intrinsic component of plasma membrane [GO:0031226]; plasma membrane [GO:0005886]	axon [GO:0030424]; cytoplasm [GO:0005737]; integral component of plasma membrane [GO:0005887]; intrinsic component of plasma membrane [GO:0031226]; plasma membrane [GO:0005886]; adaptive immune response [GO:0002250]; apoptotic process [GO:0006915]; axonal fasciculation [GO:0007413]; B cell apoptotic process [GO:0001783]; cellular response to tumor necrosis factor [GO:0071356]; humoral immune response [GO:0006959]; myelination [GO:0042552]; negative regulation of B cell proliferation [GO:0030889]; negative regulation of interleukin-10 production [GO:0032693]; negative regulation of interleukin-13 production [GO:0032696]; negative regulation of interleukin-5 production [GO:0032714]; negative regulation of myelination [GO:0031642]; negative regulation of T cell proliferation [GO:0042130]; neuron apoptotic process [GO:0051402]; oligodendrocyte apoptotic process [GO:0097252]; regulation of oligodendrocyte differentiation [GO:0048713]; T cell receptor signaling pathway [GO:0050852]		GO:0001783; GO:0002250; GO:0005737; GO:0005886; GO:0005887; GO:0006915; GO:0006959; GO:0007413; GO:0030424; GO:0030889; GO:0031226; GO:0031642; GO:0032693; GO:0032696; GO:0032714; GO:0042130; GO:0042552; GO:0048713; GO:0050852; GO:0051402; GO:0071356; GO:0097252	AGLKKSMTPTQNR	1.0081	11.5995	13.022	13.5798	12.0749	10.228	0	9.06264	9.60591	12.7799	14.3236	12.7805	13.269	13.1509	11.3304	13.3999
O00213	APBB1_HUMAN	Amyloid beta precursor protein binding family B member 1 (Amyloid-beta A4 precursor protein-binding family B member 1) (Protein Fe65)	APBB1 FE65 RIR	Homo sapiens (Human)	apoptotic process [GO:0006915]; axonogenesis [GO:0007409]; cellular response to DNA damage stimulus [GO:0006974]; chromatin organization [GO:0006325]; histone H4 acetylation [GO:0043967]; negative regulation of cell cycle G1/S phase transition [GO:1902807]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of apoptotic process [GO:0043065]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of protein secretion [GO:0050714]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of DNA-templated transcription [GO:0006355]; signal transduction [GO:0007165]; smooth muscle contraction [GO:0006939]	cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; synapse [GO:0045202]	cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; synapse [GO:0045202]; amyloid-beta binding [GO:0001540]; chromatin binding [GO:0003682]; histone binding [GO:0042393]; low-density lipoprotein particle receptor binding [GO:0050750]; proline-rich region binding [GO:0070064]; transcription coactivator activity [GO:0003713]; ubiquitin protein ligase binding [GO:0031625]; apoptotic process [GO:0006915]; axonogenesis [GO:0007409]; cellular response to DNA damage stimulus [GO:0006974]; chromatin organization [GO:0006325]; histone H4 acetylation [GO:0043967]; negative regulation of cell cycle G1/S phase transition [GO:1902807]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of apoptotic process [GO:0043065]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of protein secretion [GO:0050714]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of DNA-templated transcription [GO:0006355]; signal transduction [GO:0007165]; smooth muscle contraction [GO:0006939]	amyloid-beta binding [GO:0001540]; chromatin binding [GO:0003682]; histone binding [GO:0042393]; low-density lipoprotein particle receptor binding [GO:0050750]; proline-rich region binding [GO:0070064]; transcription coactivator activity [GO:0003713]; ubiquitin protein ligase binding [GO:0031625]	GO:0000122; GO:0001540; GO:0003682; GO:0003713; GO:0005634; GO:0005654; GO:0005737; GO:0005783; GO:0005886; GO:0006325; GO:0006355; GO:0006915; GO:0006939; GO:0006974; GO:0007165; GO:0007409; GO:0016607; GO:0030027; GO:0030426; GO:0031625; GO:0042393; GO:0043065; GO:0043967; GO:0045202; GO:0045893; GO:0045944; GO:0050714; GO:0050750; GO:0070064; GO:1902807	AATAHRDQNR	0.9936	13.0795	12.4425	12.5915	11.1077	10.7493	0	12.2512	13.1217	11.5988	11.7354	12.5364	14.3715	12.4958	10.6817	11.3563
B7Z1X8	B7Z1X8_HUMAN	Methionine adenosyltransferase 2 subunit beta (Methionine adenosyltransferase II beta)		Homo sapiens (Human)	one-carbon metabolic process [GO:0006730]; S-adenosylmethionine biosynthetic process [GO:0006556]		transferase activity [GO:0016740]; one-carbon metabolic process [GO:0006730]; S-adenosylmethionine biosynthetic process [GO:0006556]	transferase activity [GO:0016740]	GO:0006556; GO:0006730; GO:0016740	AVLENNLGAAVLR	0.95068	12.7861	12.183	12.7372	10.5576	10.6065	11.9759	12.753	10.9662	13.2358	11.7993	13.8802	12.3827	9.58973	13.6623	0
B4DFL4	B4DFL4_HUMAN	"Breast carcinoma-amplified sequence 1 (cDNA FLJ50470, moderately similar to Rattus norvegicus breast carcinoma amplified sequence 1 (Bcas1), mRNA) (cDNA, FLJ78937, highly similar to Rattus norvegicus breast carcinoma amplified sequence 1 (Bcas1), mRNA)"	BCAS1	Homo sapiens (Human)						AESVCDGQAGQK	1.0019	12.6975	12.9727	13.3071	10.7894	10.9093	0	11.0066	11.9268	12.7424	12.318	12.2446	12.4109	9.79349	12.6965	12.7327
Q96A73	P33MX_HUMAN	Putative monooxygenase p33MONOX (EC 1.-.-.-) (Brain-derived rescue factor p60MONOX) (Flavin monooxygenase motif-containing protein of 33 kDa)	KIAA1191 P33MONOX	Homo sapiens (Human)		cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	GO:0005737; GO:0016491	AHNLKPRDLNVLTPTGF	1.0194	11.5033	10.9128	10.896	9.85495	11.2435	11.1015	11.6113	10.9358	11.6962	10.8199	11.4125	11.3475	11.1992	10.9313	12.7705
Q9UIK5	TEFF2_HUMAN	Tomoregulin-2 (TR-2) (Hyperplastic polyposis protein 1) (Transmembrane protein with EGF-like and two follistatin-like domains)	TMEFF2 HPP1 TENB2 TPEF UNQ178/PRO204	Homo sapiens (Human)	"animal organ morphogenesis [GO:0009887]; cell migration [GO:0016477]; negative regulation of cell migration [GO:0030336]; negative regulation of integrin biosynthetic process [GO:0045720]; negative regulation of stress fiber assembly [GO:0051497]; substrate adhesion-dependent cell spreading [GO:0034446]; tissue development [GO:0009888]; wound healing, spreading of cells [GO:0044319]"	basement membrane [GO:0005604]; extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	"basement membrane [GO:0005604]; extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; animal organ morphogenesis [GO:0009887]; cell migration [GO:0016477]; negative regulation of cell migration [GO:0030336]; negative regulation of integrin biosynthetic process [GO:0045720]; negative regulation of stress fiber assembly [GO:0051497]; substrate adhesion-dependent cell spreading [GO:0034446]; tissue development [GO:0009888]; wound healing, spreading of cells [GO:0044319]"		GO:0005576; GO:0005604; GO:0005886; GO:0009887; GO:0009888; GO:0016021; GO:0016477; GO:0030336; GO:0034446; GO:0044319; GO:0045720; GO:0051497	CDAGYTGQHCEKKDYSVLYVVPGPVR	0.61304	13.5554	14.8888	14.0743	12.6575	12.6243	12.4905	12.938	13.4791	11.9738	10.3243	10.8558	0	14.2412	13.4359	0
Q9Y287	ITM2B_HUMAN	"Integral membrane protein 2B (Immature BRI2) (imBRI2) (Protein E25B) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C-terminal peptide) (P23 peptide)]"	ITM2B BRI BRI2	Homo sapiens (Human)	negative regulation of amyloid precursor protein biosynthetic process [GO:0042985]; nervous system development [GO:0007399]	endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; Golgi-associated vesicle membrane [GO:0030660]; integral component of organelle membrane [GO:0031301]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; plasma membrane [GO:0005886]	endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; Golgi-associated vesicle membrane [GO:0030660]; integral component of organelle membrane [GO:0031301]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; plasma membrane [GO:0005886]; amyloid-beta binding [GO:0001540]; ATP binding [GO:0005524]; negative regulation of amyloid precursor protein biosynthetic process [GO:0042985]; nervous system development [GO:0007399]	amyloid-beta binding [GO:0001540]; ATP binding [GO:0005524]	GO:0000139; GO:0001540; GO:0005524; GO:0005576; GO:0005615; GO:0005794; GO:0005886; GO:0007399; GO:0010008; GO:0016020; GO:0030660; GO:0031301; GO:0042985; GO:0043231; GO:0070062	AGTYLPQSYLIHEHMVITDR	0.091837	12.6971	12.2992	12.1773	11.301	11.458	10.8119	11.8246	11.8187	11.7577	0	12.8105	12.6656	11.5437	11.6044	12.39
Q9UDY4	DNJB4_HUMAN	DnaJ homolog subfamily B member 4 (Heat shock 40 kDa protein 1 homolog) (HSP40 homolog) (Heat shock protein 40 homolog) (Human liver DnaJ-like protein)	DNAJB4 DNAJW HLJ1	Homo sapiens (Human)	chaperone cofactor-dependent protein refolding [GO:0051085]; response to heat [GO:0009408]; response to unfolded protein [GO:0006986]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; ATPase activator activity [GO:0001671]; chaperone binding [GO:0051087]; unfolded protein binding [GO:0051082]; chaperone cofactor-dependent protein refolding [GO:0051085]; response to heat [GO:0009408]; response to unfolded protein [GO:0006986]	ATPase activator activity [GO:0001671]; chaperone binding [GO:0051087]; unfolded protein binding [GO:0051082]	GO:0001671; GO:0005654; GO:0005829; GO:0005886; GO:0006986; GO:0009408; GO:0051082; GO:0051085; GO:0051087	AYRKQALK	1.0192	8.16777	12.5519	12.9853	0	11.3289	11.1342	12.7593	11.4821	12.1664	13.2874	12.5433	12.2401	10.6628	13.4099	11.9465
Q9NTX7	RN146_HUMAN	E3 ubiquitin-protein ligase RNF146 (EC 2.3.2.27) (Dactylidin) (Iduna) (RING finger protein 146) (RING-type E3 ubiquitin transferase RNF146)	RNF146	Homo sapiens (Human)	positive regulation of canonical Wnt signaling pathway [GO:0090263]; protein autoubiquitination [GO:0051865]; protein K48-linked ubiquitination [GO:0070936]; ubiquitin-dependent protein catabolic process [GO:0006511]; Wnt signaling pathway [GO:0016055]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; poly-ADP-D-ribose binding [GO:0072572]; ubiquitin protein ligase activity [GO:0061630]; ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; protein autoubiquitination [GO:0051865]; protein K48-linked ubiquitination [GO:0070936]; ubiquitin-dependent protein catabolic process [GO:0006511]; Wnt signaling pathway [GO:0016055]	poly-ADP-D-ribose binding [GO:0072572]; ubiquitin protein ligase activity [GO:0061630]; ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]	GO:0004842; GO:0005634; GO:0005654; GO:0005737; GO:0005829; GO:0005886; GO:0006511; GO:0008270; GO:0016055; GO:0051865; GO:0061630; GO:0070936; GO:0072572; GO:0090263	AASRGNGEYAWYYEGR	0.982	12.2167	12.3638	12.4287	11.58	11.1056	9.57903	11.7421	0	10.8823	12.8265	14.8183	12.3572	11.6583	11.5791	10.6437
B7Z1Z7	B7Z1Z7_HUMAN	"cDNA FLJ58099, highly similar to Homo sapiens clathrin, heavy polypeptide-like 1 (CLTCL1), transcript variant 1, mRNA"		Homo sapiens (Human)	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	endomembrane system [GO:0012505]	endomembrane system [GO:0012505]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]		GO:0006886; GO:0012505; GO:0016192	AAEQAHLWAELVFLYDK	0.90704	11.5107	9.29811	11.0438	11.2911	11.1565	0	11.6874	11.7225	11.9102	13.3647	13.1154	14.1981	11.1191	11.5341	12.1918
Q86XJ0	CAHM3_HUMAN	Calcium homeostasis modulator protein 3 (Protein A)	CALHM3 FAM26A	Homo sapiens (Human)	ATP transport [GO:0015867]; protein heterooligomerization [GO:0051291]; response to stimulus [GO:0050896]; sensory perception of taste [GO:0050909]	basolateral plasma membrane [GO:0016323]; integral component of plasma membrane [GO:0005887]	basolateral plasma membrane [GO:0016323]; integral component of plasma membrane [GO:0005887]; cation channel activity [GO:0005261]; voltage-gated ion channel activity [GO:0005244]; ATP transport [GO:0015867]; protein heterooligomerization [GO:0051291]; response to stimulus [GO:0050896]; sensory perception of taste [GO:0050909]	cation channel activity [GO:0005261]; voltage-gated ion channel activity [GO:0005244]	GO:0005244; GO:0005261; GO:0005887; GO:0015867; GO:0016323; GO:0050896; GO:0050909; GO:0051291	AHLRAISSR	0.99242	12.4767	10.6176	11.6604	0	11.0264	0	12.8652	12.1468	12.522	14.3824	14.4381	14.2034	13.3287	12.8668	12.0834
P17655	CAN2_HUMAN	Calpain-2 catalytic subunit (EC 3.4.22.53) (Calcium-activated neutral proteinase 2) (CANP 2) (Calpain M-type) (Calpain large polypeptide L2) (Calpain-2 large subunit) (Millimolar-calpain) (M-calpain)	CAPN2 CANPL2	Homo sapiens (Human)	behavioral response to pain [GO:0048266]; blastocyst development [GO:0001824]; cellular response to amino acid stimulus [GO:0071230]; cellular response to interferon-beta [GO:0035458]; cellular response to lipopolysaccharide [GO:0071222]; female pregnancy [GO:0007565]; myoblast fusion [GO:0007520]; positive regulation of cardiac muscle cell apoptotic process [GO:0010666]; positive regulation of myoblast fusion [GO:1901741]; positive regulation of neuron death [GO:1901216]; positive regulation of phosphatidylcholine biosynthetic process [GO:2001247]; protein autoprocessing [GO:0016540]; proteolysis [GO:0006508]; proteolysis involved in protein catabolic process [GO:0051603]; regulation of cytoskeleton organization [GO:0051493]; regulation of interleukin-6 production [GO:0032675]; response to hydrogen peroxide [GO:0042542]; response to hypoxia [GO:0001666]; response to mechanical stimulus [GO:0009612]	calpain complex [GO:0110158]; chromatin [GO:0000785]; cortical actin cytoskeleton [GO:0030864]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; endoplasmic reticulum [GO:0005783]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; Golgi apparatus [GO:0005794]; lysosome [GO:0005764]; membrane raft [GO:0045121]; mitochondrial intermembrane space [GO:0005758]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; perinuclear endoplasmic reticulum [GO:0097038]; plasma membrane [GO:0005886]; pseudopodium [GO:0031143]	calpain complex [GO:0110158]; chromatin [GO:0000785]; cortical actin cytoskeleton [GO:0030864]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; endoplasmic reticulum [GO:0005783]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; Golgi apparatus [GO:0005794]; lysosome [GO:0005764]; membrane raft [GO:0045121]; mitochondrial intermembrane space [GO:0005758]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; perinuclear endoplasmic reticulum [GO:0097038]; plasma membrane [GO:0005886]; pseudopodium [GO:0031143]; calcium ion binding [GO:0005509]; calcium-dependent cysteine-type endopeptidase activity [GO:0004198]; cysteine-type peptidase activity [GO:0008234]; cytoskeletal protein binding [GO:0008092]; enzyme binding [GO:0019899]; protein-containing complex binding [GO:0044877]; behavioral response to pain [GO:0048266]; blastocyst development [GO:0001824]; cellular response to amino acid stimulus [GO:0071230]; cellular response to interferon-beta [GO:0035458]; cellular response to lipopolysaccharide [GO:0071222]; female pregnancy [GO:0007565]; myoblast fusion [GO:0007520]; positive regulation of cardiac muscle cell apoptotic process [GO:0010666]; positive regulation of myoblast fusion [GO:1901741]; positive regulation of neuron death [GO:1901216]; positive regulation of phosphatidylcholine biosynthetic process [GO:2001247]; protein autoprocessing [GO:0016540]; proteolysis [GO:0006508]; proteolysis involved in protein catabolic process [GO:0051603]; regulation of cytoskeleton organization [GO:0051493]; regulation of interleukin-6 production [GO:0032675]; response to hydrogen peroxide [GO:0042542]; response to hypoxia [GO:0001666]; response to mechanical stimulus [GO:0009612]	calcium ion binding [GO:0005509]; calcium-dependent cysteine-type endopeptidase activity [GO:0004198]; cysteine-type peptidase activity [GO:0008234]; cytoskeletal protein binding [GO:0008092]; enzyme binding [GO:0019899]; protein-containing complex binding [GO:0044877]	GO:0000785; GO:0001666; GO:0001824; GO:0004198; GO:0005509; GO:0005634; GO:0005737; GO:0005758; GO:0005764; GO:0005783; GO:0005794; GO:0005829; GO:0005886; GO:0005925; GO:0006508; GO:0007520; GO:0007565; GO:0008092; GO:0008234; GO:0009612; GO:0009897; GO:0010666; GO:0016540; GO:0019899; GO:0030425; GO:0030864; GO:0031143; GO:0032675; GO:0035458; GO:0042542; GO:0043025; GO:0044877; GO:0045121; GO:0048266; GO:0051493; GO:0051603; GO:0070062; GO:0071222; GO:0071230; GO:0097038; GO:0110158; GO:1901216; GO:1901741; GO:2001247	AIKYLNQDYEALR	0.99228	11.5307	11.7824	12.9016	0	12.7926	0	12.6049	13.218	12.5726	13.3341	15.3445	12.309	10.7464	13.7852	11.6772
Q06830	PRDX1_HUMAN	Peroxiredoxin-1 (EC 1.11.1.24) (Natural killer cell-enhancing factor A) (NKEF-A) (Proliferation-associated gene protein) (PAG) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Thioredoxin-dependent peroxiredoxin 1)	PRDX1 PAGA PAGB TDPX2	Homo sapiens (Human)	cell population proliferation [GO:0008283]; cell redox homeostasis [GO:0045454]; cellular response to chemical stress [GO:0062197]; erythrocyte homeostasis [GO:0034101]; fibroblast proliferation [GO:0048144]; hydrogen peroxide catabolic process [GO:0042744]; leukocyte activation [GO:0045321]; natural killer cell activation [GO:0030101]; natural killer cell mediated cytotoxicity [GO:0042267]; regulation of NIK/NF-kappaB signaling [GO:1901222]; regulation of stress-activated MAPK cascade [GO:0032872]; removal of superoxide radicals [GO:0019430]; retina homeostasis [GO:0001895]; skeletal system development [GO:0001501]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; melanosome [GO:0042470]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; melanosome [GO:0042470]; nucleus [GO:0005634]; cadherin binding [GO:0045296]; identical protein binding [GO:0042802]; peroxidase activity [GO:0004601]; RNA binding [GO:0003723]; thioredoxin peroxidase activity [GO:0008379]; thioredoxin-dependent peroxiredoxin activity [GO:0140824]; cell population proliferation [GO:0008283]; cell redox homeostasis [GO:0045454]; cellular response to chemical stress [GO:0062197]; erythrocyte homeostasis [GO:0034101]; fibroblast proliferation [GO:0048144]; hydrogen peroxide catabolic process [GO:0042744]; leukocyte activation [GO:0045321]; natural killer cell activation [GO:0030101]; natural killer cell mediated cytotoxicity [GO:0042267]; regulation of NIK/NF-kappaB signaling [GO:1901222]; regulation of stress-activated MAPK cascade [GO:0032872]; removal of superoxide radicals [GO:0019430]; retina homeostasis [GO:0001895]; skeletal system development [GO:0001501]	cadherin binding [GO:0045296]; identical protein binding [GO:0042802]; peroxidase activity [GO:0004601]; RNA binding [GO:0003723]; thioredoxin peroxidase activity [GO:0008379]; thioredoxin-dependent peroxiredoxin activity [GO:0140824]	GO:0001501; GO:0001895; GO:0003723; GO:0004601; GO:0005615; GO:0005634; GO:0005737; GO:0005829; GO:0008283; GO:0008379; GO:0019430; GO:0030101; GO:0032872; GO:0034101; GO:0042267; GO:0042470; GO:0042744; GO:0042802; GO:0045296; GO:0045321; GO:0045454; GO:0048144; GO:0062197; GO:0070062; GO:0140824; GO:1901222	ADEGISFRGLFIIDDK	0.75564	13.7281	13.9172	0	11.6594	8.47224	8.44137	10.5715	0	14.322	11.6511	14.6909	14.4825	14.0957	14.2255	14.0914
Q9H2B1	Q9H2B1_HUMAN	Allograft inflammatory factor-1 splice variant Hara-1		Homo sapiens (Human)		ruffle membrane [GO:0032587]	ruffle membrane [GO:0032587]; calcium ion binding [GO:0005509]	calcium ion binding [GO:0005509]	GO:0005509; GO:0032587	LKTLQSALIPSALSPHPEK	0.33113	14.2155	14.3568	14.2257	0	0	0	15.1743	15.4079	15.2344	15.1877	15.1852	15.2275	0	14.4433	14.5119
B4DFL8	B4DFL8_HUMAN	"cDNA FLJ59865, highly similar to WW domain-binding protein 2"		Homo sapiens (Human)	cellular response to estrogen stimulus [GO:0071391]; epigenetic maintenance of chromatin in transcription-competent conformation [GO:0045815]	chromatin [GO:0000785]	chromatin [GO:0000785]; transcription coactivator activity [GO:0003713]; cellular response to estrogen stimulus [GO:0071391]; epigenetic maintenance of chromatin in transcription-competent conformation [GO:0045815]	transcription coactivator activity [GO:0003713]	GO:0000785; GO:0003713; GO:0045815; GO:0071391	AEAGGGWEGSASYK	0.90909	11.4951	11.8964	11.9113	9.9911	10.6681	9.85439	10.8153	10.6996	10.8738	11.2654	11.7787	11.3145	11.2559	8.65435	10.3916
Q8WWZ7	ABCA5_HUMAN	Cholesterol transporter ABCA5 (EC 7.6.2.-) (ATP-binding cassette sub-family A member 5)	ABCA5 KIAA1888	Homo sapiens (Human)	cholesterol efflux [GO:0033344]; cholesterol homeostasis [GO:0042632]; cholesterol metabolic process [GO:0008203]; high-density lipoprotein particle remodeling [GO:0034375]; lipid transport [GO:0006869]; negative regulation of macrophage derived foam cell differentiation [GO:0010745]; positive regulation of reverse cholesterol transport [GO:1903064]; regulation of cholesterol efflux [GO:0010874]; reverse cholesterol transport [GO:0043691]	Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; late endosome [GO:0005770]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; plasma membrane [GO:0005886]	Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; late endosome [GO:0005770]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; plasma membrane [GO:0005886]; ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; lipid transporter activity [GO:0005319]; cholesterol efflux [GO:0033344]; cholesterol homeostasis [GO:0042632]; cholesterol metabolic process [GO:0008203]; high-density lipoprotein particle remodeling [GO:0034375]; lipid transport [GO:0006869]; negative regulation of macrophage derived foam cell differentiation [GO:0010745]; positive regulation of reverse cholesterol transport [GO:1903064]; regulation of cholesterol efflux [GO:0010874]; reverse cholesterol transport [GO:0043691]	ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; lipid transporter activity [GO:0005319]	GO:0000139; GO:0005319; GO:0005524; GO:0005764; GO:0005765; GO:0005770; GO:0005794; GO:0005886; GO:0006869; GO:0008203; GO:0010745; GO:0010874; GO:0016021; GO:0031902; GO:0033344; GO:0034375; GO:0042626; GO:0042632; GO:0043231; GO:0043691; GO:0140359; GO:1903064	AAILTTHYMEEAEAVCDR	1.0031	13.6856	13.4886	13.2694	0	0	11.7292	13.2319	10.0812	12.8758	12.6782	13.4423	13.657	11.0336	12.7327	10.6798
Q15011	HERP1_HUMAN	Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (Methyl methanesulfonate (MMF)-inducible fragment protein 1)	HERPUD1 HERP KIAA0025 MIF1	Homo sapiens (Human)	"endoplasmic reticulum calcium ion homeostasis [GO:0032469]; endoplasmic reticulum unfolded protein response [GO:0030968]; negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [GO:1902236]; negative regulation of intrinsic apoptotic signaling pathway [GO:2001243]; positive regulation of ER-associated ubiquitin-dependent protein catabolic process [GO:1903071]; protein targeting to ER [GO:0045047]; regulation of ER-associated ubiquitin-dependent protein catabolic process [GO:1903069]; regulation of protein ubiquitination [GO:0031396]; response to endoplasmic reticulum stress [GO:0034976]; response to unfolded protein [GO:0006986]; retrograde protein transport, ER to cytosol [GO:0030970]; ubiquitin-dependent ERAD pathway [GO:0030433]; ubiquitin-dependent protein catabolic process [GO:0006511]"	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum quality control compartment [GO:0044322]; integral component of membrane [GO:0016021]; Lewy body core [GO:1990037]; membrane [GO:0016020]	"endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum quality control compartment [GO:0044322]; integral component of membrane [GO:0016021]; Lewy body core [GO:1990037]; membrane [GO:0016020]; transmembrane transporter binding [GO:0044325]; ubiquitin ligase-substrate adaptor activity [GO:1990756]; endoplasmic reticulum calcium ion homeostasis [GO:0032469]; endoplasmic reticulum unfolded protein response [GO:0030968]; negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [GO:1902236]; negative regulation of intrinsic apoptotic signaling pathway [GO:2001243]; positive regulation of ER-associated ubiquitin-dependent protein catabolic process [GO:1903071]; protein targeting to ER [GO:0045047]; regulation of ER-associated ubiquitin-dependent protein catabolic process [GO:1903069]; regulation of protein ubiquitination [GO:0031396]; response to endoplasmic reticulum stress [GO:0034976]; response to unfolded protein [GO:0006986]; retrograde protein transport, ER to cytosol [GO:0030970]; ubiquitin-dependent ERAD pathway [GO:0030433]; ubiquitin-dependent protein catabolic process [GO:0006511]"	transmembrane transporter binding [GO:0044325]; ubiquitin ligase-substrate adaptor activity [GO:1990756]	GO:0005783; GO:0005789; GO:0006511; GO:0006986; GO:0016020; GO:0016021; GO:0030433; GO:0030968; GO:0030970; GO:0031396; GO:0032469; GO:0034976; GO:0044322; GO:0044325; GO:0045047; GO:1902236; GO:1903069; GO:1903071; GO:1990037; GO:1990756; GO:2001243	DLELSGDR	0.99419	0	10.5965	11.5353	8.98948	10.1618	10.7382	12.458	13.1545	11.1022	12.9624	12.262	13.0565	10.887	12.6985	11.8587
P49840	GSK3A_HUMAN	Glycogen synthase kinase-3 alpha (GSK-3 alpha) (EC 2.7.11.26) (Serine/threonine-protein kinase GSK3A) (EC 2.7.11.1)	GSK3A	Homo sapiens (Human)	"aging [GO:0007568]; cardiac left ventricle morphogenesis [GO:0003214]; cell migration [GO:0016477]; cellular response to glucocorticoid stimulus [GO:0071385]; cellular response to insulin stimulus [GO:0032869]; cellular response to interleukin-3 [GO:0036016]; cellular response to lithium ion [GO:0071285]; dopamine receptor signaling pathway [GO:0007212]; excitatory postsynaptic potential [GO:0060079]; extrinsic apoptotic signaling pathway [GO:0097191]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; glycogen metabolic process [GO:0005977]; hypermethylation of CpG island [GO:0044027]; insulin receptor signaling pathway [GO:0008286]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cell growth involved in cardiac muscle cell development [GO:0061052]; negative regulation of dendrite development [GO:2000171]; negative regulation of glucose import [GO:0046325]; negative regulation of glycogen (starch) synthase activity [GO:2000466]; negative regulation of glycogen biosynthetic process [GO:0045719]; negative regulation of glycogen synthase activity, transferring glucose-1-phosphate [GO:1904227]; negative regulation of insulin receptor signaling pathway [GO:0046627]; negative regulation of TOR signaling [GO:0032007]; negative regulation of type B pancreatic cell development [GO:2000077]; negative regulation of UDP-glucose catabolic process [GO:0010905]; nervous system development [GO:0007399]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of adenylate cyclase-activating adrenergic receptor signaling pathway [GO:0071879]; positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0106071]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of autophagy [GO:0010508]; positive regulation of gene expression [GO:0010628]; positive regulation of glycogen (starch) synthase activity [GO:2000467]; positive regulation of heart contraction [GO:0045823]; positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [GO:1901030]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of peptidyl-threonine phosphorylation [GO:0010800]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein catabolic process [GO:0045732]; positive regulation of protein targeting to mitochondrion [GO:1903955]; positive regulation of protein ubiquitination [GO:0031398]; positive regulation of transcription by RNA polymerase II [GO:0045944]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein phosphorylation [GO:0006468]; regulation of autophagy of mitochondrion [GO:1903146]; regulation of gene expression by genomic imprinting [GO:0006349]; regulation of neuron projection development [GO:0010975]; regulation of systemic arterial blood pressure [GO:0003073]; signal transduction [GO:0007165]; viral protein processing [GO:0019082]; Wnt signaling pathway [GO:0016055]"	apical dendrite [GO:0097440]; axon [GO:0030424]; beta-catenin destruction complex [GO:0030877]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; microtubule [GO:0005874]; mitochondrion [GO:0005739]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; postsynapse [GO:0098794]; proximal dendrite [GO:1990635]	"apical dendrite [GO:0097440]; axon [GO:0030424]; beta-catenin destruction complex [GO:0030877]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; microtubule [GO:0005874]; mitochondrion [GO:0005739]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; postsynapse [GO:0098794]; proximal dendrite [GO:1990635]; ATP binding [GO:0005524]; protein kinase A catalytic subunit binding [GO:0034236]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; signaling receptor binding [GO:0005102]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]; aging [GO:0007568]; cardiac left ventricle morphogenesis [GO:0003214]; cell migration [GO:0016477]; cellular response to glucocorticoid stimulus [GO:0071385]; cellular response to insulin stimulus [GO:0032869]; cellular response to interleukin-3 [GO:0036016]; cellular response to lithium ion [GO:0071285]; dopamine receptor signaling pathway [GO:0007212]; excitatory postsynaptic potential [GO:0060079]; extrinsic apoptotic signaling pathway [GO:0097191]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; glycogen metabolic process [GO:0005977]; hypermethylation of CpG island [GO:0044027]; insulin receptor signaling pathway [GO:0008286]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cell growth involved in cardiac muscle cell development [GO:0061052]; negative regulation of dendrite development [GO:2000171]; negative regulation of glucose import [GO:0046325]; negative regulation of glycogen (starch) synthase activity [GO:2000466]; negative regulation of glycogen biosynthetic process [GO:0045719]; negative regulation of glycogen synthase activity, transferring glucose-1-phosphate [GO:1904227]; negative regulation of insulin receptor signaling pathway [GO:0046627]; negative regulation of TOR signaling [GO:0032007]; negative regulation of type B pancreatic cell development [GO:2000077]; negative regulation of UDP-glucose catabolic process [GO:0010905]; nervous system development [GO:0007399]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of adenylate cyclase-activating adrenergic receptor signaling pathway [GO:0071879]; positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0106071]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of autophagy [GO:0010508]; positive regulation of gene expression [GO:0010628]; positive regulation of glycogen (starch) synthase activity [GO:2000467]; positive regulation of heart contraction [GO:0045823]; positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [GO:1901030]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of peptidyl-threonine phosphorylation [GO:0010800]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein catabolic process [GO:0045732]; positive regulation of protein targeting to mitochondrion [GO:1903955]; positive regulation of protein ubiquitination [GO:0031398]; positive regulation of transcription by RNA polymerase II [GO:0045944]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein phosphorylation [GO:0006468]; regulation of autophagy of mitochondrion [GO:1903146]; regulation of gene expression by genomic imprinting [GO:0006349]; regulation of neuron projection development [GO:0010975]; regulation of systemic arterial blood pressure [GO:0003073]; signal transduction [GO:0007165]; viral protein processing [GO:0019082]; Wnt signaling pathway [GO:0016055]"	ATP binding [GO:0005524]; protein kinase A catalytic subunit binding [GO:0034236]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; signaling receptor binding [GO:0005102]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]	GO:0003073; GO:0003214; GO:0004674; GO:0005102; GO:0005524; GO:0005634; GO:0005737; GO:0005739; GO:0005829; GO:0005874; GO:0005977; GO:0006349; GO:0006468; GO:0007165; GO:0007212; GO:0007399; GO:0007568; GO:0008286; GO:0010508; GO:0010628; GO:0010800; GO:0010905; GO:0010975; GO:0016055; GO:0016477; GO:0018105; GO:0018107; GO:0019082; GO:0030424; GO:0030877; GO:0031398; GO:0032007; GO:0032436; GO:0032869; GO:0033138; GO:0034236; GO:0036016; GO:0043025; GO:0043161; GO:0043525; GO:0044027; GO:0045719; GO:0045732; GO:0045823; GO:0045944; GO:0046325; GO:0046627; GO:0048156; GO:0050321; GO:0060079; GO:0061052; GO:0071285; GO:0071385; GO:0071879; GO:0090090; GO:0097191; GO:0097192; GO:0097440; GO:0098794; GO:0106071; GO:0106310; GO:1901030; GO:1902004; GO:1903146; GO:1903955; GO:1904227; GO:1990635; GO:2000077; GO:2000171; GO:2000466; GO:2000467	AHPWTKVFK	0.92758	11.8966	11.4743	11.5936	11.1792	12.2963	11.6696	11.8044	8.70273	8.8752	0	12.5985	12.2268	12.9305	12.1726	12.7963
Q13286	CLN3_HUMAN	Battenin (Batten disease protein) (Protein CLN3)	CLN3 BTS	Homo sapiens (Human)	"actin cytoskeleton organization [GO:0030036]; action potential [GO:0001508]; amyloid precursor protein catabolic process [GO:0042987]; associative learning [GO:0008306]; autophagosome maturation [GO:0097352]; autophagosome-lysosome fusion [GO:0061909]; blood vessel endothelial cell migration [GO:0043534]; cellular water homeostasis [GO:0009992]; glycerophospholipid biosynthetic process [GO:0046474]; glycolipid transport [GO:0046836]; Golgi to lysosome transport [GO:0090160]; ionotropic glutamate receptor signaling pathway [GO:0035235]; L-arginine transmembrane transport [GO:1903826]; learning or memory [GO:0007611]; lysosomal lumen acidification [GO:0007042]; lysosomal lumen pH elevation [GO:0035752]; lysosomal protein catabolic process [GO:1905146]; lysosome organization [GO:0007040]; membrane organization [GO:0061024]; negative regulation of apoptotic process [GO:0043066]; negative regulation of catalytic activity [GO:0043086]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of proteolysis [GO:0045861]; neuromuscular process controlling balance [GO:0050885]; neurotransmitter metabolic process [GO:0042133]; phagosome-lysosome docking [GO:0090384]; phagosome-lysosome fusion [GO:0090385]; plasma membrane raft organization [GO:0044857]; positive regulation of caveolin-mediated endocytosis [GO:2001288]; positive regulation of Golgi to plasma membrane protein transport [GO:0042998]; positive regulation of pinocytosis [GO:0048549]; positive regulation of protein phosphorylation [GO:0001934]; protein localization to plasma membrane [GO:0072659]; protein phosphorylation [GO:0006468]; protein processing [GO:0016485]; receptor-mediated endocytosis [GO:0006898]; regulation of arginine biosynthetic process [GO:1900079]; regulation of autophagosome maturation [GO:1901096]; regulation of autophagosome size [GO:0016243]; regulation of cellular response to osmotic stress [GO:0106049]; regulation of cytoskeleton organization [GO:0051493]; regulation of cytosolic calcium ion concentration [GO:0051480]; regulation of fibroblast migration [GO:0010762]; regulation of filopodium assembly [GO:0051489]; regulation of intracellular pH [GO:0051453]; regulation of modification of synaptic structure [GO:1905244]; regulation of phagosome maturation [GO:1905162]; regulation of protein localization to plasma membrane [GO:1903076]; regulation of protein processing [GO:0070613]; regulation of short-term neuronal synaptic plasticity [GO:0048172]; regulation of synaptic transmission, GABAergic [GO:0032228]; regulation of synaptic transmission, glutamatergic [GO:0051966]; renal potassium excretion [GO:0036359]; vesicle transport along microtubule [GO:0047496]"	anchoring junction [GO:0070161]; autolysosome [GO:0044754]; autophagosome [GO:0005776]; caveola [GO:0005901]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; early endosome [GO:0005769]; early endosome membrane [GO:0031901]; endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; Golgi stack [GO:0005795]; integral component of endoplasmic reticulum membrane [GO:0030176]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; membrane raft [GO:0045121]; neuron projection [GO:0043005]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]; synaptic vesicle [GO:0008021]; trans-Golgi network [GO:0005802]; vacuole [GO:0005773]	"anchoring junction [GO:0070161]; autolysosome [GO:0044754]; autophagosome [GO:0005776]; caveola [GO:0005901]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; early endosome [GO:0005769]; early endosome membrane [GO:0031901]; endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; Golgi stack [GO:0005795]; integral component of endoplasmic reticulum membrane [GO:0030176]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; membrane raft [GO:0045121]; neuron projection [GO:0043005]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]; synaptic vesicle [GO:0008021]; trans-Golgi network [GO:0005802]; vacuole [GO:0005773]; calcium-dependent protein binding [GO:0048306]; glycolipid binding [GO:0051861]; sulfatide binding [GO:0120146]; actin cytoskeleton organization [GO:0030036]; action potential [GO:0001508]; amyloid precursor protein catabolic process [GO:0042987]; associative learning [GO:0008306]; autophagosome maturation [GO:0097352]; autophagosome-lysosome fusion [GO:0061909]; blood vessel endothelial cell migration [GO:0043534]; cellular water homeostasis [GO:0009992]; glycerophospholipid biosynthetic process [GO:0046474]; glycolipid transport [GO:0046836]; Golgi to lysosome transport [GO:0090160]; ionotropic glutamate receptor signaling pathway [GO:0035235]; L-arginine transmembrane transport [GO:1903826]; learning or memory [GO:0007611]; lysosomal lumen acidification [GO:0007042]; lysosomal lumen pH elevation [GO:0035752]; lysosomal protein catabolic process [GO:1905146]; lysosome organization [GO:0007040]; membrane organization [GO:0061024]; negative regulation of apoptotic process [GO:0043066]; negative regulation of catalytic activity [GO:0043086]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of proteolysis [GO:0045861]; neuromuscular process controlling balance [GO:0050885]; neurotransmitter metabolic process [GO:0042133]; phagosome-lysosome docking [GO:0090384]; phagosome-lysosome fusion [GO:0090385]; plasma membrane raft organization [GO:0044857]; positive regulation of caveolin-mediated endocytosis [GO:2001288]; positive regulation of Golgi to plasma membrane protein transport [GO:0042998]; positive regulation of pinocytosis [GO:0048549]; positive regulation of protein phosphorylation [GO:0001934]; protein localization to plasma membrane [GO:0072659]; protein phosphorylation [GO:0006468]; protein processing [GO:0016485]; receptor-mediated endocytosis [GO:0006898]; regulation of arginine biosynthetic process [GO:1900079]; regulation of autophagosome maturation [GO:1901096]; regulation of autophagosome size [GO:0016243]; regulation of cellular response to osmotic stress [GO:0106049]; regulation of cytoskeleton organization [GO:0051493]; regulation of cytosolic calcium ion concentration [GO:0051480]; regulation of fibroblast migration [GO:0010762]; regulation of filopodium assembly [GO:0051489]; regulation of intracellular pH [GO:0051453]; regulation of modification of synaptic structure [GO:1905244]; regulation of phagosome maturation [GO:1905162]; regulation of protein localization to plasma membrane [GO:1903076]; regulation of protein processing [GO:0070613]; regulation of short-term neuronal synaptic plasticity [GO:0048172]; regulation of synaptic transmission, GABAergic [GO:0032228]; regulation of synaptic transmission, glutamatergic [GO:0051966]; renal potassium excretion [GO:0036359]; vesicle transport along microtubule [GO:0047496]"	calcium-dependent protein binding [GO:0048306]; glycolipid binding [GO:0051861]; sulfatide binding [GO:0120146]	GO:0000139; GO:0001508; GO:0001934; GO:0005634; GO:0005737; GO:0005764; GO:0005765; GO:0005769; GO:0005770; GO:0005773; GO:0005776; GO:0005783; GO:0005794; GO:0005795; GO:0005802; GO:0005829; GO:0005886; GO:0005901; GO:0006468; GO:0006898; GO:0007040; GO:0007042; GO:0007611; GO:0008021; GO:0008306; GO:0009992; GO:0010762; GO:0016021; GO:0016243; GO:0016485; GO:0030036; GO:0030176; GO:0031901; GO:0031902; GO:0032228; GO:0035235; GO:0035752; GO:0036359; GO:0042133; GO:0042987; GO:0042998; GO:0043005; GO:0043066; GO:0043086; GO:0043524; GO:0043534; GO:0044754; GO:0044857; GO:0045121; GO:0045861; GO:0046474; GO:0046836; GO:0047496; GO:0048172; GO:0048306; GO:0048549; GO:0050885; GO:0051453; GO:0051480; GO:0051489; GO:0051493; GO:0051861; GO:0051966; GO:0055037; GO:0061024; GO:0061909; GO:0070161; GO:0070613; GO:0072659; GO:0090160; GO:0090384; GO:0090385; GO:0097352; GO:0106049; GO:0120146; GO:1900079; GO:1901096; GO:1903076; GO:1903826; GO:1905146; GO:1905162; GO:1905244; GO:2001288	ERWTVFK	0.17925	12.2971	11.5946	11.9912	9.9167	0	9.67566	12.2976	11.6698	10.3474	11.5886	12.0602	11.6355	11.8997	11.2321	12.706
O94907	DKK1_HUMAN	Dickkopf-related protein 1 (Dickkopf-1) (Dkk-1) (hDkk-1) (SK)	DKK1 UNQ492/PRO1008	Homo sapiens (Human)	"canonical Wnt signaling pathway [GO:0060070]; cell morphogenesis involved in differentiation [GO:0000904]; embryonic limb morphogenesis [GO:0030326]; endoderm formation [GO:0001706]; face morphogenesis [GO:0060325]; forebrain development [GO:0030900]; hair follicle development [GO:0001942]; learning or memory [GO:0007611]; limb development [GO:0060173]; mesoderm formation [GO:0001707]; motor learning [GO:0061743]; negative regulation of apoptotic process [GO:0043066]; negative regulation of BMP signaling pathway [GO:0030514]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of canonical Wnt signaling pathway involved in cardiac muscle cell fate commitment [GO:1901296]; negative regulation of cardiac muscle cell differentiation [GO:2000726]; negative regulation of mesodermal cell fate specification [GO:0042662]; negative regulation of neuron projection development [GO:0010977]; negative regulation of ossification [GO:0030279]; negative regulation of pathway-restricted SMAD protein phosphorylation [GO:0060394]; negative regulation of peptidyl-serine phosphorylation [GO:0033137]; negative regulation of presynapse assembly [GO:1905607]; negative regulation of protein binding [GO:0032091]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of Wnt signaling pathway [GO:0030178]; negative regulation of Wnt-Frizzled-LRP5/6 complex assembly [GO:1904723]; positive regulation of cell death [GO:0010942]; positive regulation of gene expression [GO:0010628]; positive regulation of heart induction by negative regulation of canonical Wnt signaling pathway [GO:0090082]; positive regulation of JUN kinase activity [GO:0043507]; positive regulation of midbrain dopaminergic neuron differentiation [GO:1904958]; positive regulation of neuron death [GO:1901216]; positive regulation of tau-protein kinase activity [GO:1902949]; positive regulation of Wnt signaling pathway, calcium modulating pathway [GO:0045813]; positive regulation of Wnt signaling pathway, planar cell polarity pathway [GO:2000096]; regulation of dopaminergic neuron differentiation [GO:1904338]; regulation of endodermal cell fate specification [GO:0042663]; regulation of receptor internalization [GO:0002090]; regulation of synaptic transmission, glutamatergic [GO:0051966]; response to retinoic acid [GO:0032526]; synapse pruning [GO:0098883]; Wnt signaling pathway involved in somitogenesis [GO:0090244]"	early endosome membrane [GO:0031901]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]	"early endosome membrane [GO:0031901]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]; co-receptor binding [GO:0039706]; growth factor activity [GO:0008083]; low-density lipoprotein particle receptor binding [GO:0050750]; receptor antagonist activity [GO:0048019]; canonical Wnt signaling pathway [GO:0060070]; cell morphogenesis involved in differentiation [GO:0000904]; embryonic limb morphogenesis [GO:0030326]; endoderm formation [GO:0001706]; face morphogenesis [GO:0060325]; forebrain development [GO:0030900]; hair follicle development [GO:0001942]; learning or memory [GO:0007611]; limb development [GO:0060173]; mesoderm formation [GO:0001707]; motor learning [GO:0061743]; negative regulation of apoptotic process [GO:0043066]; negative regulation of BMP signaling pathway [GO:0030514]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of canonical Wnt signaling pathway involved in cardiac muscle cell fate commitment [GO:1901296]; negative regulation of cardiac muscle cell differentiation [GO:2000726]; negative regulation of mesodermal cell fate specification [GO:0042662]; negative regulation of neuron projection development [GO:0010977]; negative regulation of ossification [GO:0030279]; negative regulation of pathway-restricted SMAD protein phosphorylation [GO:0060394]; negative regulation of peptidyl-serine phosphorylation [GO:0033137]; negative regulation of presynapse assembly [GO:1905607]; negative regulation of protein binding [GO:0032091]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of Wnt signaling pathway [GO:0030178]; negative regulation of Wnt-Frizzled-LRP5/6 complex assembly [GO:1904723]; positive regulation of cell death [GO:0010942]; positive regulation of gene expression [GO:0010628]; positive regulation of heart induction by negative regulation of canonical Wnt signaling pathway [GO:0090082]; positive regulation of JUN kinase activity [GO:0043507]; positive regulation of midbrain dopaminergic neuron differentiation [GO:1904958]; positive regulation of neuron death [GO:1901216]; positive regulation of tau-protein kinase activity [GO:1902949]; positive regulation of Wnt signaling pathway, calcium modulating pathway [GO:0045813]; positive regulation of Wnt signaling pathway, planar cell polarity pathway [GO:2000096]; regulation of dopaminergic neuron differentiation [GO:1904338]; regulation of endodermal cell fate specification [GO:0042663]; regulation of receptor internalization [GO:0002090]; regulation of synaptic transmission, glutamatergic [GO:0051966]; response to retinoic acid [GO:0032526]; synapse pruning [GO:0098883]; Wnt signaling pathway involved in somitogenesis [GO:0090244]"	co-receptor binding [GO:0039706]; growth factor activity [GO:0008083]; low-density lipoprotein particle receptor binding [GO:0050750]; receptor antagonist activity [GO:0048019]	GO:0000122; GO:0000904; GO:0001706; GO:0001707; GO:0001942; GO:0002090; GO:0005576; GO:0005615; GO:0005886; GO:0007611; GO:0008083; GO:0010628; GO:0010942; GO:0010977; GO:0030178; GO:0030279; GO:0030326; GO:0030514; GO:0030900; GO:0031901; GO:0032091; GO:0032526; GO:0033137; GO:0039706; GO:0042662; GO:0042663; GO:0043066; GO:0043507; GO:0045813; GO:0048019; GO:0050750; GO:0051966; GO:0060070; GO:0060173; GO:0060325; GO:0060394; GO:0061743; GO:0090082; GO:0090090; GO:0090244; GO:0098883; GO:1901216; GO:1901296; GO:1902949; GO:1904338; GO:1904723; GO:1904958; GO:1905607; GO:2000096; GO:2000726	CYCGEGLSCRIQK	0.92655	11.415	11.261	10.9234	0	10.7116	9.15573	13.1406	12.0268	12.7268	11.8254	11.0547	10.8642	12.2833	11.9843	11.1486
P49770	EI2BB_HUMAN	Translation initiation factor eIF-2B subunit beta (S20I15) (S20III15) (eIF-2B GDP-GTP exchange factor subunit beta)	EIF2B2 EIF2BB	Homo sapiens (Human)	central nervous system development [GO:0007417]; myelination [GO:0042552]; oligodendrocyte development [GO:0014003]; ovarian follicle development [GO:0001541]; regulation of catalytic activity [GO:0050790]; regulation of translational initiation [GO:0006446]; response to glucose [GO:0009749]; response to heat [GO:0009408]; response to peptide hormone [GO:0043434]; T cell receptor signaling pathway [GO:0050852]; translational initiation [GO:0006413]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; eukaryotic translation initiation factor 2B complex [GO:0005851]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; eukaryotic translation initiation factor 2B complex [GO:0005851]; ATP binding [GO:0005524]; GTP binding [GO:0005525]; translation initiation factor activity [GO:0003743]; central nervous system development [GO:0007417]; myelination [GO:0042552]; oligodendrocyte development [GO:0014003]; ovarian follicle development [GO:0001541]; regulation of catalytic activity [GO:0050790]; regulation of translational initiation [GO:0006446]; response to glucose [GO:0009749]; response to heat [GO:0009408]; response to peptide hormone [GO:0043434]; T cell receptor signaling pathway [GO:0050852]; translational initiation [GO:0006413]	ATP binding [GO:0005524]; GTP binding [GO:0005525]; translation initiation factor activity [GO:0003743]	GO:0001541; GO:0003743; GO:0005524; GO:0005525; GO:0005737; GO:0005829; GO:0005851; GO:0006413; GO:0006446; GO:0007417; GO:0009408; GO:0009749; GO:0014003; GO:0042552; GO:0043434; GO:0050790; GO:0050852	AGIETTVMTDAAIFAVMSR	0.93853	9.34636	11.241	11.1797	10.0909	8.73145	8.92585	11.9678	18.7014	12.1687	11.5756	11.0453	12.1221	10.9663	0	11.7092
Q00535	CDK5_HUMAN	Cyclin-dependent kinase 5 (EC 2.7.11.1) (Cell division protein kinase 5) (Cyclin-dependent-like kinase 5) (Serine/threonine-protein kinase PSSALRE) (Tau protein kinase II catalytic subunit) (TPKII catalytic subunit)	CDK5 CDKN5 PSSALRE	Homo sapiens (Human)	"axon extension [GO:0048675]; axonogenesis [GO:0007409]; behavioral response to cocaine [GO:0048148]; calcium ion import [GO:0070509]; cell division [GO:0051301]; cell-matrix adhesion [GO:0007160]; cellular response to amyloid-beta [GO:1904646]; central nervous system neuron development [GO:0021954]; cerebellar cortex formation [GO:0021697]; chemical synaptic transmission [GO:0007268]; corpus callosum development [GO:0022038]; cortical actin cytoskeleton organization [GO:0030866]; dendrite morphogenesis [GO:0048813]; excitatory postsynaptic potential [GO:0060079]; hippocampus development [GO:0021766]; intracellular protein transport [GO:0006886]; layer formation in cerebral cortex [GO:0021819]; microtubule cytoskeleton organization [GO:0000226]; mitochondrion organization [GO:0007005]; motor neuron axon guidance [GO:0008045]; negative regulation of axon extension [GO:0030517]; negative regulation of cell cycle [GO:0045786]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of neuron death [GO:1901215]; negative regulation of protein export from nucleus [GO:0046826]; negative regulation of protein ubiquitination [GO:0031397]; negative regulation of proteolysis [GO:0045861]; negative regulation of synaptic plasticity [GO:0031914]; neuron apoptotic process [GO:0051402]; neuron differentiation [GO:0030182]; neuron migration [GO:0001764]; neuron projection development [GO:0031175]; nucleocytoplasmic transport [GO:0006913]; oligodendrocyte differentiation [GO:0048709]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; phosphorylation [GO:0016310]; positive regulation of actin cytoskeleton reorganization [GO:2000251]; positive regulation of calcium ion-dependent exocytosis [GO:0045956]; positive regulation of glial cell apoptotic process [GO:0034352]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of protein binding [GO:0032092]; positive regulation of protein kinase activity [GO:0045860]; positive regulation of protein targeting to membrane [GO:0090314]; positive regulation of voltage-gated calcium channel activity [GO:1901387]; protein autophosphorylation [GO:0046777]; protein localization to synapse [GO:0035418]; protein phosphorylation [GO:0006468]; receptor catabolic process [GO:0032801]; receptor clustering [GO:0043113]; regulation of apoptotic process [GO:0042981]; regulation of cell cycle [GO:0051726]; regulation of cell migration [GO:0030334]; regulation of dendritic spine morphogenesis [GO:0061001]; regulation of macroautophagy [GO:0016241]; regulation of protein localization to plasma membrane [GO:1903076]; regulation of synaptic plasticity [GO:0048167]; regulation of synaptic transmission, glutamatergic [GO:0051966]; regulation of synaptic vesicle recycling [GO:1903421]; regulation of transcription involved in G1/S transition of mitotic cell cycle [GO:0000083]; response to wounding [GO:0009611]; rhythmic process [GO:0048511]; Schwann cell development [GO:0014044]; sensory perception of pain [GO:0019233]; serine phosphorylation of STAT protein [GO:0042501]; skeletal muscle tissue development [GO:0007519]; synapse assembly [GO:0007416]; synapse pruning [GO:0098883]; synaptic transmission, dopaminergic [GO:0001963]; synaptic transmission, glutamatergic [GO:0035249]; synaptic vesicle endocytosis [GO:0048488]; synaptic vesicle exocytosis [GO:0016079]; synaptic vesicle transport [GO:0048489]; visual learning [GO:0008542]"	anchoring junction [GO:0070161]; axon [GO:0030424]; cell junction [GO:0030054]; cyclin-dependent protein kinase holoenzyme complex [GO:0000307]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; filopodium [GO:0030175]; glutamatergic synapse [GO:0098978]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; membrane [GO:0016020]; microtubule [GO:0005874]; neuromuscular junction [GO:0031594]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; presynapse [GO:0098793]; protein kinase 5 complex [GO:0016533]; Schaffer collateral - CA1 synapse [GO:0098685]	"anchoring junction [GO:0070161]; axon [GO:0030424]; cell junction [GO:0030054]; cyclin-dependent protein kinase holoenzyme complex [GO:0000307]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; filopodium [GO:0030175]; glutamatergic synapse [GO:0098978]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; membrane [GO:0016020]; microtubule [GO:0005874]; neuromuscular junction [GO:0031594]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; presynapse [GO:0098793]; protein kinase 5 complex [GO:0016533]; Schaffer collateral - CA1 synapse [GO:0098685]; acetylcholine receptor activator activity [GO:0030549]; ATP binding [GO:0005524]; cyclin-dependent protein serine/threonine kinase activity [GO:0004693]; ephrin receptor binding [GO:0046875]; ErbB-2 class receptor binding [GO:0005176]; ErbB-3 class receptor binding [GO:0043125]; Hsp90 protein binding [GO:0051879]; kinase activity [GO:0016301]; p53 binding [GO:0002039]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]; voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels [GO:0099635]; axon extension [GO:0048675]; axonogenesis [GO:0007409]; behavioral response to cocaine [GO:0048148]; calcium ion import [GO:0070509]; cell division [GO:0051301]; cell-matrix adhesion [GO:0007160]; cellular response to amyloid-beta [GO:1904646]; central nervous system neuron development [GO:0021954]; cerebellar cortex formation [GO:0021697]; chemical synaptic transmission [GO:0007268]; corpus callosum development [GO:0022038]; cortical actin cytoskeleton organization [GO:0030866]; dendrite morphogenesis [GO:0048813]; excitatory postsynaptic potential [GO:0060079]; hippocampus development [GO:0021766]; intracellular protein transport [GO:0006886]; layer formation in cerebral cortex [GO:0021819]; microtubule cytoskeleton organization [GO:0000226]; mitochondrion organization [GO:0007005]; motor neuron axon guidance [GO:0008045]; negative regulation of axon extension [GO:0030517]; negative regulation of cell cycle [GO:0045786]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of neuron death [GO:1901215]; negative regulation of protein export from nucleus [GO:0046826]; negative regulation of protein ubiquitination [GO:0031397]; negative regulation of proteolysis [GO:0045861]; negative regulation of synaptic plasticity [GO:0031914]; neuron apoptotic process [GO:0051402]; neuron differentiation [GO:0030182]; neuron migration [GO:0001764]; neuron projection development [GO:0031175]; nucleocytoplasmic transport [GO:0006913]; oligodendrocyte differentiation [GO:0048709]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; phosphorylation [GO:0016310]; positive regulation of actin cytoskeleton reorganization [GO:2000251]; positive regulation of calcium ion-dependent exocytosis [GO:0045956]; positive regulation of glial cell apoptotic process [GO:0034352]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of protein binding [GO:0032092]; positive regulation of protein kinase activity [GO:0045860]; positive regulation of protein targeting to membrane [GO:0090314]; positive regulation of voltage-gated calcium channel activity [GO:1901387]; protein autophosphorylation [GO:0046777]; protein localization to synapse [GO:0035418]; protein phosphorylation [GO:0006468]; receptor catabolic process [GO:0032801]; receptor clustering [GO:0043113]; regulation of apoptotic process [GO:0042981]; regulation of cell cycle [GO:0051726]; regulation of cell migration [GO:0030334]; regulation of dendritic spine morphogenesis [GO:0061001]; regulation of macroautophagy [GO:0016241]; regulation of protein localization to plasma membrane [GO:1903076]; regulation of synaptic plasticity [GO:0048167]; regulation of synaptic transmission, glutamatergic [GO:0051966]; regulation of synaptic vesicle recycling [GO:1903421]; regulation of transcription involved in G1/S transition of mitotic cell cycle [GO:0000083]; response to wounding [GO:0009611]; rhythmic process [GO:0048511]; Schwann cell development [GO:0014044]; sensory perception of pain [GO:0019233]; serine phosphorylation of STAT protein [GO:0042501]; skeletal muscle tissue development [GO:0007519]; synapse assembly [GO:0007416]; synapse pruning [GO:0098883]; synaptic transmission, dopaminergic [GO:0001963]; synaptic transmission, glutamatergic [GO:0035249]; synaptic vesicle endocytosis [GO:0048488]; synaptic vesicle exocytosis [GO:0016079]; synaptic vesicle transport [GO:0048489]; visual learning [GO:0008542]"	acetylcholine receptor activator activity [GO:0030549]; ATP binding [GO:0005524]; cyclin-dependent protein serine/threonine kinase activity [GO:0004693]; ephrin receptor binding [GO:0046875]; ErbB-2 class receptor binding [GO:0005176]; ErbB-3 class receptor binding [GO:0043125]; Hsp90 protein binding [GO:0051879]; kinase activity [GO:0016301]; p53 binding [GO:0002039]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; tau protein binding [GO:0048156]; tau-protein kinase activity [GO:0050321]; voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels [GO:0099635]	GO:0000083; GO:0000226; GO:0000307; GO:0001764; GO:0001963; GO:0002039; GO:0004672; GO:0004674; GO:0004693; GO:0005176; GO:0005524; GO:0005634; GO:0005654; GO:0005737; GO:0005829; GO:0005874; GO:0005886; GO:0006468; GO:0006886; GO:0006913; GO:0007005; GO:0007160; GO:0007268; GO:0007409; GO:0007416; GO:0007519; GO:0008045; GO:0008542; GO:0009611; GO:0014044; GO:0014069; GO:0016020; GO:0016079; GO:0016241; GO:0016301; GO:0016310; GO:0016533; GO:0018105; GO:0018107; GO:0019233; GO:0019901; GO:0021697; GO:0021766; GO:0021819; GO:0021954; GO:0022038; GO:0030027; GO:0030054; GO:0030175; GO:0030182; GO:0030334; GO:0030424; GO:0030425; GO:0030426; GO:0030517; GO:0030549; GO:0030866; GO:0031175; GO:0031397; GO:0031594; GO:0031914; GO:0032092; GO:0032801; GO:0034352; GO:0035249; GO:0035418; GO:0042501; GO:0042981; GO:0043005; GO:0043025; GO:0043113; GO:0043125; GO:0043204; GO:0043525; GO:0045786; GO:0045860; GO:0045861; GO:0045892; GO:0045956; GO:0046777; GO:0046826; GO:0046875; GO:0048148; GO:0048156; GO:0048167; GO:0048488; GO:0048489; GO:0048511; GO:0048675; GO:0048709; GO:0048813; GO:0050321; GO:0051301; GO:0051402; GO:0051726; GO:0051879; GO:0051966; GO:0060079; GO:0061001; GO:0070161; GO:0070509; GO:0090314; GO:0098685; GO:0098793; GO:0098883; GO:0098978; GO:0099635; GO:0106310; GO:1901215; GO:1901387; GO:1903076; GO:1903421; GO:1904646; GO:2000251	AFGIPVR	0.99812	10.2957	10.9627	9.94207	9.37104	11.9433	0	10.1575	12.9544	11.8818	12.6441	11.9829	13.0451	11.6242	10.7216	11.813
B5TZ80	B5TZ80_HUMAN	Estrogen receptor alpha splice variant	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQCTIDK	0.2437	10.3397	11.2989	11.257	11.3087	11.1836	11.2107	0	12.3249	9.67234	12.5662	11.6723	11.7701	11.6145	11.5313	11.5101
P34972	CNR2_HUMAN	Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5)	CNR2 CB2A CB2B	Homo sapiens (Human)	"adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; cannabinoid signaling pathway [GO:0038171]; G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger [GO:0007187]; immune response [GO:0006955]; inflammatory response [GO:0006954]; leukocyte chemotaxis [GO:0030595]; negative regulation of action potential [GO:0045759]; negative regulation of inflammatory response [GO:0050728]; negative regulation of mast cell activation [GO:0033004]; negative regulation of nitric-oxide synthase activity [GO:0051001]; negative regulation of synaptic transmission, GABAergic [GO:0032229]; regulation of metabolic process [GO:0019222]; response to amphetamine [GO:0001975]; response to lipopolysaccharide [GO:0032496]; sensory perception of pain [GO:0019233]"	cytoplasm [GO:0005737]; dendrite [GO:0030425]; endoplasmic reticulum [GO:0005783]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]; integral component of plasma membrane [GO:0005887]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]	"cytoplasm [GO:0005737]; dendrite [GO:0030425]; endoplasmic reticulum [GO:0005783]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]; integral component of plasma membrane [GO:0005887]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; cannabinoid receptor activity [GO:0004949]; G protein-coupled receptor activity [GO:0004930]; adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; cannabinoid signaling pathway [GO:0038171]; G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger [GO:0007187]; immune response [GO:0006955]; inflammatory response [GO:0006954]; leukocyte chemotaxis [GO:0030595]; negative regulation of action potential [GO:0045759]; negative regulation of inflammatory response [GO:0050728]; negative regulation of mast cell activation [GO:0033004]; negative regulation of nitric-oxide synthase activity [GO:0051001]; negative regulation of synaptic transmission, GABAergic [GO:0032229]; regulation of metabolic process [GO:0019222]; response to amphetamine [GO:0001975]; response to lipopolysaccharide [GO:0032496]; sensory perception of pain [GO:0019233]"	cannabinoid receptor activity [GO:0004949]; G protein-coupled receptor activity [GO:0004930]	GO:0001975; GO:0004930; GO:0004949; GO:0005737; GO:0005783; GO:0005886; GO:0005887; GO:0006954; GO:0006955; GO:0007187; GO:0007189; GO:0019222; GO:0019233; GO:0030425; GO:0030595; GO:0031234; GO:0032229; GO:0032496; GO:0033004; GO:0038171; GO:0043204; GO:0045759; GO:0050728; GO:0051001	AHQHVASLSGHQDR	0.87915	10.9823	12.1784	12.2408	9.05829	10.1208	9.43012	12.1858	10.7206	11.1922	12.4365	12.0146	12.0471	12.2087	0	12.105
Q99767	APBA2_HUMAN	Amyloid-beta A4 precursor protein-binding family A member 2 (Adapter protein X11beta) (Neuron-specific X11L protein) (Neuronal Munc18-1-interacting protein 2) (Mint-2)	APBA2 MINT2 X11L	Homo sapiens (Human)	chemical synaptic transmission [GO:0007268]; in utero embryonic development [GO:0001701]; locomotory behavior [GO:0007626]; multicellular organism growth [GO:0035264]; nervous system development [GO:0007399]; protein transport [GO:0015031]; regulation of gene expression [GO:0010468]; regulation of synaptic vesicle exocytosis [GO:2000300]	cytoplasm [GO:0005737]; dendritic spine [GO:0043197]; plasma membrane [GO:0005886]; Schaffer collateral - CA1 synapse [GO:0098685]; synaptic vesicle [GO:0008021]	cytoplasm [GO:0005737]; dendritic spine [GO:0043197]; plasma membrane [GO:0005886]; Schaffer collateral - CA1 synapse [GO:0098685]; synaptic vesicle [GO:0008021]; amyloid-beta binding [GO:0001540]; identical protein binding [GO:0042802]; chemical synaptic transmission [GO:0007268]; in utero embryonic development [GO:0001701]; locomotory behavior [GO:0007626]; multicellular organism growth [GO:0035264]; nervous system development [GO:0007399]; protein transport [GO:0015031]; regulation of gene expression [GO:0010468]; regulation of synaptic vesicle exocytosis [GO:2000300]	amyloid-beta binding [GO:0001540]; identical protein binding [GO:0042802]	GO:0001540; GO:0001701; GO:0005737; GO:0005886; GO:0007268; GO:0007399; GO:0007626; GO:0008021; GO:0010468; GO:0015031; GO:0035264; GO:0042802; GO:0043197; GO:0098685; GO:2000300	AHRKLESVGSGMLDHR	0.93911	10.549	0	10.5734	12.3616	11.3732	11.6499	0	13.1942	13.276	13.8531	11.9232	13.1868	13.703	12.6732	9.81647
O75173	ATS4_HUMAN	A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAM-TS 4) (ADAM-TS4) (ADAMTS-4) (EC 3.4.24.82) (ADMP-1) (Aggrecanase-1)	ADAMTS4 KIAA0688 UNQ769/PRO1563	Homo sapiens (Human)	extracellular matrix disassembly [GO:0022617]; extracellular matrix organization [GO:0030198]; proteolysis [GO:0006508]; skeletal system development [GO:0001501]	collagen-containing extracellular matrix [GO:0062023]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nuclear speck [GO:0016607]	collagen-containing extracellular matrix [GO:0062023]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nuclear speck [GO:0016607]; metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]; metallopeptidase activity [GO:0008237]; peptidase activity [GO:0008233]; protease binding [GO:0002020]; extracellular matrix disassembly [GO:0022617]; extracellular matrix organization [GO:0030198]; proteolysis [GO:0006508]; skeletal system development [GO:0001501]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]; metallopeptidase activity [GO:0008237]; peptidase activity [GO:0008233]; protease binding [GO:0002020]	GO:0001501; GO:0002020; GO:0004222; GO:0005576; GO:0005615; GO:0006508; GO:0008233; GO:0008237; GO:0016607; GO:0022617; GO:0030198; GO:0031012; GO:0046872; GO:0062023	APLGSPSPRPR	0.94309	14.1475	13.6014	11.9381	8.98695	0	0	11.0441	11.7353	12.9875	13.0296	13.0818	12.2614	12.6908	12.2835	8.87513
B7Z1Y2	B7Z1Y2_HUMAN	Fructose-bisphosphate aldolase (EC 4.1.2.13)		Homo sapiens (Human)	glycolytic process [GO:0006096]		fructose-bisphosphate aldolase activity [GO:0004332]; glycolytic process [GO:0006096]	fructose-bisphosphate aldolase activity [GO:0004332]	GO:0004332; GO:0006096	AEVNGLAAQGK	0.31944	12.1397	10.3318	8.89488	8.25682	9.96135	12.6113	9.27496	0	11.5559	13.108	11.8028	10.9275	12.9786	11.3933	12.308
O95704	APBB3_HUMAN	Amyloid-beta A4 precursor protein-binding family B member 3 (Protein Fe65-like 2) (Fe65L2)	APBB3 FE65L2	Homo sapiens (Human)	positive regulation of protein secretion [GO:0050714]; regulation of DNA-templated transcription [GO:0006355]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleus [GO:0005634]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleus [GO:0005634]; amyloid-beta binding [GO:0001540]; low-density lipoprotein particle receptor binding [GO:0050750]; positive regulation of protein secretion [GO:0050714]; regulation of DNA-templated transcription [GO:0006355]	amyloid-beta binding [GO:0001540]; low-density lipoprotein particle receptor binding [GO:0050750]	GO:0001540; GO:0005634; GO:0005737; GO:0005829; GO:0006355; GO:0015629; GO:0016020; GO:0050714; GO:0050750	AMGMDVLNEAIGTLTARGDR	0.97973	12.3594	12.3679	10.1277	10.4153	0	9.26339	11.6649	11.8881	11.6722	9.436	10.7058	10.5258	11.9645	11.9244	10.6609
P23141	EST1_HUMAN	Liver carboxylesterase 1 (Acyl-coenzyme A:cholesterol acyltransferase) (ACAT) (Brain carboxylesterase hBr1) (Carboxylesterase 1) (CE-1) (hCE-1) (EC 3.1.1.1) (Cholesteryl ester hydrolase) (CEH) (EC 3.1.1.13) (Cocaine carboxylesterase) (Egasyn) (HMSE) (Methylumbelliferyl-acetate deacetylase 1) (EC 3.1.1.56) (Monocyte/macrophage serine esterase) (Retinyl ester hydrolase) (REH) (Serine esterase 1) (Triacylglycerol hydrolase) (TGH)	CES1 CES2 SES1	Homo sapiens (Human)	cellular response to cholesterol [GO:0071397]; cellular response to low-density lipoprotein particle stimulus [GO:0071404]; cholesterol biosynthetic process [GO:0006695]; cholesterol ester hydrolysis involved in cholesterol transport [GO:0090122]; cholesterol homeostasis [GO:0042632]; cholesterol metabolic process [GO:0008203]; epithelial cell differentiation [GO:0030855]; lipid catabolic process [GO:0016042]; medium-chain fatty acid metabolic process [GO:0051791]; negative regulation of cholesterol storage [GO:0010887]; positive regulation of cholesterol efflux [GO:0010875]; positive regulation of cholesterol metabolic process [GO:0090205]; regulation of bile acid biosynthetic process [GO:0070857]; regulation of bile acid secretion [GO:0120188]; response to toxic substance [GO:0009636]; reverse cholesterol transport [GO:0043691]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; lipid droplet [GO:0005811]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; lipid droplet [GO:0005811]; carboxylic ester hydrolase activity [GO:0052689]; methyl indole-3-acetate esterase activity [GO:0080030]; methylumbelliferyl-acetate deacetylase activity [GO:0047374]; sterol esterase activity [GO:0004771]; cellular response to cholesterol [GO:0071397]; cellular response to low-density lipoprotein particle stimulus [GO:0071404]; cholesterol biosynthetic process [GO:0006695]; cholesterol ester hydrolysis involved in cholesterol transport [GO:0090122]; cholesterol homeostasis [GO:0042632]; cholesterol metabolic process [GO:0008203]; epithelial cell differentiation [GO:0030855]; lipid catabolic process [GO:0016042]; medium-chain fatty acid metabolic process [GO:0051791]; negative regulation of cholesterol storage [GO:0010887]; positive regulation of cholesterol efflux [GO:0010875]; positive regulation of cholesterol metabolic process [GO:0090205]; regulation of bile acid biosynthetic process [GO:0070857]; regulation of bile acid secretion [GO:0120188]; response to toxic substance [GO:0009636]; reverse cholesterol transport [GO:0043691]	carboxylic ester hydrolase activity [GO:0052689]; methyl indole-3-acetate esterase activity [GO:0080030]; methylumbelliferyl-acetate deacetylase activity [GO:0047374]; sterol esterase activity [GO:0004771]	GO:0004771; GO:0005737; GO:0005783; GO:0005788; GO:0005811; GO:0005829; GO:0006695; GO:0008203; GO:0009636; GO:0010875; GO:0010887; GO:0016042; GO:0030855; GO:0042632; GO:0043691; GO:0047374; GO:0051791; GO:0052689; GO:0070857; GO:0071397; GO:0071404; GO:0080030; GO:0090122; GO:0090205; GO:0120188	AGQLLSELFTNR	0.47514	10.6211	10.6921	0	10.6405	9.92456	8.98083	11.8805	9.97757	11.5307	11.1845	13.5922	13.3967	9.99986	11.4479	10.7625
P56270	MAZ_HUMAN	Myc-associated zinc finger protein (MAZI) (Pur-1) (Purine-binding transcription factor) (Serum amyloid A-activating factor-1) (SAF-1) (Transcription factor Zif87) (ZF87) (Zinc finger protein 801)	MAZ ZNF801	Homo sapiens (Human)	negative regulation of apoptotic signaling pathway [GO:2001234]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of gene expression [GO:0010628]; positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; positive regulation of protein kinase B signaling [GO:0051897]; regulation of transcription by RNA polymerase II [GO:0006357]; termination of RNA polymerase II transcription [GO:0006369]; transcription initiation at RNA polymerase II promoter [GO:0006367]	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; negative regulation of apoptotic signaling pathway [GO:2001234]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of gene expression [GO:0010628]; positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; positive regulation of protein kinase B signaling [GO:0051897]; regulation of transcription by RNA polymerase II [GO:0006357]; termination of RNA polymerase II transcription [GO:0006369]; transcription initiation at RNA polymerase II promoter [GO:0006367]"	"DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	GO:0000122; GO:0000978; GO:0000981; GO:0003700; GO:0003723; GO:0005634; GO:0006357; GO:0006367; GO:0006369; GO:0008284; GO:0010628; GO:0014068; GO:0030335; GO:0045893; GO:0046872; GO:0051897; GO:2001234	AFRDVYHLNR	0.99814	10.372	9.16088	10.9558	10.6927	10.9429	11.3717	12.0539	11.5654	10.525	12.623	11.5112	10.9097	9.64366	11.9583	0
B4DFG4	B4DFG4_HUMAN	"cDNA FLJ58801, highly similar to Interleukin enhancer-binding factor 3"		Homo sapiens (Human)	defense response to virus [GO:0051607]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; DNA binding [GO:0003677]; double-stranded RNA binding [GO:0003725]; defense response to virus [GO:0051607]	DNA binding [GO:0003677]; double-stranded RNA binding [GO:0003725]	GO:0003677; GO:0003725; GO:0005634; GO:0005737; GO:0051607	AEPPQAMNALMR	1.0033	10.6243	13.6398	0	13.6027	13.2073	0	13.1396	9.16171	9.14721	13.3619	9.42788	13.844	11.0568	10.7755	13.2973
P48730	KC1D_HUMAN	Casein kinase I isoform delta (CKI-delta) (CKId) (EC 2.7.11.1) (Tau-protein kinase CSNK1D) (EC 2.7.11.26)	CSNK1D HCKID	Homo sapiens (Human)	cellular response to nerve growth factor stimulus [GO:1990090]; circadian regulation of gene expression [GO:0032922]; COPII vesicle coating [GO:0048208]; Golgi organization [GO:0007030]; microtubule nucleation [GO:0007020]; non-motile cilium assembly [GO:1905515]; peptidyl-serine phosphorylation [GO:0018105]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of non-canonical Wnt signaling pathway [GO:2000052]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of Wnt-mediated midbrain dopaminergic neuron differentiation [GO:1905426]; protein localization to centrosome [GO:0071539]; protein localization to cilium [GO:0061512]; protein localization to Golgi apparatus [GO:0034067]; protein phosphorylation [GO:0006468]; regulation of circadian rhythm [GO:0042752]; signal transduction [GO:0007165]; spindle assembly [GO:0051225]; Wnt signaling pathway [GO:0016055]	centrosome [GO:0005813]; ciliary basal body [GO:0036064]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; Golgi apparatus [GO:0005794]; neuron projection [GO:0043005]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; spindle [GO:0005819]; spindle microtubule [GO:0005876]	centrosome [GO:0005813]; ciliary basal body [GO:0036064]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; Golgi apparatus [GO:0005794]; neuron projection [GO:0043005]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; spindle [GO:0005819]; spindle microtubule [GO:0005876]; ATP binding [GO:0005524]; cadherin binding [GO:0045296]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; tau-protein kinase activity [GO:0050321]; cellular response to nerve growth factor stimulus [GO:1990090]; circadian regulation of gene expression [GO:0032922]; COPII vesicle coating [GO:0048208]; Golgi organization [GO:0007030]; microtubule nucleation [GO:0007020]; non-motile cilium assembly [GO:1905515]; peptidyl-serine phosphorylation [GO:0018105]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of non-canonical Wnt signaling pathway [GO:2000052]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of Wnt-mediated midbrain dopaminergic neuron differentiation [GO:1905426]; protein localization to centrosome [GO:0071539]; protein localization to cilium [GO:0061512]; protein localization to Golgi apparatus [GO:0034067]; protein phosphorylation [GO:0006468]; regulation of circadian rhythm [GO:0042752]; signal transduction [GO:0007165]; spindle assembly [GO:0051225]; Wnt signaling pathway [GO:0016055]	ATP binding [GO:0005524]; cadherin binding [GO:0045296]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; tau-protein kinase activity [GO:0050321]	GO:0001934; GO:0004672; GO:0004674; GO:0005524; GO:0005634; GO:0005654; GO:0005737; GO:0005794; GO:0005813; GO:0005819; GO:0005829; GO:0005876; GO:0005886; GO:0006468; GO:0007020; GO:0007030; GO:0007165; GO:0016055; GO:0018105; GO:0032436; GO:0032922; GO:0033116; GO:0034067; GO:0036064; GO:0042752; GO:0043005; GO:0045296; GO:0048208; GO:0048471; GO:0050321; GO:0051225; GO:0061512; GO:0071539; GO:0090263; GO:0106310; GO:1905426; GO:1905515; GO:1990090; GO:2000052	AADDAER	1.005	11.5616	12.0914	11.8083	0	10.4829	0	9.02785	11.7145	10.9756	13.6937	12.9188	13.412	13.5791	11.2113	11.7957
Q9Y2W7	CSEN_HUMAN	Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)	KCNIP3 CSEN DREAM KCHIP3	Homo sapiens (Human)	apoptotic process [GO:0006915]; negative regulation of transcription by RNA polymerase II [GO:0000122]; protein localization to plasma membrane [GO:0072659]; regulation of potassium ion transmembrane transport [GO:1901379]; signal transduction [GO:0007165]	cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; voltage-gated potassium channel complex [GO:0008076]	"cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; voltage-gated potassium channel complex [GO:0008076]; calcium ion binding [GO:0005509]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; potassium channel activity [GO:0005267]; potassium channel regulator activity [GO:0015459]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; voltage-gated ion channel activity [GO:0005244]; apoptotic process [GO:0006915]; negative regulation of transcription by RNA polymerase II [GO:0000122]; protein localization to plasma membrane [GO:0072659]; regulation of potassium ion transmembrane transport [GO:1901379]; signal transduction [GO:0007165]"	"calcium ion binding [GO:0005509]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; potassium channel activity [GO:0005267]; potassium channel regulator activity [GO:0015459]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; voltage-gated ion channel activity [GO:0005244]"	GO:0000122; GO:0000978; GO:0001227; GO:0005244; GO:0005267; GO:0005509; GO:0005634; GO:0005783; GO:0005794; GO:0005829; GO:0005886; GO:0006915; GO:0007165; GO:0008076; GO:0015459; GO:0072659; GO:1901379	ASDGSLLGDLGHTPLSK	0.98589	0	11.9026	14.0686	13.3946	11.4414	0	14.1853	9.95771	11.6664	14.7137	0	11.9078	14.3656	12.1656	14.3643
Q9H3S2	Q9H3S2_HUMAN	"HCCA2 protein (HCCA2 protein, isoform CRA_b)"	HCCA2 hCG_40842	Homo sapiens (Human)						AAPALPR	0.74419	11.1898	11.2472	10.3406	10.6386	0	0	12.4986	11.6033	15.414	12.9628	12.4698	12.5025	10.4571	10.7957	11.1173
B4DFG5	B4DFG5_HUMAN	Mitochondrial glutathione transporter SLC25A40 (Solute carrier family 25 member 40)	SLC25A39	Homo sapiens (Human)	mitochondrial transmembrane transport [GO:1990542]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; mitochondrial transmembrane transport [GO:1990542]		GO:0016021; GO:1990542	AAPSCAIMISTYEFGK	0.98896	10.1387	11.0606	10.1962	10.5854	9.54961	12.6588	0	10.9786	11.5131	11.6593	11.5395	12.0313	11.011	10.3636	9.9368
Q93045	STMN2_HUMAN	Stathmin-2 (Superior cervical ganglion-10 protein) (Protein SCG10)	STMN2 SCG10 SCGN10	Homo sapiens (Human)	cellular response to nerve growth factor stimulus [GO:1990090]; microtubule depolymerization [GO:0007019]; negative regulation of microtubule depolymerization [GO:0007026]; negative regulation of microtubule polymerization [GO:0031115]; negative regulation of neuron projection development [GO:0010977]; neuron projection development [GO:0031175]; positive regulation of microtubule depolymerization [GO:0031117]; positive regulation of neuron projection development [GO:0010976]; regulation of microtubule polymerization or depolymerization [GO:0031110]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endosome [GO:0005768]; Golgi apparatus [GO:0005794]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; membrane [GO:0016020]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; perinuclear region of cytoplasm [GO:0048471]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endosome [GO:0005768]; Golgi apparatus [GO:0005794]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; membrane [GO:0016020]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; perinuclear region of cytoplasm [GO:0048471]; calcium-dependent protein binding [GO:0048306]; tubulin binding [GO:0015631]; cellular response to nerve growth factor stimulus [GO:1990090]; microtubule depolymerization [GO:0007019]; negative regulation of microtubule depolymerization [GO:0007026]; negative regulation of microtubule polymerization [GO:0031115]; negative regulation of neuron projection development [GO:0010977]; neuron projection development [GO:0031175]; positive regulation of microtubule depolymerization [GO:0031117]; positive regulation of neuron projection development [GO:0010976]; regulation of microtubule polymerization or depolymerization [GO:0031110]	calcium-dependent protein binding [GO:0048306]; tubulin binding [GO:0015631]	GO:0005737; GO:0005768; GO:0005794; GO:0005829; GO:0007019; GO:0007026; GO:0010976; GO:0010977; GO:0015631; GO:0016020; GO:0030027; GO:0030426; GO:0031110; GO:0031115; GO:0031117; GO:0031175; GO:0043005; GO:0043025; GO:0048306; GO:0048471; GO:1990090	AKTAMAYK	0.9839	12.0354	12.4997	11.4999	10.7752	10.4953	10.5201	0	11.2302	11.5254	12.9978	12.1688	13.1434	11.6493	0	12.4938
P02649	APOE_HUMAN	Apolipoprotein E (Apo-E)	APOE	Homo sapiens (Human)	"AMPA glutamate receptor clustering [GO:0097113]; amyloid precursor protein metabolic process [GO:0042982]; artery morphogenesis [GO:0048844]; cellular calcium ion homeostasis [GO:0006874]; cGMP-mediated signaling [GO:0019934]; cholesterol catabolic process [GO:0006707]; cholesterol efflux [GO:0033344]; cholesterol homeostasis [GO:0042632]; cholesterol metabolic process [GO:0008203]; chylomicron remnant clearance [GO:0034382]; cytoskeleton organization [GO:0007010]; fatty acid homeostasis [GO:0055089]; G protein-coupled receptor signaling pathway [GO:0007186]; gene expression [GO:0010467]; high-density lipoprotein particle assembly [GO:0034380]; high-density lipoprotein particle clearance [GO:0034384]; high-density lipoprotein particle remodeling [GO:0034375]; intermediate-density lipoprotein particle clearance [GO:0071831]; intracellular transport [GO:0046907]; lipid transport involved in lipid storage [GO:0010877]; lipoprotein biosynthetic process [GO:0042158]; lipoprotein catabolic process [GO:0042159]; locomotory exploration behavior [GO:0035641]; long-chain fatty acid transport [GO:0015909]; long-term memory [GO:0007616]; low-density lipoprotein particle remodeling [GO:0034374]; maintenance of location in cell [GO:0051651]; melanosome organization [GO:0032438]; negative regulation of amyloid fibril formation [GO:1905907]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of blood coagulation [GO:0030195]; negative regulation of blood vessel endothelial cell migration [GO:0043537]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cholesterol biosynthetic process [GO:0045541]; negative regulation of cholesterol efflux [GO:0090370]; negative regulation of dendritic spine development [GO:0061000]; negative regulation of dendritic spine maintenance [GO:1902951]; negative regulation of endothelial cell migration [GO:0010596]; negative regulation of endothelial cell proliferation [GO:0001937]; negative regulation of gene expression [GO:0010629]; negative regulation of inflammatory response [GO:0050728]; negative regulation of lipid biosynthetic process [GO:0051055]; negative regulation of lipid transport across blood-brain barrier [GO:1903001]; negative regulation of long-term synaptic potentiation [GO:1900272]; negative regulation of MAP kinase activity [GO:0043407]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of neuron death [GO:1901215]; negative regulation of neuron projection development [GO:0010977]; negative regulation of phospholipid efflux [GO:1902999]; negative regulation of platelet activation [GO:0010544]; negative regulation of postsynaptic membrane organization [GO:1901627]; negative regulation of protein metabolic process [GO:0051248]; negative regulation of protein secretion [GO:0050709]; negative regulation of smooth muscle cell proliferation [GO:0048662]; negative regulation of triglyceride metabolic process [GO:0090209]; neuron projection development [GO:0031175]; nitric oxide mediated signal transduction [GO:0007263]; NMDA glutamate receptor clustering [GO:0097114]; phospholipid efflux [GO:0033700]; positive regulation by host of viral process [GO:0044794]; positive regulation of amyloid fibril formation [GO:1905908]; positive regulation of amyloid-beta clearance [GO:1900223]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of cholesterol efflux [GO:0010875]; positive regulation of cholesterol metabolic process [GO:0090205]; positive regulation of CoA-transferase activity [GO:1905920]; positive regulation of dendritic spine development [GO:0060999]; positive regulation of dendritic spine maintenance [GO:1902952]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of endocytosis [GO:0045807]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of heparan sulfate binding [GO:1905855]; positive regulation of heparan sulfate proteoglycan binding [GO:1905860]; positive regulation of lipid biosynthetic process [GO:0046889]; positive regulation of lipid transport across blood-brain barrier [GO:1903002]; positive regulation of low-density lipoprotein particle receptor catabolic process [GO:0032805]; positive regulation of membrane protein ectodomain proteolysis [GO:0051044]; positive regulation of neurofibrillary tangle assembly [GO:1902998]; positive regulation of neuron death [GO:1901216]; positive regulation of neuron projection development [GO:0010976]; positive regulation of nitric-oxide synthase activity [GO:0051000]; positive regulation of phospholipid efflux [GO:1902995]; positive regulation of presynaptic membrane organization [GO:1901631]; protein import [GO:0017038]; receptor-mediated endocytosis [GO:0006898]; regulation of amyloid fibril formation [GO:1905906]; regulation of amyloid precursor protein catabolic process [GO:1902991]; regulation of amyloid-beta clearance [GO:1900221]; regulation of axon extension [GO:0030516]; regulation of behavioral fear response [GO:2000822]; regulation of Cdc42 protein signal transduction [GO:0032489]; regulation of cellular response to very-low-density lipoprotein particle stimulus [GO:1905890]; regulation of cholesterol metabolic process [GO:0090181]; regulation of innate immune response [GO:0045088]; regulation of neuron death [GO:1901214]; regulation of neuronal synaptic plasticity [GO:0048168]; regulation of proteasomal protein catabolic process [GO:0061136]; regulation of protein metabolic process [GO:0051246]; regulation of protein-containing complex assembly [GO:0043254]; regulation of tau-protein kinase activity [GO:1902947]; response to caloric restriction [GO:0061771]; response to dietary excess [GO:0002021]; response to reactive oxygen species [GO:0000302]; reverse cholesterol transport [GO:0043691]; synaptic transmission, cholinergic [GO:0007271]; triglyceride homeostasis [GO:0070328]; triglyceride metabolic process [GO:0006641]; triglyceride-rich lipoprotein particle clearance [GO:0071830]; vasodilation [GO:0042311]; very-low-density lipoprotein particle clearance [GO:0034447]; very-low-density lipoprotein particle remodeling [GO:0034372]; virion assembly [GO:0019068]"	blood microparticle [GO:0072562]; chylomicron [GO:0042627]; clathrin-coated endocytic vesicle membrane [GO:0030669]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; discoidal high-density lipoprotein particle [GO:0034365]; early endosome [GO:0005769]; endocytic vesicle lumen [GO:0071682]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; extracellular vesicle [GO:1903561]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; high-density lipoprotein particle [GO:0034364]; intermediate-density lipoprotein particle [GO:0034363]; lipoprotein particle [GO:1990777]; low-density lipoprotein particle [GO:0034362]; melanosome [GO:0042470]; membrane [GO:0016020]; multivesicular body [GO:0005771]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; synaptic cleft [GO:0043083]; very-low-density lipoprotein particle [GO:0034361]	"blood microparticle [GO:0072562]; chylomicron [GO:0042627]; clathrin-coated endocytic vesicle membrane [GO:0030669]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; discoidal high-density lipoprotein particle [GO:0034365]; early endosome [GO:0005769]; endocytic vesicle lumen [GO:0071682]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; extracellular vesicle [GO:1903561]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; high-density lipoprotein particle [GO:0034364]; intermediate-density lipoprotein particle [GO:0034363]; lipoprotein particle [GO:1990777]; low-density lipoprotein particle [GO:0034362]; melanosome [GO:0042470]; membrane [GO:0016020]; multivesicular body [GO:0005771]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; synaptic cleft [GO:0043083]; very-low-density lipoprotein particle [GO:0034361]; amyloid-beta binding [GO:0001540]; antioxidant activity [GO:0016209]; cholesterol transfer activity [GO:0120020]; enzyme binding [GO:0019899]; heparan sulfate proteoglycan binding [GO:0043395]; heparin binding [GO:0008201]; identical protein binding [GO:0042802]; lipid binding [GO:0008289]; lipid transporter activity [GO:0005319]; lipoprotein particle binding [GO:0071813]; low-density lipoprotein particle receptor binding [GO:0050750]; metal chelating activity [GO:0046911]; phosphatidylcholine-sterol O-acyltransferase activator activity [GO:0060228]; phospholipid binding [GO:0005543]; protein dimerization activity [GO:0046983]; protein homodimerization activity [GO:0042803]; protein-containing complex binding [GO:0044877]; signaling receptor binding [GO:0005102]; structural molecule activity [GO:0005198]; tau protein binding [GO:0048156]; very-low-density lipoprotein particle receptor binding [GO:0070326]; AMPA glutamate receptor clustering [GO:0097113]; amyloid precursor protein metabolic process [GO:0042982]; artery morphogenesis [GO:0048844]; cellular calcium ion homeostasis [GO:0006874]; cGMP-mediated signaling [GO:0019934]; cholesterol catabolic process [GO:0006707]; cholesterol efflux [GO:0033344]; cholesterol homeostasis [GO:0042632]; cholesterol metabolic process [GO:0008203]; chylomicron remnant clearance [GO:0034382]; cytoskeleton organization [GO:0007010]; fatty acid homeostasis [GO:0055089]; G protein-coupled receptor signaling pathway [GO:0007186]; gene expression [GO:0010467]; high-density lipoprotein particle assembly [GO:0034380]; high-density lipoprotein particle clearance [GO:0034384]; high-density lipoprotein particle remodeling [GO:0034375]; intermediate-density lipoprotein particle clearance [GO:0071831]; intracellular transport [GO:0046907]; lipid transport involved in lipid storage [GO:0010877]; lipoprotein biosynthetic process [GO:0042158]; lipoprotein catabolic process [GO:0042159]; locomotory exploration behavior [GO:0035641]; long-chain fatty acid transport [GO:0015909]; long-term memory [GO:0007616]; low-density lipoprotein particle remodeling [GO:0034374]; maintenance of location in cell [GO:0051651]; melanosome organization [GO:0032438]; negative regulation of amyloid fibril formation [GO:1905907]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of blood coagulation [GO:0030195]; negative regulation of blood vessel endothelial cell migration [GO:0043537]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cholesterol biosynthetic process [GO:0045541]; negative regulation of cholesterol efflux [GO:0090370]; negative regulation of dendritic spine development [GO:0061000]; negative regulation of dendritic spine maintenance [GO:1902951]; negative regulation of endothelial cell migration [GO:0010596]; negative regulation of endothelial cell proliferation [GO:0001937]; negative regulation of gene expression [GO:0010629]; negative regulation of inflammatory response [GO:0050728]; negative regulation of lipid biosynthetic process [GO:0051055]; negative regulation of lipid transport across blood-brain barrier [GO:1903001]; negative regulation of long-term synaptic potentiation [GO:1900272]; negative regulation of MAP kinase activity [GO:0043407]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of neuron death [GO:1901215]; negative regulation of neuron projection development [GO:0010977]; negative regulation of phospholipid efflux [GO:1902999]; negative regulation of platelet activation [GO:0010544]; negative regulation of postsynaptic membrane organization [GO:1901627]; negative regulation of protein metabolic process [GO:0051248]; negative regulation of protein secretion [GO:0050709]; negative regulation of smooth muscle cell proliferation [GO:0048662]; negative regulation of triglyceride metabolic process [GO:0090209]; neuron projection development [GO:0031175]; nitric oxide mediated signal transduction [GO:0007263]; NMDA glutamate receptor clustering [GO:0097114]; phospholipid efflux [GO:0033700]; positive regulation by host of viral process [GO:0044794]; positive regulation of amyloid fibril formation [GO:1905908]; positive regulation of amyloid-beta clearance [GO:1900223]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of cholesterol efflux [GO:0010875]; positive regulation of cholesterol metabolic process [GO:0090205]; positive regulation of CoA-transferase activity [GO:1905920]; positive regulation of dendritic spine development [GO:0060999]; positive regulation of dendritic spine maintenance [GO:1902952]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of endocytosis [GO:0045807]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of heparan sulfate binding [GO:1905855]; positive regulation of heparan sulfate proteoglycan binding [GO:1905860]; positive regulation of lipid biosynthetic process [GO:0046889]; positive regulation of lipid transport across blood-brain barrier [GO:1903002]; positive regulation of low-density lipoprotein particle receptor catabolic process [GO:0032805]; positive regulation of membrane protein ectodomain proteolysis [GO:0051044]; positive regulation of neurofibrillary tangle assembly [GO:1902998]; positive regulation of neuron death [GO:1901216]; positive regulation of neuron projection development [GO:0010976]; positive regulation of nitric-oxide synthase activity [GO:0051000]; positive regulation of phospholipid efflux [GO:1902995]; positive regulation of presynaptic membrane organization [GO:1901631]; protein import [GO:0017038]; receptor-mediated endocytosis [GO:0006898]; regulation of amyloid fibril formation [GO:1905906]; regulation of amyloid precursor protein catabolic process [GO:1902991]; regulation of amyloid-beta clearance [GO:1900221]; regulation of axon extension [GO:0030516]; regulation of behavioral fear response [GO:2000822]; regulation of Cdc42 protein signal transduction [GO:0032489]; regulation of cellular response to very-low-density lipoprotein particle stimulus [GO:1905890]; regulation of cholesterol metabolic process [GO:0090181]; regulation of innate immune response [GO:0045088]; regulation of neuron death [GO:1901214]; regulation of neuronal synaptic plasticity [GO:0048168]; regulation of proteasomal protein catabolic process [GO:0061136]; regulation of protein metabolic process [GO:0051246]; regulation of protein-containing complex assembly [GO:0043254]; regulation of tau-protein kinase activity [GO:1902947]; response to caloric restriction [GO:0061771]; response to dietary excess [GO:0002021]; response to reactive oxygen species [GO:0000302]; reverse cholesterol transport [GO:0043691]; synaptic transmission, cholinergic [GO:0007271]; triglyceride homeostasis [GO:0070328]; triglyceride metabolic process [GO:0006641]; triglyceride-rich lipoprotein particle clearance [GO:0071830]; vasodilation [GO:0042311]; very-low-density lipoprotein particle clearance [GO:0034447]; very-low-density lipoprotein particle remodeling [GO:0034372]; virion assembly [GO:0019068]"	amyloid-beta binding [GO:0001540]; antioxidant activity [GO:0016209]; cholesterol transfer activity [GO:0120020]; enzyme binding [GO:0019899]; heparan sulfate proteoglycan binding [GO:0043395]; heparin binding [GO:0008201]; identical protein binding [GO:0042802]; lipid binding [GO:0008289]; lipid transporter activity [GO:0005319]; lipoprotein particle binding [GO:0071813]; low-density lipoprotein particle receptor binding [GO:0050750]; metal chelating activity [GO:0046911]; phosphatidylcholine-sterol O-acyltransferase activator activity [GO:0060228]; phospholipid binding [GO:0005543]; protein dimerization activity [GO:0046983]; protein homodimerization activity [GO:0042803]; protein-containing complex binding [GO:0044877]; signaling receptor binding [GO:0005102]; structural molecule activity [GO:0005198]; tau protein binding [GO:0048156]; very-low-density lipoprotein particle receptor binding [GO:0070326]	GO:0000302; GO:0001540; GO:0001937; GO:0002021; GO:0005102; GO:0005198; GO:0005319; GO:0005543; GO:0005576; GO:0005615; GO:0005634; GO:0005737; GO:0005769; GO:0005771; GO:0005783; GO:0005788; GO:0005794; GO:0005886; GO:0006641; GO:0006707; GO:0006874; GO:0006898; GO:0007010; GO:0007186; GO:0007263; GO:0007271; GO:0007616; GO:0008201; GO:0008203; GO:0008289; GO:0010467; GO:0010544; GO:0010596; GO:0010629; GO:0010875; GO:0010877; GO:0010976; GO:0010977; GO:0015909; GO:0016020; GO:0016209; GO:0017038; GO:0019068; GO:0019899; GO:0019934; GO:0030195; GO:0030425; GO:0030516; GO:0030669; GO:0031012; GO:0031175; GO:0032438; GO:0032489; GO:0032805; GO:0033344; GO:0033700; GO:0034361; GO:0034362; GO:0034363; GO:0034364; GO:0034365; GO:0034372; GO:0034374; GO:0034375; GO:0034380; GO:0034382; GO:0034384; GO:0034447; GO:0035641; GO:0042158; GO:0042159; GO:0042311; GO:0042470; GO:0042627; GO:0042632; GO:0042802; GO:0042803; GO:0042982; GO:0043025; GO:0043083; GO:0043254; GO:0043395; GO:0043407; GO:0043524; GO:0043537; GO:0043691; GO:0044794; GO:0044877; GO:0045088; GO:0045541; GO:0045807; GO:0045893; GO:0046889; GO:0046907; GO:0046911; GO:0046983; GO:0048156; GO:0048168; GO:0048662; GO:0048844; GO:0050709; GO:0050728; GO:0050750; GO:0051000; GO:0051044; GO:0051055; GO:0051246; GO:0051248; GO:0051651; GO:0055089; GO:0060228; GO:0060999; GO:0061000; GO:0061136; GO:0061771; GO:0062023; GO:0070062; GO:0070326; GO:0070328; GO:0070374; GO:0071682; GO:0071813; GO:0071830; GO:0071831; GO:0072562; GO:0090090; GO:0090181; GO:0090205; GO:0090209; GO:0090370; GO:0097113; GO:0097114; GO:0098978; GO:0120020; GO:1900221; GO:1900223; GO:1900272; GO:1901214; GO:1901215; GO:1901216; GO:1901627; GO:1901631; GO:1902004; GO:1902430; GO:1902947; GO:1902951; GO:1902952; GO:1902991; GO:1902995; GO:1902998; GO:1902999; GO:1903001; GO:1903002; GO:1903561; GO:1905855; GO:1905860; GO:1905890; GO:1905906; GO:1905907; GO:1905908; GO:1905920; GO:1990777; GO:2000822	AATVGSLAGQPLQER	1.0096	12.0834	8.91657	12.4824	10.3957	10.4882	0	12.8446	11.8504	11.9682	13.5068	0	12.1113	12.1547	11.8117	11.8127
Q9UBU2	DKK2_HUMAN	Dickkopf-related protein 2 (Dickkopf-2) (Dkk-2) (hDkk-2)	DKK2 UNQ682/PRO1316	Homo sapiens (Human)	negative regulation of canonical Wnt signaling pathway [GO:0090090]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; Wnt signaling pathway [GO:0016055]	extracellular space [GO:0005615]	extracellular space [GO:0005615]; co-receptor binding [GO:0039706]; receptor antagonist activity [GO:0048019]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; Wnt signaling pathway [GO:0016055]	co-receptor binding [GO:0039706]; receptor antagonist activity [GO:0048019]	GO:0005615; GO:0016055; GO:0039706; GO:0048019; GO:0090090; GO:0090263	AKLNSIK	0.97773	13.7542	13.8971	13.5276	0	0	0	12.6563	13.2894	11.8763	9.8237	13.0589	13.3647	11.678	13.431	11.8296
O15269	SPTC1_HUMAN	Serine palmitoyltransferase 1 (EC 2.3.1.50) (Long chain base biosynthesis protein 1) (LCB 1) (Serine-palmitoyl-CoA transferase 1) (SPT 1) (SPT1)	SPTLC1 LCB1	Homo sapiens (Human)	ceramide biosynthetic process [GO:0046513]; positive regulation of lipophagy [GO:1904504]; regulation of fat cell apoptotic process [GO:1904649]; sphinganine biosynthetic process [GO:0046511]; sphingolipid biosynthetic process [GO:0030148]; sphingolipid metabolic process [GO:0006665]; sphingomyelin biosynthetic process [GO:0006686]; sphingosine biosynthetic process [GO:0046512]	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; serine C-palmitoyltransferase complex [GO:0017059]; SPOTS complex [GO:0035339]	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; serine C-palmitoyltransferase complex [GO:0017059]; SPOTS complex [GO:0035339]; pyridoxal phosphate binding [GO:0030170]; serine C-palmitoyltransferase activity [GO:0004758]; ceramide biosynthetic process [GO:0046513]; positive regulation of lipophagy [GO:1904504]; regulation of fat cell apoptotic process [GO:1904649]; sphinganine biosynthetic process [GO:0046511]; sphingolipid biosynthetic process [GO:0030148]; sphingolipid metabolic process [GO:0006665]; sphingomyelin biosynthetic process [GO:0006686]; sphingosine biosynthetic process [GO:0046512]	pyridoxal phosphate binding [GO:0030170]; serine C-palmitoyltransferase activity [GO:0004758]	GO:0004758; GO:0005783; GO:0005789; GO:0006665; GO:0006686; GO:0016021; GO:0017059; GO:0030148; GO:0030170; GO:0035339; GO:0046511; GO:0046512; GO:0046513; GO:1904504; GO:1904649	AAALASLKKYGVGTCGPR	1.005	11.3934	11.4886	11.3378	10.8544	10.7735	0	11.7932	12.2706	11.7359	12.153	11.1976	12.0195	12.5846	0	12.0265
B6DP74	B6DP74_HUMAN	Estrogen receptor alpha splice variant	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	GYHYGVWSCEGCKAFFKR	0.32192	0	11.0037	13.2588	0	0	12.4974	12.9162	10.22	13.6167	11.0895	11.9934	13.2464	13.7779	13.925	13.8225
B7Z1Y7	B7Z1Y7_HUMAN	"cDNA FLJ50466, highly similar to DNA (cytosine-5)-methyltransferase-like protein 2"		Homo sapiens (Human)	methylation [GO:0032259]		methyltransferase activity [GO:0008168]; methylation [GO:0032259]	methyltransferase activity [GO:0008168]	GO:0008168; GO:0032259	DAILFKLETAEEIHR	0.91582	13.2887	12.1853	10.6237	0	0	8.81554	10.7956	11.0092	12.0033	12.0925	12.3341	11.3793	12.192	12.3672	11.9098
A8K0N1	A8K0N1_HUMAN	"cDNA FLJ78226, highly similar to Homo sapiens serum/glucocorticoid regulated kinase 2 (SGK2), transcript variant 1, mRNA"		Homo sapiens (Human)	protein phosphorylation [GO:0006468]		ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]; protein phosphorylation [GO:0006468]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	GO:0004674; GO:0005524; GO:0006468	ANGNINLGPSANPNAQPTDFDFLK	0.9455	13.9247	0	10.9858	11.0286	12.0847	10.8847	9.58389	0	11.0817	11.036	12.1687	12.0999	11.8191	12.517	10.5264
B4DFG6	B4DFG6_HUMAN	"cDNA FLJ54285, highly similar to 28S ribosomal protein S18b, mitochondrial"		Homo sapiens (Human)	mitochondrial translation [GO:0032543]	mitochondrion [GO:0005739]; ribosome [GO:0005840]	mitochondrion [GO:0005739]; ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; mitochondrial translation [GO:0032543]	structural constituent of ribosome [GO:0003735]	GO:0003735; GO:0005739; GO:0005840; GO:0032543	AASVLNTVLRR	0.98536	12.2724	0	9.72853	11.6194	11.7117	11.9845	13.0622	12.0888	10.5762	15.2287	12.6861	14.1876	14.3171	0	0
B4DFI7	B4DFI7_HUMAN	"Hydroxyacid-oxoacid transhydrogenase, mitochondrial (Alcohol dehydrogenase iron-containing protein 1)"	ADHFE1	Homo sapiens (Human)			metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]	metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]	GO:0016491; GO:0046872	AACQCPTHSHTYSQAPGLSPSGK	0.62389	10.7336	8.90292	10.2118	0	9.38027	9.33771	10.534	11.2976	10.6598	12.1306	13.1949	11.1212	9.57321	11.855	9.66493
Q8IV08	PLD3_HUMAN	5'-3' exonuclease PLD3 (EC 3.1.16.1) (Choline phosphatase 3) (HindIII K4L homolog) (Hu-K4) (Phosphatidylcholine-hydrolyzing phospholipase D3) (Phospholipase D3) (PLD 3)	PLD3	Homo sapiens (Human)	immune system process [GO:0002376]; inflammatory response [GO:0006954]; myotube differentiation [GO:0014902]; regulation of cytokine production involved in inflammatory response [GO:1900015]	early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; extracellular exosome [GO:0070062]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; late endosome membrane [GO:0031902]; lysosomal lumen [GO:0043202]; lysosomal membrane [GO:0005765]	early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; extracellular exosome [GO:0070062]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; late endosome membrane [GO:0031902]; lysosomal lumen [GO:0043202]; lysosomal membrane [GO:0005765]; phospholipase D activity [GO:0004630]; single-stranded DNA 5'-3' exodeoxyribonuclease activity [GO:0045145]; immune system process [GO:0002376]; inflammatory response [GO:0006954]; myotube differentiation [GO:0014902]; regulation of cytokine production involved in inflammatory response [GO:1900015]	phospholipase D activity [GO:0004630]; single-stranded DNA 5'-3' exodeoxyribonuclease activity [GO:0045145]	GO:0000139; GO:0002376; GO:0004630; GO:0005765; GO:0005789; GO:0006954; GO:0014902; GO:0016021; GO:0031901; GO:0031902; GO:0043202; GO:0045145; GO:0070062; GO:1900015	AFLLSLAALRDNHTHSDIQVK	0.92566	14.0876	11.9642	11.4635	12.7441	10.8619	12.5456	11.5911	0	0	10.4897	0	10.3352	14.1841	13.92	13.9878
Q9UHG2	PCS1N_HUMAN	ProSAAS (Proprotein convertase subtilisin/kexin type 1 inhibitor) (Proprotein convertase 1 inhibitor) (pro-SAAS) [Cleaved into: KEP; Big SAAS (b-SAAS); Little SAAS (l-SAAS) (N-proSAAS); Big PEN-LEN (b-PEN-LEN) (SAAS CT(1-49)); PEN; Little LEN (l-LEN); Big LEN (b-LEN) (SAAS CT(25-40))]	PCSK1N	Homo sapiens (Human)	neuropeptide signaling pathway [GO:0007218]; peptide hormone processing [GO:0016486]; response to cold [GO:0009409]; response to dietary excess [GO:0002021]	extracellular space [GO:0005615]; secretory granule [GO:0030141]; trans-Golgi network [GO:0005802]	extracellular space [GO:0005615]; secretory granule [GO:0030141]; trans-Golgi network [GO:0005802]; endopeptidase inhibitor activity [GO:0004866]; serine-type endopeptidase inhibitor activity [GO:0004867]; signaling receptor binding [GO:0005102]; neuropeptide signaling pathway [GO:0007218]; peptide hormone processing [GO:0016486]; response to cold [GO:0009409]; response to dietary excess [GO:0002021]	endopeptidase inhibitor activity [GO:0004866]; serine-type endopeptidase inhibitor activity [GO:0004867]; signaling receptor binding [GO:0005102]	GO:0002021; GO:0004866; GO:0004867; GO:0005102; GO:0005615; GO:0005802; GO:0007218; GO:0009409; GO:0016486; GO:0030141	AEAQEAEDQQAR	0.8972	12.4443	12.0652	10.1768	11.0912	0	0	12.3332	12.5269	9.42312	13.4795	14.4488	13.5448	13.2228	0	13.3877
A8K0M9	A8K0M9_HUMAN	Selenoprotein K	SELK hCG_1641209	Homo sapiens (Human)		endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]		GO:0005789; GO:0016021	GPPGNPPRRMGR	0.88889	11.0949	10.3882	10.4601	9.82447	10.1118	8.10439	9.47927	13.6436	11.4783	0	11.0765	10.3028	11.764	11.4426	8.95373
B4DFG9	B4DFG9_HUMAN	Zinc finger protein 330 (Nucleolar autoantigen 36)		Homo sapiens (Human)		"chromosome, centromeric region [GO:0000775]; nucleolus [GO:0005730]"	"chromosome, centromeric region [GO:0000775]; nucleolus [GO:0005730]; zinc ion binding [GO:0008270]"	zinc ion binding [GO:0008270]	GO:0000775; GO:0005730; GO:0008270	ACFCDDHTRSKVFK	0.93571	11.3071	13.7327	11.4529	9.84101	10.5025	10.9419	12.0366	11.1696	0	11.9982	10.8404	13.5241	9.53247	0	11.1416
Q15078	CD5R1_HUMAN	"Cyclin-dependent kinase 5 activator 1 (CDK5 activator 1) (Cyclin-dependent kinase 5 regulatory subunit 1) (TPKII regulatory subunit) [Cleaved into: Cyclin-dependent kinase 5 activator 1, p35 (p35); Cyclin-dependent kinase 5 activator 1, p25 (p25) (Tau protein kinase II 23 kDa subunit) (p23)]"	CDK5R1 CDK5R NCK5A	Homo sapiens (Human)	axon guidance [GO:0007411]; axonal fasciculation [GO:0007413]; brain development [GO:0007420]; cerebellum development [GO:0021549]; embryo development ending in birth or egg hatching [GO:0009792]; ephrin receptor signaling pathway [GO:0048013]; G protein-coupled acetylcholine receptor signaling pathway [GO:0007213]; G1 to G0 transition involved in cell differentiation [GO:0070315]; hippocampus development [GO:0021766]; ionotropic glutamate receptor signaling pathway [GO:0035235]; layer formation in cerebral cortex [GO:0021819]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of DNA-templated transcription [GO:0045892]; neuron cell-cell adhesion [GO:0007158]; neuron differentiation [GO:0030182]; neuron migration [GO:0001764]; neuron projection development [GO:0031175]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of MHC class II biosynthetic process [GO:0045348]; positive regulation of microtubule polymerization [GO:0031116]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of protein targeting to membrane [GO:0090314]; positive regulation of signaling receptor activity [GO:2000273]; regulation of actin cytoskeleton organization [GO:0032956]; regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]; regulation of dendritic spine morphogenesis [GO:0061001]; regulation of macroautophagy [GO:0016241]; regulation of neuron differentiation [GO:0045664]; regulation of synaptic vesicle cycle [GO:0098693]; rhythmic process [GO:0048511]; serine phosphorylation of STAT protein [GO:0042501]; superior olivary nucleus maturation [GO:0021722]	axon [GO:0030424]; contractile fiber [GO:0043292]; cyclin-dependent protein kinase holoenzyme complex [GO:0000307]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendritic spine [GO:0043197]; growth cone [GO:0030426]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; neuromuscular junction [GO:0031594]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; presynapse [GO:0098793]; protein kinase 5 complex [GO:0016533]	axon [GO:0030424]; contractile fiber [GO:0043292]; cyclin-dependent protein kinase holoenzyme complex [GO:0000307]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendritic spine [GO:0043197]; growth cone [GO:0030426]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; neuromuscular junction [GO:0031594]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; presynapse [GO:0098793]; protein kinase 5 complex [GO:0016533]; actin filament binding [GO:0051015]; alpha-tubulin binding [GO:0043014]; beta-tubulin binding [GO:0048487]; cadherin binding [GO:0045296]; calcium ion binding [GO:0005509]; cyclin-dependent protein serine/threonine kinase activator activity [GO:0061575]; ephrin receptor binding [GO:0046875]; ionotropic glutamate receptor binding [GO:0035255]; kinase activity [GO:0016301]; protease binding [GO:0002020]; protein kinase activator activity [GO:0030295]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine/threonine kinase activator activity [GO:0043539]; axon guidance [GO:0007411]; axonal fasciculation [GO:0007413]; brain development [GO:0007420]; cerebellum development [GO:0021549]; embryo development ending in birth or egg hatching [GO:0009792]; ephrin receptor signaling pathway [GO:0048013]; G protein-coupled acetylcholine receptor signaling pathway [GO:0007213]; G1 to G0 transition involved in cell differentiation [GO:0070315]; hippocampus development [GO:0021766]; ionotropic glutamate receptor signaling pathway [GO:0035235]; layer formation in cerebral cortex [GO:0021819]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of DNA-templated transcription [GO:0045892]; neuron cell-cell adhesion [GO:0007158]; neuron differentiation [GO:0030182]; neuron migration [GO:0001764]; neuron projection development [GO:0031175]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of MHC class II biosynthetic process [GO:0045348]; positive regulation of microtubule polymerization [GO:0031116]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of protein targeting to membrane [GO:0090314]; positive regulation of signaling receptor activity [GO:2000273]; regulation of actin cytoskeleton organization [GO:0032956]; regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]; regulation of dendritic spine morphogenesis [GO:0061001]; regulation of macroautophagy [GO:0016241]; regulation of neuron differentiation [GO:0045664]; regulation of synaptic vesicle cycle [GO:0098693]; rhythmic process [GO:0048511]; serine phosphorylation of STAT protein [GO:0042501]; superior olivary nucleus maturation [GO:0021722]	actin filament binding [GO:0051015]; alpha-tubulin binding [GO:0043014]; beta-tubulin binding [GO:0048487]; cadherin binding [GO:0045296]; calcium ion binding [GO:0005509]; cyclin-dependent protein serine/threonine kinase activator activity [GO:0061575]; ephrin receptor binding [GO:0046875]; ionotropic glutamate receptor binding [GO:0035255]; kinase activity [GO:0016301]; protease binding [GO:0002020]; protein kinase activator activity [GO:0030295]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine/threonine kinase activator activity [GO:0043539]	GO:0000079; GO:0000226; GO:0000307; GO:0001764; GO:0002020; GO:0004672; GO:0005509; GO:0005634; GO:0005654; GO:0005737; GO:0005829; GO:0005886; GO:0007158; GO:0007213; GO:0007411; GO:0007413; GO:0007420; GO:0009792; GO:0014069; GO:0016020; GO:0016241; GO:0016301; GO:0016533; GO:0018105; GO:0018107; GO:0019901; GO:0021549; GO:0021722; GO:0021766; GO:0021819; GO:0030182; GO:0030295; GO:0030424; GO:0030425; GO:0030426; GO:0031116; GO:0031175; GO:0031594; GO:0032956; GO:0035235; GO:0035255; GO:0042501; GO:0043005; GO:0043014; GO:0043025; GO:0043197; GO:0043204; GO:0043231; GO:0043292; GO:0043525; GO:0043539; GO:0045296; GO:0045348; GO:0045664; GO:0045892; GO:0046875; GO:0048013; GO:0048471; GO:0048487; GO:0048511; GO:0051015; GO:0061001; GO:0061575; GO:0070315; GO:0090314; GO:0098693; GO:0098793; GO:2000273	APHPAVTSAGTPK	0.84615	9.74844	9.30118	10.3104	8.85184	8.78702	0	10.898	10.6749	13.3911	11.4979	10.9659	10.8186	11.3728	10.4918	9.8921
Q92575	UBXN4_HUMAN	UBX domain-containing protein 4 (Erasin) (UBX domain-containing protein 2)	UBXN4 KIAA0242 UBXD2 UBXDC1	Homo sapiens (Human)	response to unfolded protein [GO:0006986]; ubiquitin-dependent ERAD pathway [GO:0030433]	cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; nuclear envelope [GO:0005635]	cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; nuclear envelope [GO:0005635]; response to unfolded protein [GO:0006986]; ubiquitin-dependent ERAD pathway [GO:0030433]		GO:0005635; GO:0005783; GO:0005789; GO:0005829; GO:0006986; GO:0030433	AAALLAKQAEMEVK	1.0016	11.4121	13.1627	13.4014	0	0	0	10.9239	8.57285	11.617	13.7353	13.7078	12.559	12.7959	13.4986	11.2248
O00189	AP4M1_HUMAN	AP-4 complex subunit mu-1 (AP-4 adaptor complex mu subunit) (Adaptor-related protein complex 4 subunit mu-1) (Mu subunit of AP-4) (Mu-adaptin-related protein 2) (mu-ARP2) (Mu4-adaptin) (mu4)	AP4M1 MUARP2	Homo sapiens (Human)	autophagosome assembly [GO:0000045]; Golgi to endosome transport [GO:0006895]; Golgi to lysosome transport [GO:0090160]; intracellular protein transport [GO:0006886]; post-Golgi vesicle-mediated transport [GO:0006892]; protein localization [GO:0008104]; protein localization to basolateral plasma membrane [GO:1903361]; protein targeting [GO:0006605]; protein targeting to lysosome [GO:0006622]; vesicle-mediated transport [GO:0016192]	AP-4 adaptor complex [GO:0030124]; clathrin adaptor complex [GO:0030131]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; early endosome [GO:0005769]; endosome lumen [GO:0031904]; extracellular exosome [GO:0070062]; trans-Golgi network [GO:0005802]; trans-Golgi network membrane [GO:0032588]	AP-4 adaptor complex [GO:0030124]; clathrin adaptor complex [GO:0030131]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; early endosome [GO:0005769]; endosome lumen [GO:0031904]; extracellular exosome [GO:0070062]; trans-Golgi network [GO:0005802]; trans-Golgi network membrane [GO:0032588]; protein domain specific binding [GO:0019904]; protein transmembrane transporter activity [GO:0008320]; autophagosome assembly [GO:0000045]; Golgi to endosome transport [GO:0006895]; Golgi to lysosome transport [GO:0090160]; intracellular protein transport [GO:0006886]; post-Golgi vesicle-mediated transport [GO:0006892]; protein localization [GO:0008104]; protein localization to basolateral plasma membrane [GO:1903361]; protein targeting [GO:0006605]; protein targeting to lysosome [GO:0006622]; vesicle-mediated transport [GO:0016192]	protein domain specific binding [GO:0019904]; protein transmembrane transporter activity [GO:0008320]	GO:0000045; GO:0005769; GO:0005802; GO:0005829; GO:0006605; GO:0006622; GO:0006886; GO:0006892; GO:0006895; GO:0008104; GO:0008320; GO:0016192; GO:0019904; GO:0030124; GO:0030131; GO:0031410; GO:0031904; GO:0032588; GO:0070062; GO:0090160; GO:1903361	AELAEGALR	0.92051	0	12.8863	0	13.6129	13.2124	13.0039	13.8337	10.3865	10.1241	11.386	0	11.7299	12.278	11.7328	10.5166
B4DFE8	B4DFE8_HUMAN	Creatine kinase (EC 2.7.3.2)		Homo sapiens (Human)	phosphocreatine biosynthetic process [GO:0046314]; phosphorylation [GO:0016310]		ATP binding [GO:0005524]; creatine kinase activity [GO:0004111]; phosphocreatine biosynthetic process [GO:0046314]; phosphorylation [GO:0016310]	ATP binding [GO:0005524]; creatine kinase activity [GO:0004111]	GO:0004111; GO:0005524; GO:0016310; GO:0046314	AERREVER	0.64435	10.9732	10.6038	13.8737	0	0	11.3687	11.586	11.781	12.24	12.7642	12.4691	13.2856	11.4529	11.7008	0
Q6ZWE5	Q6ZWE5_HUMAN	"Monocarboxylate transporter 14 (cDNA FLJ41213 fis, clone BRALZ2016085, weakly similar to MONOCARBOXYLATE TRANSPORTER 3)"	SLC16A14	Homo sapiens (Human)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	GO:0016021; GO:0022857	AQSACTYGALCYK	0.92268	12.0509	11.6468	11.7786	0	11.1822	0	12.7072	12.9537	11.4447	8.75064	11.65	10.4456	8.80697	9.67197	10.8744
P17174	AATC_HUMAN	"Aspartate aminotransferase, cytoplasmic (cAspAT) (EC 2.6.1.1) (EC 2.6.1.3) (Cysteine aminotransferase, cytoplasmic) (Cysteine transaminase, cytoplasmic) (cCAT) (Glutamate oxaloacetate transaminase 1) (Transaminase A)"	GOT1	Homo sapiens (Human)	2-oxoglutarate metabolic process [GO:0006103]; aspartate biosynthetic process [GO:0006532]; aspartate catabolic process [GO:0006533]; aspartate metabolic process [GO:0006531]; cellular response to insulin stimulus [GO:0032869]; fatty acid homeostasis [GO:0055089]; glutamate catabolic process to 2-oxoglutarate [GO:0019551]; glutamate catabolic process to aspartate [GO:0019550]; glutamate metabolic process [GO:0006536]; glycerol biosynthetic process [GO:0006114]; Notch signaling pathway [GO:0007219]; oxaloacetate metabolic process [GO:0006107]; response to glucocorticoid [GO:0051384]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; L-aspartate:2-oxoglutarate aminotransferase activity [GO:0004069]; L-cysteine transaminase activity [GO:0047801]; phosphatidylserine decarboxylase activity [GO:0004609]; pyridoxal phosphate binding [GO:0030170]; 2-oxoglutarate metabolic process [GO:0006103]; aspartate biosynthetic process [GO:0006532]; aspartate catabolic process [GO:0006533]; aspartate metabolic process [GO:0006531]; cellular response to insulin stimulus [GO:0032869]; fatty acid homeostasis [GO:0055089]; glutamate catabolic process to 2-oxoglutarate [GO:0019551]; glutamate catabolic process to aspartate [GO:0019550]; glutamate metabolic process [GO:0006536]; glycerol biosynthetic process [GO:0006114]; Notch signaling pathway [GO:0007219]; oxaloacetate metabolic process [GO:0006107]; response to glucocorticoid [GO:0051384]	L-aspartate:2-oxoglutarate aminotransferase activity [GO:0004069]; L-cysteine transaminase activity [GO:0047801]; phosphatidylserine decarboxylase activity [GO:0004609]; pyridoxal phosphate binding [GO:0030170]	GO:0004069; GO:0004609; GO:0005634; GO:0005654; GO:0005737; GO:0005829; GO:0006103; GO:0006107; GO:0006114; GO:0006531; GO:0006532; GO:0006533; GO:0006536; GO:0007219; GO:0019550; GO:0019551; GO:0030170; GO:0032869; GO:0047801; GO:0051384; GO:0055089; GO:0070062	DIRSYRYWDAEK	0.43452	12.9014	10.4503	13.0584	12.8222	0	13.522	12.3264	11.7875	13.2565	12.4818	0	9.67622	0	10.0403	10.7161
B4DFK2	B4DFK2_HUMAN	"cDNA FLJ50468, highly similar to Breast carcinoma amplified sequence 1"		Homo sapiens (Human)						AFLRQMTSDSTEK	0.61009	11.603	11.9763	12.1239	0	10.7358	10.6807	12.4202	11.6944	0	12.5501	12.4155	12.5126	0	12.5015	11.7537
B7Z1Y6	B7Z1Y6_HUMAN	"Contactin-associated protein-like 2 (cDNA FLJ53861, highly similar to Contactin-associated protein-like 2)"	CNTNAP2	Homo sapiens (Human)	protein localization to juxtaparanode region of axon [GO:0071205]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; protein localization to juxtaparanode region of axon [GO:0071205]		GO:0016021; GO:0071205	DVGAFFEEGMWLR	0.256	0	11.0945	12.4877	11.0016	13.5078	10.9867	10.9241	13.2029	9.39849	13.3737	11.2527	13.5732	0	0	11.2347
O60259	KLK8_HUMAN	Kallikrein-8 (hK8) (EC 3.4.21.118) (Neuropsin) (NP) (Ovasin) (Serine protease 19) (Serine protease TADG-14) (Tumor-associated differentially expressed gene 14 protein)	KLK8 NRPN PRSS19 TADG14 UNQ283/PRO322	Homo sapiens (Human)	cell death [GO:0008219]; keratinocyte proliferation [GO:0043616]; memory [GO:0007613]; negative regulation of axon regeneration [GO:0048681]; negative regulation of myelination [GO:0031642]; neuron projection morphogenesis [GO:0048812]; proteolysis [GO:0006508]; regulation of synapse organization [GO:0050807]; response to wounding [GO:0009611]	cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; secretory granule [GO:0030141]; serine protease inhibitor complex [GO:0097180]	cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; secretory granule [GO:0030141]; serine protease inhibitor complex [GO:0097180]; serine-type endopeptidase activity [GO:0004252]; cell death [GO:0008219]; keratinocyte proliferation [GO:0043616]; memory [GO:0007613]; negative regulation of axon regeneration [GO:0048681]; negative regulation of myelination [GO:0031642]; neuron projection morphogenesis [GO:0048812]; proteolysis [GO:0006508]; regulation of synapse organization [GO:0050807]; response to wounding [GO:0009611]	serine-type endopeptidase activity [GO:0004252]	GO:0004252; GO:0005576; GO:0005615; GO:0005737; GO:0006508; GO:0007613; GO:0008219; GO:0009611; GO:0030141; GO:0031642; GO:0043616; GO:0048681; GO:0048812; GO:0050807; GO:0097180	CEDAYPGQITDGMVCAGSSK	0.93143	9.282	9.2441	8.8695	0	10.7708	8.8577	12.2578	12.946	0	13.6202	9.42419	10.7445	11.6392	10.9331	12.9301
Q9HA72	CAHM2_HUMAN	Calcium homeostasis modulator protein 2 (Protein FAM26B)	CALHM2 FAM26B	Homo sapiens (Human)	positive regulation of apoptotic process [GO:0043065]	integral component of plasma membrane [GO:0005887]	integral component of plasma membrane [GO:0005887]; cation channel activity [GO:0005261]; positive regulation of apoptotic process [GO:0043065]	cation channel activity [GO:0005261]	GO:0005261; GO:0005887; GO:0043065	AALIAENFR	0.91337	10.3317	10.5653	10.2748	0	9.28723	0	9.2076	10.9144	12.0255	11.9286	11.5417	12.2127	10.8195	11.2002	9.73427
B7Z1Z6	B7Z1Z6_HUMAN	"cDNA FLJ58056, highly similar to Calcium/calmodulin-dependent protein kinase type II beta chain"		Homo sapiens (Human)	protein phosphorylation [GO:0006468]		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein phosphorylation [GO:0006468]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	GO:0004672; GO:0005524; GO:0006468	ADGVKPQTNSTKNSAAATSPK	0.15534	11.3383	11.4006	9.33195	0	0	10.8022	10.3525	9.22781	10.4078	10.7514	11.9676	12.1365	11.1625	9.71949	11.3374
P05231	IL6_HUMAN	Interleukin-6 (IL-6) (B-cell stimulatory factor 2) (BSF-2) (CTL differentiation factor) (CDF) (Hybridoma growth factor) (Interferon beta-2) (IFN-beta-2)	IL6 IFNB2	Homo sapiens (Human)	acute-phase response [GO:0006953]; cellular response to hydrogen peroxide [GO:0070301]; cellular response to lipopolysaccharide [GO:0071222]; cellular response to virus [GO:0098586]; cytokine-mediated signaling pathway [GO:0019221]; defense response to Gram-negative bacterium [GO:0050829]; defense response to Gram-positive bacterium [GO:0050830]; defense response to virus [GO:0051607]; endocrine pancreas development [GO:0031018]; germinal center B cell differentiation [GO:0002314]; glucagon secretion [GO:0070091]; glucose homeostasis [GO:0042593]; hepatic immune response [GO:0002384]; hepatocyte proliferation [GO:0072574]; humoral immune response [GO:0006959]; inflammatory response [GO:0006954]; interleukin-6-mediated signaling pathway [GO:0070102]; liver regeneration [GO:0097421]; maintenance of blood-brain barrier [GO:0035633]; monocyte chemotaxis [GO:0002548]; negative regulation of apoptotic process [GO:0043066]; negative regulation of bone resorption [GO:0045779]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of chemokine production [GO:0032682]; negative regulation of collagen biosynthetic process [GO:0032966]; negative regulation of fat cell differentiation [GO:0045599]; negative regulation of interleukin-1-mediated signaling pathway [GO:2000660]; negative regulation of lipid storage [GO:0010888]; negative regulation of neurogenesis [GO:0050768]; negative regulation of primary miRNA processing [GO:2000635]; neuron cellular homeostasis [GO:0070050]; neuron projection development [GO:0031175]; neutrophil apoptotic process [GO:0001781]; neutrophil mediated immunity [GO:0002446]; platelet activation [GO:0030168]; positive regulation of acute inflammatory response [GO:0002675]; positive regulation of apoptotic DNA fragmentation [GO:1902512]; positive regulation of apoptotic process [GO:0043065]; positive regulation of B cell activation [GO:0050871]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of chemokine production [GO:0032722]; positive regulation of cytokine production involved in inflammatory response [GO:1900017]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of epithelial to mesenchymal transition [GO:0010718]; positive regulation of extracellular matrix disassembly [GO:0090091]; positive regulation of gene expression [GO:0010628]; positive regulation of glial cell proliferation [GO:0060252]; positive regulation of immunoglobulin production [GO:0002639]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-10 production [GO:0032733]; positive regulation of interleukin-17 production [GO:0032740]; positive regulation of interleukin-21 production [GO:0032745]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of leukocyte adhesion to vascular endothelial cell [GO:1904996]; positive regulation of leukocyte chemotaxis [GO:0002690]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of miRNA maturation [GO:1903800]; positive regulation of neuroinflammatory response [GO:0150078]; positive regulation of osteoblast differentiation [GO:0045669]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of platelet aggregation [GO:1901731]; positive regulation of receptor signaling pathway via JAK-STAT [GO:0046427]; positive regulation of receptor signaling pathway via STAT [GO:1904894]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of T cell proliferation [GO:0042102]; positive regulation of T-helper 2 cell cytokine production [GO:2000553]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of translation [GO:0045727]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of type B pancreatic cell apoptotic process [GO:2000676]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]; positive regulation of vascular endothelial growth factor production [GO:0010575]; regulation of angiogenesis [GO:0045765]; regulation of astrocyte activation [GO:0061888]; regulation of glucagon secretion [GO:0070092]; regulation of insulin secretion [GO:0050796]; regulation of microglial cell activation [GO:1903978]; regulation of neuroinflammatory response [GO:0150077]; regulation of vascular endothelial growth factor production [GO:0010574]; response to activity [GO:0014823]; response to glucocorticoid [GO:0051384]; response to peptidoglycan [GO:0032494]; T follicular helper cell differentiation [GO:0061470]; T-helper 17 cell lineage commitment [GO:0072540]; vascular endothelial growth factor production [GO:0010573]	endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; interleukin-6 receptor complex [GO:0005896]	endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; interleukin-6 receptor complex [GO:0005896]; cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; interleukin-6 receptor binding [GO:0005138]; acute-phase response [GO:0006953]; cellular response to hydrogen peroxide [GO:0070301]; cellular response to lipopolysaccharide [GO:0071222]; cellular response to virus [GO:0098586]; cytokine-mediated signaling pathway [GO:0019221]; defense response to Gram-negative bacterium [GO:0050829]; defense response to Gram-positive bacterium [GO:0050830]; defense response to virus [GO:0051607]; endocrine pancreas development [GO:0031018]; germinal center B cell differentiation [GO:0002314]; glucagon secretion [GO:0070091]; glucose homeostasis [GO:0042593]; hepatic immune response [GO:0002384]; hepatocyte proliferation [GO:0072574]; humoral immune response [GO:0006959]; inflammatory response [GO:0006954]; interleukin-6-mediated signaling pathway [GO:0070102]; liver regeneration [GO:0097421]; maintenance of blood-brain barrier [GO:0035633]; monocyte chemotaxis [GO:0002548]; negative regulation of apoptotic process [GO:0043066]; negative regulation of bone resorption [GO:0045779]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of chemokine production [GO:0032682]; negative regulation of collagen biosynthetic process [GO:0032966]; negative regulation of fat cell differentiation [GO:0045599]; negative regulation of interleukin-1-mediated signaling pathway [GO:2000660]; negative regulation of lipid storage [GO:0010888]; negative regulation of neurogenesis [GO:0050768]; negative regulation of primary miRNA processing [GO:2000635]; neuron cellular homeostasis [GO:0070050]; neuron projection development [GO:0031175]; neutrophil apoptotic process [GO:0001781]; neutrophil mediated immunity [GO:0002446]; platelet activation [GO:0030168]; positive regulation of acute inflammatory response [GO:0002675]; positive regulation of apoptotic DNA fragmentation [GO:1902512]; positive regulation of apoptotic process [GO:0043065]; positive regulation of B cell activation [GO:0050871]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of chemokine production [GO:0032722]; positive regulation of cytokine production involved in inflammatory response [GO:1900017]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of epithelial to mesenchymal transition [GO:0010718]; positive regulation of extracellular matrix disassembly [GO:0090091]; positive regulation of gene expression [GO:0010628]; positive regulation of glial cell proliferation [GO:0060252]; positive regulation of immunoglobulin production [GO:0002639]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-10 production [GO:0032733]; positive regulation of interleukin-17 production [GO:0032740]; positive regulation of interleukin-21 production [GO:0032745]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of leukocyte adhesion to vascular endothelial cell [GO:1904996]; positive regulation of leukocyte chemotaxis [GO:0002690]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of miRNA maturation [GO:1903800]; positive regulation of neuroinflammatory response [GO:0150078]; positive regulation of osteoblast differentiation [GO:0045669]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of platelet aggregation [GO:1901731]; positive regulation of receptor signaling pathway via JAK-STAT [GO:0046427]; positive regulation of receptor signaling pathway via STAT [GO:1904894]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of T cell proliferation [GO:0042102]; positive regulation of T-helper 2 cell cytokine production [GO:2000553]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of translation [GO:0045727]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of type B pancreatic cell apoptotic process [GO:2000676]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]; positive regulation of vascular endothelial growth factor production [GO:0010575]; regulation of angiogenesis [GO:0045765]; regulation of astrocyte activation [GO:0061888]; regulation of glucagon secretion [GO:0070092]; regulation of insulin secretion [GO:0050796]; regulation of microglial cell activation [GO:1903978]; regulation of neuroinflammatory response [GO:0150077]; regulation of vascular endothelial growth factor production [GO:0010574]; response to activity [GO:0014823]; response to glucocorticoid [GO:0051384]; response to peptidoglycan [GO:0032494]; T follicular helper cell differentiation [GO:0061470]; T-helper 17 cell lineage commitment [GO:0072540]; vascular endothelial growth factor production [GO:0010573]	cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; interleukin-6 receptor binding [GO:0005138]	GO:0001781; GO:0002314; GO:0002384; GO:0002446; GO:0002548; GO:0002639; GO:0002675; GO:0002690; GO:0005125; GO:0005138; GO:0005576; GO:0005615; GO:0005788; GO:0005896; GO:0006953; GO:0006954; GO:0006959; GO:0008083; GO:0008284; GO:0008285; GO:0010573; GO:0010574; GO:0010575; GO:0010628; GO:0010718; GO:0010888; GO:0014823; GO:0019221; GO:0030168; GO:0031018; GO:0031175; GO:0032494; GO:0032682; GO:0032722; GO:0032731; GO:0032733; GO:0032740; GO:0032745; GO:0032755; GO:0032757; GO:0032760; GO:0032966; GO:0033138; GO:0035633; GO:0042102; GO:0042531; GO:0042593; GO:0043065; GO:0043066; GO:0043410; GO:0045599; GO:0045669; GO:0045727; GO:0045765; GO:0045779; GO:0045893; GO:0045944; GO:0046427; GO:0048661; GO:0050731; GO:0050768; GO:0050796; GO:0050829; GO:0050830; GO:0050871; GO:0051091; GO:0051384; GO:0051607; GO:0060252; GO:0061470; GO:0061888; GO:0070050; GO:0070091; GO:0070092; GO:0070102; GO:0070301; GO:0071222; GO:0072540; GO:0072574; GO:0090091; GO:0097421; GO:0098586; GO:0150077; GO:0150078; GO:1900017; GO:1901731; GO:1902512; GO:1903800; GO:1903978; GO:1904894; GO:1904996; GO:2000553; GO:2000635; GO:2000660; GO:2000676	AVQMSTK	0.94415	12.5995	11.229	12.2982	0	9.35286	0	11.2201	11.1035	0	12.5188	11.9163	12.7699	11.2973	12.374	11.1695
P55008	AIF1_HUMAN	Allograft inflammatory factor 1 (AIF-1) (Ionized calcium-binding adapter molecule 1) (Protein G1)	AIF1 G1 IBA1	Homo sapiens (Human)	"actin crosslink formation [GO:0051764]; actin filament bundle assembly [GO:0051017]; actin filament polymerization [GO:0030041]; cellular response to extracellular stimulus [GO:0031668]; cellular response to hormone stimulus [GO:0032870]; cellular response to hydroperoxide [GO:0071447]; cellular response to interferon-gamma [GO:0071346]; cellular response to morphine [GO:0071315]; cellular response to oxidative stress [GO:0034599]; cerebellum development [GO:0021549]; inflammatory response [GO:0006954]; microglial cell activation [GO:0001774]; negative regulation of apoptotic process [GO:0043066]; negative regulation of gene expression [GO:0010629]; negative regulation of smooth muscle cell chemotaxis [GO:0071672]; negative regulation of smooth muscle cell proliferation [GO:0048662]; parallel actin filament bundle assembly [GO:0030046]; phagocytosis, engulfment [GO:0006911]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of chemokine production [GO:0032722]; positive regulation of chemotaxis [GO:0050921]; positive regulation of fibroblast growth factor production [GO:0090271]; positive regulation of G1/S transition of mitotic cell cycle [GO:1900087]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of monocyte chemotaxis [GO:0090026]; positive regulation of mononuclear cell migration [GO:0071677]; positive regulation of muscle hyperplasia [GO:0014739]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of smooth muscle cell chemotaxis [GO:0071673]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of T cell migration [GO:2000406]; positive regulation of T cell proliferation [GO:0042102]; Rac protein signal transduction [GO:0016601]; regulation of gene expression [GO:0010468]; response to axon injury [GO:0048678]; response to electrical stimulus [GO:0051602]; response to glucocorticoid [GO:0051384]; ruffle assembly [GO:0097178]"	actin filament [GO:0005884]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; glial cell projection [GO:0097386]; lamellipodium [GO:0030027]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; phagocytic cup [GO:0001891]; ruffle [GO:0001726]; ruffle membrane [GO:0032587]	"actin filament [GO:0005884]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; glial cell projection [GO:0097386]; lamellipodium [GO:0030027]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; phagocytic cup [GO:0001891]; ruffle [GO:0001726]; ruffle membrane [GO:0032587]; actin filament binding [GO:0051015]; calcium ion binding [GO:0005509]; actin crosslink formation [GO:0051764]; actin filament bundle assembly [GO:0051017]; actin filament polymerization [GO:0030041]; cellular response to extracellular stimulus [GO:0031668]; cellular response to hormone stimulus [GO:0032870]; cellular response to hydroperoxide [GO:0071447]; cellular response to interferon-gamma [GO:0071346]; cellular response to morphine [GO:0071315]; cellular response to oxidative stress [GO:0034599]; cerebellum development [GO:0021549]; inflammatory response [GO:0006954]; microglial cell activation [GO:0001774]; negative regulation of apoptotic process [GO:0043066]; negative regulation of gene expression [GO:0010629]; negative regulation of smooth muscle cell chemotaxis [GO:0071672]; negative regulation of smooth muscle cell proliferation [GO:0048662]; parallel actin filament bundle assembly [GO:0030046]; phagocytosis, engulfment [GO:0006911]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of chemokine production [GO:0032722]; positive regulation of chemotaxis [GO:0050921]; positive regulation of fibroblast growth factor production [GO:0090271]; positive regulation of G1/S transition of mitotic cell cycle [GO:1900087]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of monocyte chemotaxis [GO:0090026]; positive regulation of mononuclear cell migration [GO:0071677]; positive regulation of muscle hyperplasia [GO:0014739]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of smooth muscle cell chemotaxis [GO:0071673]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of T cell migration [GO:2000406]; positive regulation of T cell proliferation [GO:0042102]; Rac protein signal transduction [GO:0016601]; regulation of gene expression [GO:0010468]; response to axon injury [GO:0048678]; response to electrical stimulus [GO:0051602]; response to glucocorticoid [GO:0051384]; ruffle assembly [GO:0097178]"	actin filament binding [GO:0051015]; calcium ion binding [GO:0005509]	GO:0001726; GO:0001774; GO:0001891; GO:0001934; GO:0005509; GO:0005634; GO:0005737; GO:0005829; GO:0005884; GO:0006911; GO:0006954; GO:0008284; GO:0010468; GO:0010629; GO:0014739; GO:0016601; GO:0021549; GO:0030027; GO:0030041; GO:0030046; GO:0030335; GO:0031668; GO:0032587; GO:0032722; GO:0032755; GO:0032870; GO:0034599; GO:0042102; GO:0043066; GO:0043204; GO:0045429; GO:0048471; GO:0048661; GO:0048662; GO:0048678; GO:0050921; GO:0051015; GO:0051017; GO:0051384; GO:0051602; GO:0051764; GO:0071315; GO:0071346; GO:0071447; GO:0071672; GO:0071673; GO:0071677; GO:0090026; GO:0090271; GO:0097178; GO:0097386; GO:1900087; GO:2000406	AFGLLKAQQEER	0.98347	10.0921	10.1945	14.3061	0	10.6999	0	10.0046	8.95681	0	14.1918	12.7676	13.6354	13.1703	11.1667	10.4227
Q9H4Y5	GSTO2_HUMAN	Glutathione S-transferase omega-2 (GSTO-2) (EC 2.5.1.18) (Glutathione S-transferase omega 2-2) (GSTO 2-2) (Glutathione-dependent dehydroascorbate reductase) (EC 1.8.5.1) (Monomethylarsonic acid reductase) (MMA(V) reductase) (EC 1.20.4.2)	GSTO2	Homo sapiens (Human)	cellular response to arsenic-containing substance [GO:0071243]; glutathione metabolic process [GO:0006749]; L-ascorbic acid metabolic process [GO:0019852]; xenobiotic metabolic process [GO:0006805]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; glutathione dehydrogenase (ascorbate) activity [GO:0045174]; glutathione transferase activity [GO:0004364]; identical protein binding [GO:0042802]; methylarsonate reductase activity [GO:0050610]; oxidoreductase activity [GO:0016491]; cellular response to arsenic-containing substance [GO:0071243]; glutathione metabolic process [GO:0006749]; L-ascorbic acid metabolic process [GO:0019852]; xenobiotic metabolic process [GO:0006805]	glutathione dehydrogenase (ascorbate) activity [GO:0045174]; glutathione transferase activity [GO:0004364]; identical protein binding [GO:0042802]; methylarsonate reductase activity [GO:0050610]; oxidoreductase activity [GO:0016491]	GO:0004364; GO:0005737; GO:0005829; GO:0006749; GO:0006805; GO:0016491; GO:0019852; GO:0042802; GO:0045174; GO:0050610; GO:0070062; GO:0071243	CGRECTNLK	0.9877	12.5311	12.8004	11.2135	8.67002	0	0	11.3238	11.0296	8.99594	11.3293	12.3893	12.5632	8.84533	8.93967	8.84185
Q9NRA0	SPHK2_HUMAN	Sphingosine kinase 2 (SK 2) (SPK 2) (EC 2.7.1.91)	SPHK2 SK2	Homo sapiens (Human)	blood vessel development [GO:0001568]; brain development [GO:0007420]; cell population proliferation [GO:0008283]; cellular response to phorbol 13-acetate 12-myristate [GO:1904628]; epigenetic maintenance of chromatin in transcription-competent conformation [GO:0045815]; female pregnancy [GO:0007565]; histone H2A-K5 acetylation [GO:0043977]; histone H2B-K12 acetylation [GO:0043980]; negative regulation of cell growth [GO:0030308]; negative regulation of histone deacetylase activity [GO:1901726]; negative regulation of histone deacetylation [GO:0031064]; phosphorylation [GO:0016310]; positive regulation of apoptotic process [GO:0043065]; positive regulation of calcium ion import [GO:0090280]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of ceramide biosynthetic process [GO:2000304]; positive regulation of cytokine production involved in immune response [GO:0002720]; positive regulation of histone H3-K9 acetylation [GO:2000617]; positive regulation of interleukin-13 production [GO:0032736]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of mast cell activation involved in immune response [GO:0033008]; positive regulation of mast cell degranulation [GO:0043306]; positive regulation of protein kinase C signaling [GO:0090037]; positive regulation of tumor necrosis factor production [GO:0032760]; regulation of ATP biosynthetic process [GO:2001169]; regulation of cytochrome-c oxidase activity [GO:1904959]; regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043122]; regulation of reactive oxygen species biosynthetic process [GO:1903426]; sphinganine-1-phosphate biosynthetic process [GO:0006669]; sphingolipid biosynthetic process [GO:0030148]; sphingolipid metabolic process [GO:0006665]; sphingosine biosynthetic process [GO:0046512]; sphingosine metabolic process [GO:0006670]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; intracellular membrane-bounded organelle [GO:0043231]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleosome [GO:0000786]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; intracellular membrane-bounded organelle [GO:0043231]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleosome [GO:0000786]; nucleus [GO:0005634]; ATP binding [GO:0005524]; D-erythro-sphingosine kinase activity [GO:0017050]; histone binding [GO:0042393]; lipid kinase activity [GO:0001727]; small GTPase binding [GO:0031267]; sphinganine kinase activity [GO:0008481]; sphingosine-1-phosphate receptor activity [GO:0038036]; blood vessel development [GO:0001568]; brain development [GO:0007420]; cell population proliferation [GO:0008283]; cellular response to phorbol 13-acetate 12-myristate [GO:1904628]; epigenetic maintenance of chromatin in transcription-competent conformation [GO:0045815]; female pregnancy [GO:0007565]; histone H2A-K5 acetylation [GO:0043977]; histone H2B-K12 acetylation [GO:0043980]; negative regulation of cell growth [GO:0030308]; negative regulation of histone deacetylase activity [GO:1901726]; negative regulation of histone deacetylation [GO:0031064]; phosphorylation [GO:0016310]; positive regulation of apoptotic process [GO:0043065]; positive regulation of calcium ion import [GO:0090280]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of ceramide biosynthetic process [GO:2000304]; positive regulation of cytokine production involved in immune response [GO:0002720]; positive regulation of histone H3-K9 acetylation [GO:2000617]; positive regulation of interleukin-13 production [GO:0032736]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of mast cell activation involved in immune response [GO:0033008]; positive regulation of mast cell degranulation [GO:0043306]; positive regulation of protein kinase C signaling [GO:0090037]; positive regulation of tumor necrosis factor production [GO:0032760]; regulation of ATP biosynthetic process [GO:2001169]; regulation of cytochrome-c oxidase activity [GO:1904959]; regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043122]; regulation of reactive oxygen species biosynthetic process [GO:1903426]; sphinganine-1-phosphate biosynthetic process [GO:0006669]; sphingolipid biosynthetic process [GO:0030148]; sphingolipid metabolic process [GO:0006665]; sphingosine biosynthetic process [GO:0046512]; sphingosine metabolic process [GO:0006670]	ATP binding [GO:0005524]; D-erythro-sphingosine kinase activity [GO:0017050]; histone binding [GO:0042393]; lipid kinase activity [GO:0001727]; small GTPase binding [GO:0031267]; sphinganine kinase activity [GO:0008481]; sphingosine-1-phosphate receptor activity [GO:0038036]	GO:0000786; GO:0001568; GO:0001727; GO:0002720; GO:0005524; GO:0005634; GO:0005654; GO:0005737; GO:0005739; GO:0005743; GO:0005765; GO:0005783; GO:0005829; GO:0006665; GO:0006669; GO:0006670; GO:0007420; GO:0007565; GO:0008283; GO:0008284; GO:0008481; GO:0016020; GO:0016310; GO:0017050; GO:0030148; GO:0030308; GO:0031064; GO:0031267; GO:0032736; GO:0032755; GO:0032760; GO:0033008; GO:0038036; GO:0042393; GO:0043065; GO:0043122; GO:0043231; GO:0043306; GO:0043977; GO:0043980; GO:0045815; GO:0046512; GO:0090037; GO:0090280; GO:1901726; GO:1903426; GO:1904628; GO:1904959; GO:2000304; GO:2000617; GO:2001169	AALHSPVSEGAPVIPPSSGLPLPTPDAR	0.91349	10.8629	0	10.2664	0	9.13991	10.2003	10.4691	10.6307	11.2833	9.20792	10.276	10.8211	11.3632	12.0458	12.3263
Q8N9Q2	SR1IP_HUMAN	Protein SREK1IP1 (SFRS12-interacting protein 1) (SREK1-interacting protein 1) (Splicing regulatory protein of 18 kDa) (p18SRP)	SREK1IP1 P18SRP SFRS12IP1	Homo sapiens (Human)	mRNA processing [GO:0006397]; RNA splicing [GO:0008380]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	GO:0003676; GO:0006397; GO:0008270; GO:0008380	AGCKKCGYPGHLTFECR	0.89412	8.62644	12.5114	12.7578	10.223	9.58737	0	9.8546	12.5394	12.4784	11.5361	0	13.4062	10.854	12.1347	0
O96009	NAPSA_HUMAN	Napsin-A (EC 3.4.23.-) (Aspartyl protease 4) (ASP4) (Asp 4) (Napsin-1) (TA01/TA02)	NAPSA NAP1 NAPA	Homo sapiens (Human)	membrane protein proteolysis [GO:0033619]; proteolysis [GO:0006508]; surfactant homeostasis [GO:0043129]	alveolar lamellar body [GO:0097208]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; lysosome [GO:0005764]; multivesicular body lumen [GO:0097486]	alveolar lamellar body [GO:0097208]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; lysosome [GO:0005764]; multivesicular body lumen [GO:0097486]; aspartic-type endopeptidase activity [GO:0004190]; endopeptidase activity [GO:0004175]; peptidase activity [GO:0008233]; membrane protein proteolysis [GO:0033619]; proteolysis [GO:0006508]; surfactant homeostasis [GO:0043129]	aspartic-type endopeptidase activity [GO:0004190]; endopeptidase activity [GO:0004175]; peptidase activity [GO:0008233]	GO:0004175; GO:0004190; GO:0005615; GO:0005764; GO:0006508; GO:0008233; GO:0033619; GO:0043129; GO:0070062; GO:0097208; GO:0097486	ARTRGADLGWGETAQAQFPG	0.9418	11.6032	12.5121	13.1108	11.1942	0	0	0	9.60452	11.4663	11.206	9.6301	12.0093	12.1454	11.9907	9.73911
B4DFH3	B4DFH3_HUMAN	Inorganic diphosphatase (EC 3.6.1.1)		Homo sapiens (Human)	phosphate-containing compound metabolic process [GO:0006796]	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; inorganic diphosphate phosphatase activity [GO:0004427]; magnesium ion binding [GO:0000287]; phosphate-containing compound metabolic process [GO:0006796]	inorganic diphosphate phosphatase activity [GO:0004427]; magnesium ion binding [GO:0000287]	GO:0000287; GO:0004427; GO:0005737; GO:0006796	DGKLRYVANIFPYK	0.62661	10.8074	10.561	10.9393	0	0	0	12.1368	12.6029	11.142	13.2804	13.3378	13.2506	9.24619	9.18249	9.6334
O75436	VP26A_HUMAN	Vacuolar protein sorting-associated protein 26A (Vesicle protein sorting 26A) (hVPS26)	VPS26A VPS26	Homo sapiens (Human)	"endocytic recycling [GO:0032456]; intracellular protein transport [GO:0006886]; regulation of macroautophagy [GO:0016241]; retrograde transport, endosome to Golgi [GO:0042147]"	"cytosol [GO:0005829]; early endosome [GO:0005769]; endosome [GO:0005768]; endosome membrane [GO:0010008]; lysosome [GO:0005764]; retromer complex [GO:0030904]; retromer, cargo-selective complex [GO:0030906]; tubular endosome [GO:0097422]; vesicle [GO:0031982]"	"cytosol [GO:0005829]; early endosome [GO:0005769]; endosome [GO:0005768]; endosome membrane [GO:0010008]; lysosome [GO:0005764]; retromer complex [GO:0030904]; retromer, cargo-selective complex [GO:0030906]; tubular endosome [GO:0097422]; vesicle [GO:0031982]; endocytic recycling [GO:0032456]; intracellular protein transport [GO:0006886]; regulation of macroautophagy [GO:0016241]; retrograde transport, endosome to Golgi [GO:0042147]"		GO:0005764; GO:0005768; GO:0005769; GO:0005829; GO:0006886; GO:0010008; GO:0016241; GO:0030904; GO:0030906; GO:0031982; GO:0032456; GO:0042147; GO:0097422	DVIVGKIYFLLVR	0.99814	12.6522	12.8219	11.0026	0	0	11.3164	12.327	0	13.5221	13.8877	13.4926	13.1487	9.54164	0	12.176
P05451	REG1A_HUMAN	Lithostathine-1-alpha (Islet cells regeneration factor) (ICRF) (Islet of Langerhans regenerating protein) (REG) (Pancreatic stone protein) (PSP) (Pancreatic thread protein) (PTP) (Regenerating islet-derived protein 1-alpha) (REG-1-alpha) (Regenerating protein I alpha)	REG1A PSPS PSPS1 REG	Homo sapiens (Human)	antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; cell wall disruption in another organism [GO:0044278]; positive regulation of cell population proliferation [GO:0008284]; response to peptide hormone [GO:0043434]	extracellular exosome [GO:0070062]; extracellular space [GO:0005615]	extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; growth factor activity [GO:0008083]; molecular function inhibitor activity [GO:0140678]; oligosaccharide binding [GO:0070492]; peptidoglycan binding [GO:0042834]; signaling receptor activity [GO:0038023]; antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; cell wall disruption in another organism [GO:0044278]; positive regulation of cell population proliferation [GO:0008284]; response to peptide hormone [GO:0043434]	growth factor activity [GO:0008083]; molecular function inhibitor activity [GO:0140678]; oligosaccharide binding [GO:0070492]; peptidoglycan binding [GO:0042834]; signaling receptor activity [GO:0038023]	GO:0005615; GO:0008083; GO:0008284; GO:0038023; GO:0042834; GO:0043434; GO:0044278; GO:0061844; GO:0070062; GO:0070492; GO:0140678	DVPCEDKFSFVCK	0.77372	10.9809	11.2169	9.9378	9.35478	10.3175	9.67174	0	9.62695	11.4692	10.2667	10.5991	0	10.7951	10.913	10.0056
P22061	PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PIMT) (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl/D-aspartyl methyltransferase) (Protein-beta-aspartate methyltransferase)	PCMT1	Homo sapiens (Human)	protein methylation [GO:0006479]; protein repair [GO:0030091]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular vesicle [GO:1903561]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular vesicle [GO:1903561]; cadherin binding [GO:0045296]; protein-L-isoaspartate (D-aspartate) O-methyltransferase activity [GO:0004719]; protein methylation [GO:0006479]; protein repair [GO:0030091]	cadherin binding [GO:0045296]; protein-L-isoaspartate (D-aspartate) O-methyltransferase activity [GO:0004719]	GO:0004719; GO:0005737; GO:0005829; GO:0006479; GO:0030091; GO:0045296; GO:0070062; GO:1903561	ALDVGSGSGILTACFAR	0.74016	12.6633	12.3309	13.3059	0	0	0	11.1601	11.6838	10.389	9.37554	14.5752	0	13.1536	13.0805	13.3802
P02795	MT2_HUMAN	Metallothionein-2 (MT-2) (Metallothionein-2A) (Metallothionein-II) (MT-II)	MT2A CES1 MT2	Homo sapiens (Human)	cellular copper ion homeostasis [GO:0006878]; cellular response to cadmium ion [GO:0071276]; cellular response to copper ion [GO:0071280]; cellular response to erythropoietin [GO:0036018]; cellular response to interleukin-3 [GO:0036016]; cellular response to zinc ion [GO:0071294]; cellular zinc ion homeostasis [GO:0006882]; detoxification of copper ion [GO:0010273]; negative regulation of growth [GO:0045926]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleus [GO:0005634]; metal ion binding [GO:0046872]; zinc ion binding [GO:0008270]; cellular copper ion homeostasis [GO:0006878]; cellular response to cadmium ion [GO:0071276]; cellular response to copper ion [GO:0071280]; cellular response to erythropoietin [GO:0036018]; cellular response to interleukin-3 [GO:0036016]; cellular response to zinc ion [GO:0071294]; cellular zinc ion homeostasis [GO:0006882]; detoxification of copper ion [GO:0010273]; negative regulation of growth [GO:0045926]	metal ion binding [GO:0046872]; zinc ion binding [GO:0008270]	GO:0005634; GO:0005737; GO:0005829; GO:0006878; GO:0006882; GO:0008270; GO:0010273; GO:0036016; GO:0036018; GO:0045926; GO:0046872; GO:0071276; GO:0071280; GO:0071294	CAQGCICK	0.74427	10.9987	10.9191	10.8068	9.9327	9.9468	10.2186	0	0	10.9519	10.5887	10.5497	10.6038	9.7871	9.637	9.99435
Q9NZC2	TREM2_HUMAN	Triggering receptor expressed on myeloid cells 2 (TREM-2) (Triggering receptor expressed on monocytes 2)	TREM2	Homo sapiens (Human)	"amyloid-beta clearance by cellular catabolic process [GO:0150094]; apoptotic cell clearance [GO:0043277]; astrocyte activation [GO:0048143]; cellular response to amyloid-beta [GO:1904646]; cellular response to glucose stimulus [GO:0071333]; cellular response to hypoxia [GO:0071456]; cellular response to lipid [GO:0071396]; cellular response to lipoteichoic acid [GO:0071223]; cellular response to oxidised low-density lipoprotein particle stimulus [GO:0140052]; cellular response to peptidoglycan [GO:0071224]; complement-mediated synapse pruning [GO:0150062]; CXCL12-activated CXCR4 signaling pathway [GO:0038160]; defense response to Gram-negative bacterium [GO:0050829]; dendritic cell differentiation [GO:0097028]; dendritic spine maintenance [GO:0097062]; detection of lipopolysaccharide [GO:0032497]; detection of lipoteichoic acid [GO:0070392]; detection of peptidoglycan [GO:0032499]; excitatory synapse pruning [GO:1905805]; humoral immune response [GO:0006959]; import into cell [GO:0098657]; lipid homeostasis [GO:0055088]; memory [GO:0007613]; microglial cell activation [GO:0001774]; microglial cell activation involved in immune response [GO:0002282]; microglial cell proliferation [GO:0061518]; negative regulation of amyloid fibril formation [GO:1905907]; negative regulation of astrocyte activation [GO:0061889]; negative regulation of autophagic cell death [GO:1904093]; negative regulation of autophagy [GO:0010507]; negative regulation of cell activation [GO:0050866]; negative regulation of cholesterol storage [GO:0010887]; negative regulation of cytokine production involved in inflammatory response [GO:1900016]; negative regulation of fat cell proliferation [GO:0070345]; negative regulation of glial cell apoptotic process [GO:0034351]; negative regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043124]; negative regulation of inflammatory response to antigenic stimulus [GO:0002862]; negative regulation of interleukin-1 beta production [GO:0032691]; negative regulation of macrophage colony-stimulating factor signaling pathway [GO:1902227]; negative regulation of neuroinflammatory response [GO:0150079]; negative regulation of NLRP3 inflammasome complex assembly [GO:1900226]; negative regulation of p38MAPK cascade [GO:1903753]; negative regulation of phosphatidylinositol 3-kinase signaling [GO:0014067]; negative regulation of sequestering of triglyceride [GO:0010891]; negative regulation of toll-like receptor 2 signaling pathway [GO:0034136]; negative regulation of toll-like receptor 4 signaling pathway [GO:0034144]; negative regulation of tumor necrosis factor production [GO:0032720]; osteoclast differentiation [GO:0030316]; phagocytosis, engulfment [GO:0006911]; phagocytosis, recognition [GO:0006910]; positive regulation of amyloid-beta clearance [GO:1900223]; positive regulation of antigen processing and presentation of peptide antigen via MHC class II [GO:0002588]; positive regulation of ATP biosynthetic process [GO:2001171]; positive regulation of C-C chemokine receptor CCR7 signaling pathway [GO:1903082]; positive regulation of calcium-mediated signaling [GO:0050850]; positive regulation of CAMKK-AMPK signaling cascade [GO:1905291]; positive regulation of CD40 signaling pathway [GO:2000350]; positive regulation of chemotaxis [GO:0050921]; positive regulation of cholesterol efflux [GO:0010875]; positive regulation of complement activation, classical pathway [GO:0045960]; positive regulation of engulfment of apoptotic cell [GO:1901076]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of establishment of protein localization [GO:1904951]; positive regulation of gene expression [GO:0010628]; positive regulation of high-density lipoprotein particle clearance [GO:0010983]; positive regulation of interleukin-10 production [GO:0032733]; positive regulation of inward rectifier potassium channel activity [GO:1901980]; positive regulation of kinase activity [GO:0033674]; positive regulation of low-density lipoprotein particle clearance [GO:1905581]; positive regulation of macrophage fusion [GO:0034241]; positive regulation of microglial cell activation [GO:1903980]; positive regulation of microglial cell migration [GO:1904141]; positive regulation of mitochondrion organization [GO:0010822]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of osteoclast differentiation [GO:0045672]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of phagocytosis [GO:0050766]; positive regulation of phagocytosis, engulfment [GO:0060100]; positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; positive regulation of proteasomal protein catabolic process [GO:1901800]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein secretion [GO:0050714]; positive regulation of synapse pruning [GO:1905808]; positive regulation of TOR signaling [GO:0032008]; pyroptosis [GO:0070269]; regulation of cytokine production involved in inflammatory response [GO:1900015]; regulation of gene expression [GO:0010468]; regulation of hippocampal neuron apoptotic process [GO:0110089]; regulation of innate immune response [GO:0045088]; regulation of interleukin-6 production [GO:0032675]; regulation of intracellular signal transduction [GO:1902531]; regulation of lipid metabolic process [GO:0019216]; regulation of macrophage inflammatory protein 1 alpha production [GO:0071640]; regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [GO:1903376]; regulation of peptidyl-tyrosine phosphorylation [GO:0050730]; regulation of plasma membrane bounded cell projection organization [GO:0120035]; regulation of resting membrane potential [GO:0060075]; regulation of toll-like receptor 6 signaling pathway [GO:0034151]; regulation of TOR signaling [GO:0032006]; respiratory burst after phagocytosis [GO:0045728]; response to axon injury [GO:0048678]; response to ischemia [GO:0002931]; social behavior [GO:0035176]"	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; intrinsic component of plasma membrane [GO:0031226]; plasma membrane [GO:0005886]; plasma membrane raft [GO:0044853]	"extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; intrinsic component of plasma membrane [GO:0031226]; plasma membrane [GO:0005886]; plasma membrane raft [GO:0044853]; amyloid-beta binding [GO:0001540]; apolipoprotein A-I binding [GO:0034186]; apolipoprotein binding [GO:0034185]; high-density lipoprotein particle binding [GO:0008035]; kinase activator activity [GO:0019209]; lipid binding [GO:0008289]; lipopolysaccharide binding [GO:0001530]; lipoprotein particle binding [GO:0071813]; lipoteichoic acid binding [GO:0070891]; low-density lipoprotein particle binding [GO:0030169]; peptidoglycan binding [GO:0042834]; phosphatidylethanolamine binding [GO:0008429]; phosphatidylserine binding [GO:0001786]; phospholipid binding [GO:0005543]; protein tyrosine kinase binding [GO:1990782]; protein-containing complex binding [GO:0044877]; scaffold protein binding [GO:0097110]; signaling receptor activity [GO:0038023]; sulfatide binding [GO:0120146]; transmembrane signaling receptor activity [GO:0004888]; very-low-density lipoprotein particle binding [GO:0034189]; amyloid-beta clearance by cellular catabolic process [GO:0150094]; apoptotic cell clearance [GO:0043277]; astrocyte activation [GO:0048143]; cellular response to amyloid-beta [GO:1904646]; cellular response to glucose stimulus [GO:0071333]; cellular response to hypoxia [GO:0071456]; cellular response to lipid [GO:0071396]; cellular response to lipoteichoic acid [GO:0071223]; cellular response to oxidised low-density lipoprotein particle stimulus [GO:0140052]; cellular response to peptidoglycan [GO:0071224]; complement-mediated synapse pruning [GO:0150062]; CXCL12-activated CXCR4 signaling pathway [GO:0038160]; defense response to Gram-negative bacterium [GO:0050829]; dendritic cell differentiation [GO:0097028]; dendritic spine maintenance [GO:0097062]; detection of lipopolysaccharide [GO:0032497]; detection of lipoteichoic acid [GO:0070392]; detection of peptidoglycan [GO:0032499]; excitatory synapse pruning [GO:1905805]; humoral immune response [GO:0006959]; import into cell [GO:0098657]; lipid homeostasis [GO:0055088]; memory [GO:0007613]; microglial cell activation [GO:0001774]; microglial cell activation involved in immune response [GO:0002282]; microglial cell proliferation [GO:0061518]; negative regulation of amyloid fibril formation [GO:1905907]; negative regulation of astrocyte activation [GO:0061889]; negative regulation of autophagic cell death [GO:1904093]; negative regulation of autophagy [GO:0010507]; negative regulation of cell activation [GO:0050866]; negative regulation of cholesterol storage [GO:0010887]; negative regulation of cytokine production involved in inflammatory response [GO:1900016]; negative regulation of fat cell proliferation [GO:0070345]; negative regulation of glial cell apoptotic process [GO:0034351]; negative regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043124]; negative regulation of inflammatory response to antigenic stimulus [GO:0002862]; negative regulation of interleukin-1 beta production [GO:0032691]; negative regulation of macrophage colony-stimulating factor signaling pathway [GO:1902227]; negative regulation of neuroinflammatory response [GO:0150079]; negative regulation of NLRP3 inflammasome complex assembly [GO:1900226]; negative regulation of p38MAPK cascade [GO:1903753]; negative regulation of phosphatidylinositol 3-kinase signaling [GO:0014067]; negative regulation of sequestering of triglyceride [GO:0010891]; negative regulation of toll-like receptor 2 signaling pathway [GO:0034136]; negative regulation of toll-like receptor 4 signaling pathway [GO:0034144]; negative regulation of tumor necrosis factor production [GO:0032720]; osteoclast differentiation [GO:0030316]; phagocytosis, engulfment [GO:0006911]; phagocytosis, recognition [GO:0006910]; positive regulation of amyloid-beta clearance [GO:1900223]; positive regulation of antigen processing and presentation of peptide antigen via MHC class II [GO:0002588]; positive regulation of ATP biosynthetic process [GO:2001171]; positive regulation of C-C chemokine receptor CCR7 signaling pathway [GO:1903082]; positive regulation of calcium-mediated signaling [GO:0050850]; positive regulation of CAMKK-AMPK signaling cascade [GO:1905291]; positive regulation of CD40 signaling pathway [GO:2000350]; positive regulation of chemotaxis [GO:0050921]; positive regulation of cholesterol efflux [GO:0010875]; positive regulation of complement activation, classical pathway [GO:0045960]; positive regulation of engulfment of apoptotic cell [GO:1901076]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of establishment of protein localization [GO:1904951]; positive regulation of gene expression [GO:0010628]; positive regulation of high-density lipoprotein particle clearance [GO:0010983]; positive regulation of interleukin-10 production [GO:0032733]; positive regulation of inward rectifier potassium channel activity [GO:1901980]; positive regulation of kinase activity [GO:0033674]; positive regulation of low-density lipoprotein particle clearance [GO:1905581]; positive regulation of macrophage fusion [GO:0034241]; positive regulation of microglial cell activation [GO:1903980]; positive regulation of microglial cell migration [GO:1904141]; positive regulation of mitochondrion organization [GO:0010822]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of osteoclast differentiation [GO:0045672]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of phagocytosis [GO:0050766]; positive regulation of phagocytosis, engulfment [GO:0060100]; positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; positive regulation of proteasomal protein catabolic process [GO:1901800]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein secretion [GO:0050714]; positive regulation of synapse pruning [GO:1905808]; positive regulation of TOR signaling [GO:0032008]; pyroptosis [GO:0070269]; regulation of cytokine production involved in inflammatory response [GO:1900015]; regulation of gene expression [GO:0010468]; regulation of hippocampal neuron apoptotic process [GO:0110089]; regulation of innate immune response [GO:0045088]; regulation of interleukin-6 production [GO:0032675]; regulation of intracellular signal transduction [GO:1902531]; regulation of lipid metabolic process [GO:0019216]; regulation of macrophage inflammatory protein 1 alpha production [GO:0071640]; regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [GO:1903376]; regulation of peptidyl-tyrosine phosphorylation [GO:0050730]; regulation of plasma membrane bounded cell projection organization [GO:0120035]; regulation of resting membrane potential [GO:0060075]; regulation of toll-like receptor 6 signaling pathway [GO:0034151]; regulation of TOR signaling [GO:0032006]; respiratory burst after phagocytosis [GO:0045728]; response to axon injury [GO:0048678]; response to ischemia [GO:0002931]; social behavior [GO:0035176]"	amyloid-beta binding [GO:0001540]; apolipoprotein A-I binding [GO:0034186]; apolipoprotein binding [GO:0034185]; high-density lipoprotein particle binding [GO:0008035]; kinase activator activity [GO:0019209]; lipid binding [GO:0008289]; lipopolysaccharide binding [GO:0001530]; lipoprotein particle binding [GO:0071813]; lipoteichoic acid binding [GO:0070891]; low-density lipoprotein particle binding [GO:0030169]; peptidoglycan binding [GO:0042834]; phosphatidylethanolamine binding [GO:0008429]; phosphatidylserine binding [GO:0001786]; phospholipid binding [GO:0005543]; protein tyrosine kinase binding [GO:1990782]; protein-containing complex binding [GO:0044877]; scaffold protein binding [GO:0097110]; signaling receptor activity [GO:0038023]; sulfatide binding [GO:0120146]; transmembrane signaling receptor activity [GO:0004888]; very-low-density lipoprotein particle binding [GO:0034189]	GO:0001530; GO:0001540; GO:0001774; GO:0001786; GO:0001934; GO:0002282; GO:0002588; GO:0002862; GO:0002931; GO:0004888; GO:0005543; GO:0005576; GO:0005886; GO:0005887; GO:0006910; GO:0006911; GO:0006959; GO:0007613; GO:0008035; GO:0008289; GO:0008429; GO:0010468; GO:0010507; GO:0010628; GO:0010822; GO:0010875; GO:0010887; GO:0010891; GO:0010983; GO:0014067; GO:0014068; GO:0016021; GO:0019209; GO:0019216; GO:0030169; GO:0030316; GO:0031226; GO:0032006; GO:0032008; GO:0032497; GO:0032499; GO:0032675; GO:0032691; GO:0032720; GO:0032733; GO:0033674; GO:0034136; GO:0034144; GO:0034151; GO:0034185; GO:0034186; GO:0034189; GO:0034241; GO:0034351; GO:0035176; GO:0038023; GO:0038160; GO:0042834; GO:0043124; GO:0043277; GO:0044853; GO:0044877; GO:0045088; GO:0045672; GO:0045728; GO:0045960; GO:0048143; GO:0048678; GO:0050714; GO:0050730; GO:0050731; GO:0050766; GO:0050829; GO:0050850; GO:0050866; GO:0050921; GO:0055088; GO:0060075; GO:0060100; GO:0061518; GO:0061889; GO:0070269; GO:0070345; GO:0070374; GO:0070392; GO:0070891; GO:0071223; GO:0071224; GO:0071333; GO:0071396; GO:0071456; GO:0071640; GO:0071813; GO:0097028; GO:0097062; GO:0097110; GO:0098657; GO:0110089; GO:0120035; GO:0120146; GO:0140052; GO:0150062; GO:0150079; GO:0150094; GO:1900015; GO:1900016; GO:1900223; GO:1900226; GO:1901076; GO:1901224; GO:1901800; GO:1901980; GO:1902227; GO:1902531; GO:1903078; GO:1903082; GO:1903376; GO:1903753; GO:1903980; GO:1904093; GO:1904141; GO:1904646; GO:1904951; GO:1905291; GO:1905581; GO:1905805; GO:1905808; GO:1905907; GO:1990782; GO:2000350; GO:2001171	AWCRQLGEK	0.90773	12.7838	0	0	9.41321	9.60004	0	13.0597	13.2211	13.3587	13.4442	0	13.4516	10.3353	13.0504	13.1749
P04179	SODM_HUMAN	"Superoxide dismutase [Mn], mitochondrial (EC 1.15.1.1)"	SOD2	Homo sapiens (Human)	acetylcholine-mediated vasodilation involved in regulation of systemic arterial blood pressure [GO:0003069]; aging [GO:0007568]; cellular response to ethanol [GO:0071361]; cellular response to oxidative stress [GO:0034599]; detection of oxygen [GO:0003032]; erythrophore differentiation [GO:0048773]; glutathione metabolic process [GO:0006749]; heart development [GO:0007507]; hemopoiesis [GO:0030097]; hydrogen peroxide biosynthetic process [GO:0050665]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; intrinsic apoptotic signaling pathway in response to oxidative stress [GO:0008631]; iron ion homeostasis [GO:0055072]; liver development [GO:0001889]; locomotory behavior [GO:0007626]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of fat cell differentiation [GO:0045599]; negative regulation of fibroblast proliferation [GO:0048147]; negative regulation of membrane hyperpolarization [GO:1902631]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [GO:1902176]; negative regulation of vascular associated smooth muscle cell proliferation [GO:1904706]; neuron development [GO:0048666]; oxygen homeostasis [GO:0032364]; positive regulation of cell migration [GO:0030335]; positive regulation of hydrogen peroxide biosynthetic process [GO:0010729]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of vascular associated smooth muscle cell apoptotic process [GO:1905461]; positive regulation of vascular associated smooth muscle cell differentiation involved in phenotypic switching [GO:1905932]; post-embryonic development [GO:0009791]; protein homotetramerization [GO:0051289]; regulation of blood pressure [GO:0008217]; regulation of catalytic activity [GO:0050790]; regulation of mitochondrial membrane potential [GO:0051881]; regulation of transcription by RNA polymerase II [GO:0006357]; release of cytochrome c from mitochondria [GO:0001836]; removal of superoxide radicals [GO:0019430]; respiratory electron transport chain [GO:0022904]; response to activity [GO:0014823]; response to axon injury [GO:0048678]; response to cadmium ion [GO:0046686]; response to cold [GO:0009409]; response to electrical stimulus [GO:0051602]; response to gamma radiation [GO:0010332]; response to hydrogen peroxide [GO:0042542]; response to hyperoxia [GO:0055093]; response to hypoxia [GO:0001666]; response to immobilization stress [GO:0035902]; response to isolation stress [GO:0035900]; response to L-ascorbic acid [GO:0033591]; response to lipopolysaccharide [GO:0032496]; response to magnetism [GO:0071000]; response to manganese ion [GO:0010042]; response to selenium ion [GO:0010269]; response to silicon dioxide [GO:0034021]; response to superoxide [GO:0000303]; response to xenobiotic stimulus [GO:0009410]; response to zinc ion [GO:0010043]; superoxide anion generation [GO:0042554]; superoxide metabolic process [GO:0006801]	extracellular exosome [GO:0070062]; mitochondrial matrix [GO:0005759]; mitochondrial nucleoid [GO:0042645]; mitochondrion [GO:0005739]	extracellular exosome [GO:0070062]; mitochondrial matrix [GO:0005759]; mitochondrial nucleoid [GO:0042645]; mitochondrion [GO:0005739]; DNA binding [GO:0003677]; enzyme binding [GO:0019899]; identical protein binding [GO:0042802]; manganese ion binding [GO:0030145]; oxygen binding [GO:0019825]; superoxide dismutase activity [GO:0004784]; acetylcholine-mediated vasodilation involved in regulation of systemic arterial blood pressure [GO:0003069]; aging [GO:0007568]; cellular response to ethanol [GO:0071361]; cellular response to oxidative stress [GO:0034599]; detection of oxygen [GO:0003032]; erythrophore differentiation [GO:0048773]; glutathione metabolic process [GO:0006749]; heart development [GO:0007507]; hemopoiesis [GO:0030097]; hydrogen peroxide biosynthetic process [GO:0050665]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; intrinsic apoptotic signaling pathway in response to oxidative stress [GO:0008631]; iron ion homeostasis [GO:0055072]; liver development [GO:0001889]; locomotory behavior [GO:0007626]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of fat cell differentiation [GO:0045599]; negative regulation of fibroblast proliferation [GO:0048147]; negative regulation of membrane hyperpolarization [GO:1902631]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [GO:1902176]; negative regulation of vascular associated smooth muscle cell proliferation [GO:1904706]; neuron development [GO:0048666]; oxygen homeostasis [GO:0032364]; positive regulation of cell migration [GO:0030335]; positive regulation of hydrogen peroxide biosynthetic process [GO:0010729]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of vascular associated smooth muscle cell apoptotic process [GO:1905461]; positive regulation of vascular associated smooth muscle cell differentiation involved in phenotypic switching [GO:1905932]; post-embryonic development [GO:0009791]; protein homotetramerization [GO:0051289]; regulation of blood pressure [GO:0008217]; regulation of catalytic activity [GO:0050790]; regulation of mitochondrial membrane potential [GO:0051881]; regulation of transcription by RNA polymerase II [GO:0006357]; release of cytochrome c from mitochondria [GO:0001836]; removal of superoxide radicals [GO:0019430]; respiratory electron transport chain [GO:0022904]; response to activity [GO:0014823]; response to axon injury [GO:0048678]; response to cadmium ion [GO:0046686]; response to cold [GO:0009409]; response to electrical stimulus [GO:0051602]; response to gamma radiation [GO:0010332]; response to hydrogen peroxide [GO:0042542]; response to hyperoxia [GO:0055093]; response to hypoxia [GO:0001666]; response to immobilization stress [GO:0035902]; response to isolation stress [GO:0035900]; response to L-ascorbic acid [GO:0033591]; response to lipopolysaccharide [GO:0032496]; response to magnetism [GO:0071000]; response to manganese ion [GO:0010042]; response to selenium ion [GO:0010269]; response to silicon dioxide [GO:0034021]; response to superoxide [GO:0000303]; response to xenobiotic stimulus [GO:0009410]; response to zinc ion [GO:0010043]; superoxide anion generation [GO:0042554]; superoxide metabolic process [GO:0006801]	DNA binding [GO:0003677]; enzyme binding [GO:0019899]; identical protein binding [GO:0042802]; manganese ion binding [GO:0030145]; oxygen binding [GO:0019825]; superoxide dismutase activity [GO:0004784]	GO:0000303; GO:0001666; GO:0001836; GO:0001889; GO:0003032; GO:0003069; GO:0003677; GO:0004784; GO:0005739; GO:0005759; GO:0006357; GO:0006749; GO:0006801; GO:0007507; GO:0007568; GO:0007626; GO:0008217; GO:0008285; GO:0008630; GO:0008631; GO:0009409; GO:0009410; GO:0009791; GO:0010042; GO:0010043; GO:0010269; GO:0010332; GO:0010729; GO:0014823; GO:0019430; GO:0019825; GO:0019899; GO:0022904; GO:0030097; GO:0030145; GO:0030335; GO:0032364; GO:0032496; GO:0033591; GO:0034021; GO:0034599; GO:0035900; GO:0035902; GO:0042542; GO:0042554; GO:0042645; GO:0042802; GO:0043524; GO:0045429; GO:0045599; GO:0046686; GO:0048147; GO:0048666; GO:0048678; GO:0048773; GO:0050665; GO:0050790; GO:0051289; GO:0051602; GO:0051881; GO:0055072; GO:0055093; GO:0070062; GO:0071000; GO:0071361; GO:1902176; GO:1902631; GO:1904706; GO:1905461; GO:1905932	AIWNVINWENVTERYMACKK	0.66942	10.7858	8.64303	10.9144	0	0	10.3694	11.7877	11.5561	11.6694	11.1044	11.2626	0	11.7981	11.9793	11.5535
Q96DW6	S2538_HUMAN	Mitochondrial glycine transporter (Appoptosin) (Mitochondrial glycine transporter GlyC) (Solute carrier family 25 member 38)	SLC25A38	Homo sapiens (Human)	erythrocyte differentiation [GO:0030218]; glycine import into mitochondrion [GO:1904983]; heme biosynthetic process [GO:0006783]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]; glycine transmembrane transporter activity [GO:0015187]; erythrocyte differentiation [GO:0030218]; glycine import into mitochondrion [GO:1904983]; heme biosynthetic process [GO:0006783]	glycine transmembrane transporter activity [GO:0015187]	GO:0005739; GO:0005743; GO:0006783; GO:0015187; GO:0016021; GO:0030218; GO:1904983	ALRRTLMAAMAWTVYEEMMAK	0.94809	11.9198	12.0222	0	10.0749	0	13.0028	10.193	9.27796	10.4244	10.0013	0	11.5222	11.3596	11.3556	12.2219
Q8IZP0	ABI1_HUMAN	Abl interactor 1 (Abelson interactor 1) (Abi-1) (Abl-binding protein 4) (AblBP4) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (Nap1-binding protein) (Nap1BP) (Spectrin SH3 domain-binding protein 1) (e3B1)	ABI1 SSH3BP1	Homo sapiens (Human)	actin polymerization or depolymerization [GO:0008154]; dendrite morphogenesis [GO:0048813]; lamellipodium morphogenesis [GO:0072673]; megakaryocyte development [GO:0035855]; negative regulation of cell population proliferation [GO:0008285]; peptidyl-tyrosine phosphorylation [GO:0018108]; somitogenesis [GO:0001756]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	anchoring junction [GO:0070161]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; extracellular exosome [GO:0070062]; filopodium tip [GO:0032433]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; nucleus [GO:0005634]; postsynaptic density [GO:0014069]; SCAR complex [GO:0031209]	anchoring junction [GO:0070161]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; extracellular exosome [GO:0070062]; filopodium tip [GO:0032433]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; nucleus [GO:0005634]; postsynaptic density [GO:0014069]; SCAR complex [GO:0031209]; cadherin binding [GO:0045296]; cytoskeletal protein binding [GO:0008092]; protein tyrosine kinase activator activity [GO:0030296]; SH3 domain binding [GO:0017124]; signaling adaptor activity [GO:0035591]; actin polymerization or depolymerization [GO:0008154]; dendrite morphogenesis [GO:0048813]; lamellipodium morphogenesis [GO:0072673]; megakaryocyte development [GO:0035855]; negative regulation of cell population proliferation [GO:0008285]; peptidyl-tyrosine phosphorylation [GO:0018108]; somitogenesis [GO:0001756]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	cadherin binding [GO:0045296]; cytoskeletal protein binding [GO:0008092]; protein tyrosine kinase activator activity [GO:0030296]; SH3 domain binding [GO:0017124]; signaling adaptor activity [GO:0035591]	GO:0001756; GO:0005634; GO:0005783; GO:0005829; GO:0005856; GO:0007169; GO:0008092; GO:0008154; GO:0008285; GO:0014069; GO:0017124; GO:0018108; GO:0030027; GO:0030296; GO:0030426; GO:0031209; GO:0032433; GO:0035591; GO:0035855; GO:0045296; GO:0048813; GO:0070062; GO:0070161; GO:0072673	AELQMLLEEEIPSGK	0.78058	10.4854	10.5871	11.8832	9.08162	0	0	11.0178	11.5742	11.3264	12.516	10.8216	10.6193	11.342	10.8345	0
P55036	PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein)	PSMD4 MCB1	Homo sapiens (Human)	proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]	"cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; proteasome accessory complex [GO:0022624]; proteasome complex [GO:0000502]; proteasome regulatory particle, base subcomplex [GO:0008540]"	"cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; proteasome accessory complex [GO:0022624]; proteasome complex [GO:0000502]; proteasome regulatory particle, base subcomplex [GO:0008540]; identical protein binding [GO:0042802]; molecular adaptor activity [GO:0060090]; polyubiquitin modification-dependent protein binding [GO:0031593]; RNA binding [GO:0003723]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]"	identical protein binding [GO:0042802]; molecular adaptor activity [GO:0060090]; polyubiquitin modification-dependent protein binding [GO:0031593]; RNA binding [GO:0003723]	GO:0000502; GO:0003723; GO:0005634; GO:0005654; GO:0005829; GO:0008540; GO:0022624; GO:0031593; GO:0042802; GO:0043161; GO:0060090	DLVKLAK	0.98938	10.7759	12.0084	13.3359	12.1649	12.7569	0	0	8.86106	9.8554	10.782	9.14621	11.1061	9.97427	0	10.6279
Q01105	SET_HUMAN	Protein SET (HLA-DR-associated protein II) (Inhibitor of granzyme A-activated DNase) (IGAAD) (PHAPII) (Phosphatase 2A inhibitor I2PP2A) (I-2PP2A) (Template-activating factor I) (TAF-I)	SET	Homo sapiens (Human)	DNA replication [GO:0006260]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of histone acetylation [GO:0035067]; negative regulation of neuron apoptotic process [GO:0043524]; nucleosome assembly [GO:0006334]; nucleosome disassembly [GO:0006337]	chromatin [GO:0000785]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; lipid droplet [GO:0005811]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; protein-containing complex [GO:0032991]	chromatin [GO:0000785]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; lipid droplet [GO:0005811]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; protein-containing complex [GO:0032991]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; histone binding [GO:0042393]; protein phosphatase inhibitor activity [GO:0004864]; protein phosphatase regulator activity [GO:0019888]; DNA replication [GO:0006260]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of histone acetylation [GO:0035067]; negative regulation of neuron apoptotic process [GO:0043524]; nucleosome assembly [GO:0006334]; nucleosome disassembly [GO:0006337]	chromatin binding [GO:0003682]; DNA binding [GO:0003677]; histone binding [GO:0042393]; protein phosphatase inhibitor activity [GO:0004864]; protein phosphatase regulator activity [GO:0019888]	GO:0000785; GO:0003677; GO:0003682; GO:0004864; GO:0005634; GO:0005654; GO:0005737; GO:0005783; GO:0005811; GO:0005829; GO:0006260; GO:0006334; GO:0006337; GO:0019888; GO:0032991; GO:0035067; GO:0042393; GO:0043524; GO:0045892; GO:0048471	APKRQSPLPPQK	1.0207	9.70373	9.69321	10.6382	9.40765	0	9.26702	10.7798	9.44576	10.2155	9.34567	13.1382	0	11.1862	9.38982	8.93233
P78380	OLR1_HUMAN	"Oxidized low-density lipoprotein receptor 1 (Ox-LDL receptor 1) (C-type lectin domain family 8 member A) (Lectin-like oxidized LDL receptor 1) (LOX-1) (Lectin-like oxLDL receptor 1) (hLOX-1) (Lectin-type oxidized LDL receptor 1) [Cleaved into: Oxidized low-density lipoprotein receptor 1, soluble form]"	OLR1 CLEC8A LOX1	Homo sapiens (Human)	blood circulation [GO:0008015]; cell death [GO:0008219]; immune system process [GO:0002376]; inflammatory response [GO:0006954]; leukocyte cell-cell adhesion [GO:0007159]; lipoprotein metabolic process [GO:0042157]; proteolysis [GO:0006508]	extracellular region [GO:0005576]; integral component of plasma membrane [GO:0005887]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; membrane raft [GO:0045121]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]; specific granule membrane [GO:0035579]; tertiary granule membrane [GO:0070821]	extracellular region [GO:0005576]; integral component of plasma membrane [GO:0005887]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; membrane raft [GO:0045121]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]; specific granule membrane [GO:0035579]; tertiary granule membrane [GO:0070821]; carbohydrate binding [GO:0030246]; identical protein binding [GO:0042802]; low-density lipoprotein particle receptor activity [GO:0005041]; blood circulation [GO:0008015]; cell death [GO:0008219]; immune system process [GO:0002376]; inflammatory response [GO:0006954]; leukocyte cell-cell adhesion [GO:0007159]; lipoprotein metabolic process [GO:0042157]; proteolysis [GO:0006508]	carbohydrate binding [GO:0030246]; identical protein binding [GO:0042802]; low-density lipoprotein particle receptor activity [GO:0005041]	GO:0002376; GO:0005041; GO:0005576; GO:0005654; GO:0005886; GO:0005887; GO:0006508; GO:0006954; GO:0007159; GO:0008015; GO:0008219; GO:0016020; GO:0030246; GO:0035579; GO:0042157; GO:0042802; GO:0043231; GO:0043235; GO:0045121; GO:0070821	DQPDEKSNGK	0.49246	12.5568	10.644	10.4012	9.67529	0	0	10.5172	11.767	9.08969	10.7	12.6011	12.3604	10.1394	0	9.29609
B7Z1X9	B7Z1X9_HUMAN	"cDNA FLJ53726, highly similar to Coiled-coil-helix-coiled-coil-helixdomain-containing protein 3"		Homo sapiens (Human)		MICOS complex [GO:0061617]	MICOS complex [GO:0061617]		GO:0061617	AAANEQLTR	0.98742	10.4375	11.6543	10.0247	10.0023	0	9.50948	9.55461	0	14.3649	11.3313	12.4379	10.1268	9.76383	0	10.1809
C0LLI8	C0LLI8_HUMAN	"Estrogen receptor alpha delta 6,7 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AANLWPSPLMIK	0.95139	11.1687	0	11.0911	0	0	0	11.5829	13.7208	11.3338	12.7508	12.7944	11.6997	10.1542	11.6365	10.7538
Q9UN36	NDRG2_HUMAN	Protein NDRG2 (N-myc downstream-regulated gene 2 protein) (Protein Syld709613)	NDRG2 KIAA1248 SYLD	Homo sapiens (Human)	cell differentiation [GO:0030154]; negative regulation of cytokine production [GO:0001818]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; negative regulation of vascular associated smooth muscle cell proliferation [GO:1904706]; regulation of platelet-derived growth factor production [GO:0090361]; regulation of vascular endothelial growth factor production [GO:0010574]; signal transduction [GO:0007165]; substantia nigra development [GO:0021762]; vascular associated smooth muscle cell proliferation [GO:1990874]; Wnt signaling pathway [GO:0016055]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; growth cone [GO:0030426]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; growth cone [GO:0030426]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; cell differentiation [GO:0030154]; negative regulation of cytokine production [GO:0001818]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; negative regulation of vascular associated smooth muscle cell proliferation [GO:1904706]; regulation of platelet-derived growth factor production [GO:0090361]; regulation of vascular endothelial growth factor production [GO:0010574]; signal transduction [GO:0007165]; substantia nigra development [GO:0021762]; vascular associated smooth muscle cell proliferation [GO:1990874]; Wnt signaling pathway [GO:0016055]		GO:0001818; GO:0005634; GO:0005737; GO:0005794; GO:0005829; GO:0007165; GO:0010574; GO:0016055; GO:0021762; GO:0030154; GO:0030426; GO:0048471; GO:0070062; GO:0070373; GO:0090361; GO:1904706; GO:1990874	CPVMLVVGDQAPHEDAVVECNSK	0.073684	12.7728	0	11.9704	9.35478	8.76921	10.197	0	11.9402	8.63626	11.1872	11.9772	12.7766	9.51416	0	9.55398
B4DFK5	B4DFK5_HUMAN	"cDNA FLJ50090, highly similar to F-box only protein 33"		Homo sapiens (Human)	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146]	SCF ubiquitin ligase complex [GO:0019005]	SCF ubiquitin ligase complex [GO:0019005]; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146]		GO:0019005; GO:0031146	EMQSFSEDI	0.52657	11.2304	10.8125	0	11.2149	0	0	9.24455	11.0653	12.0627	0	12.446	10.8047	12.4446	10.9608	12.1575
P62979	RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a (Ubiquitin carboxyl extension protein 80) [Cleaved into: Ubiquitin; 40S ribosomal protein S27a (Small ribosomal subunit protein eS31)]	RPS27A UBA80 UBCEP1	Homo sapiens (Human)	cytoplasmic translation [GO:0002181]; modification-dependent protein catabolic process [GO:0019941]; protein ubiquitination [GO:0016567]; translation [GO:0006412]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; cytosolic ribosome [GO:0022626]; cytosolic small ribosomal subunit [GO:0022627]; endocytic vesicle membrane [GO:0030666]; endoplasmic reticulum membrane [GO:0005789]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; membrane [GO:0016020]; mitochondrial outer membrane [GO:0005741]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; small ribosomal subunit [GO:0015935]; vesicle [GO:0031982]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; cytosolic ribosome [GO:0022626]; cytosolic small ribosomal subunit [GO:0022627]; endocytic vesicle membrane [GO:0030666]; endoplasmic reticulum membrane [GO:0005789]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; membrane [GO:0016020]; mitochondrial outer membrane [GO:0005741]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; small ribosomal subunit [GO:0015935]; vesicle [GO:0031982]; metal ion binding [GO:0046872]; protein tag [GO:0031386]; RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]; ubiquitin protein ligase binding [GO:0031625]; cytoplasmic translation [GO:0002181]; modification-dependent protein catabolic process [GO:0019941]; protein ubiquitination [GO:0016567]; translation [GO:0006412]	metal ion binding [GO:0046872]; protein tag [GO:0031386]; RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]; ubiquitin protein ligase binding [GO:0031625]	GO:0002181; GO:0003723; GO:0003735; GO:0005615; GO:0005634; GO:0005654; GO:0005730; GO:0005737; GO:0005741; GO:0005789; GO:0005829; GO:0005886; GO:0006412; GO:0010008; GO:0015935; GO:0016020; GO:0016567; GO:0019941; GO:0022626; GO:0022627; GO:0030666; GO:0031386; GO:0031625; GO:0031982; GO:0046872; GO:0070062	AKIQDKEGIPPDQQR	0.93882	11.4522	0	10.3316	0	0	0	11.558	11.8813	11.8231	10.7169	10.3256	10.6008	12.1409	11.2686	11.2394
P17936	IBP3_HUMAN	Insulin-like growth factor-binding protein 3 (IBP-3) (IGF-binding protein 3) (IGFBP-3)	IGFBP3 IBP3	Homo sapiens (Human)	apoptotic process [GO:0006915]; MAPK cascade [GO:0000165]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of protein phosphorylation [GO:0001933]; negative regulation of signal transduction [GO:0009968]; negative regulation of smooth muscle cell migration [GO:0014912]; negative regulation of smooth muscle cell proliferation [GO:0048662]; osteoblast differentiation [GO:0001649]; positive regulation of apoptotic process [GO:0043065]; positive regulation of insulin-like growth factor receptor signaling pathway [GO:0043568]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of myoblast differentiation [GO:0045663]; protein phosphorylation [GO:0006468]; regulation of cell growth [GO:0001558]; regulation of glucose metabolic process [GO:0010906]; regulation of insulin-like growth factor receptor signaling pathway [GO:0043567]; type B pancreatic cell proliferation [GO:0044342]	endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; insulin-like growth factor binding protein complex [GO:0016942]; insulin-like growth factor ternary complex [GO:0042567]; nucleus [GO:0005634]	endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; insulin-like growth factor binding protein complex [GO:0016942]; insulin-like growth factor ternary complex [GO:0042567]; nucleus [GO:0005634]; fibronectin binding [GO:0001968]; insulin-like growth factor binding [GO:0005520]; insulin-like growth factor I binding [GO:0031994]; insulin-like growth factor II binding [GO:0031995]; metal ion binding [GO:0046872]; protein tyrosine phosphatase activator activity [GO:0008160]; apoptotic process [GO:0006915]; MAPK cascade [GO:0000165]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of protein phosphorylation [GO:0001933]; negative regulation of signal transduction [GO:0009968]; negative regulation of smooth muscle cell migration [GO:0014912]; negative regulation of smooth muscle cell proliferation [GO:0048662]; osteoblast differentiation [GO:0001649]; positive regulation of apoptotic process [GO:0043065]; positive regulation of insulin-like growth factor receptor signaling pathway [GO:0043568]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of myoblast differentiation [GO:0045663]; protein phosphorylation [GO:0006468]; regulation of cell growth [GO:0001558]; regulation of glucose metabolic process [GO:0010906]; regulation of insulin-like growth factor receptor signaling pathway [GO:0043567]; type B pancreatic cell proliferation [GO:0044342]	fibronectin binding [GO:0001968]; insulin-like growth factor binding [GO:0005520]; insulin-like growth factor I binding [GO:0031994]; insulin-like growth factor II binding [GO:0031995]; metal ion binding [GO:0046872]; protein tyrosine phosphatase activator activity [GO:0008160]	GO:0000165; GO:0001558; GO:0001649; GO:0001933; GO:0001968; GO:0005520; GO:0005576; GO:0005615; GO:0005634; GO:0005788; GO:0006468; GO:0006915; GO:0008160; GO:0008285; GO:0009968; GO:0010906; GO:0014912; GO:0016942; GO:0031994; GO:0031995; GO:0042567; GO:0043065; GO:0043410; GO:0043567; GO:0043568; GO:0044342; GO:0045663; GO:0046872; GO:0048662	AGASSAGLGPVVR	0.98557	10.2407	9.39019	9.80521	9.94555	9.55088	0	0	0	11.0383	11.5866	11.2218	9.23644	10.5758	10.7749	9.41198
Q96A70	AZIN2_HUMAN	Antizyme inhibitor 2 (AzI2) (Arginine decarboxylase) (ADC) (ARGDC) (Ornithine decarboxylase-like protein) (ODC-like protein) (ornithine decarboxylase paralog) (ODC-p)	AZIN2 ADC KIAA1945 ODCP	Homo sapiens (Human)	agmatine biosynthetic process [GO:0097055]; negative regulation of protein catabolic process [GO:0042177]; positive regulation of catalytic activity [GO:0043085]; positive regulation of polyamine transmembrane transport [GO:1902269]; putrescine biosynthetic process from ornithine [GO:0033387]; spermatogenesis [GO:0007283]; trans-Golgi network membrane organization [GO:0098629]	axon [GO:0030424]; cis-Golgi network [GO:0005801]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; dendrite [GO:0030425]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; granular vesicle [GO:1990005]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; trans-Golgi network [GO:0005802]; transport vesicle [GO:0030133]	axon [GO:0030424]; cis-Golgi network [GO:0005801]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; dendrite [GO:0030425]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; granular vesicle [GO:1990005]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; trans-Golgi network [GO:0005802]; transport vesicle [GO:0030133]; arginine decarboxylase activity [GO:0008792]; ornithine decarboxylase activator activity [GO:0042978]; agmatine biosynthetic process [GO:0097055]; negative regulation of protein catabolic process [GO:0042177]; positive regulation of catalytic activity [GO:0043085]; positive regulation of polyamine transmembrane transport [GO:1902269]; putrescine biosynthetic process from ornithine [GO:0033387]; spermatogenesis [GO:0007283]; trans-Golgi network membrane organization [GO:0098629]	arginine decarboxylase activity [GO:0008792]; ornithine decarboxylase activator activity [GO:0042978]	GO:0005634; GO:0005737; GO:0005739; GO:0005801; GO:0005802; GO:0005829; GO:0007283; GO:0008792; GO:0030133; GO:0030424; GO:0030425; GO:0031410; GO:0033116; GO:0033387; GO:0042177; GO:0042978; GO:0043085; GO:0043204; GO:0048471; GO:0097055; GO:0098629; GO:1902269; GO:1990005	AEMELVQHIGIPASKIICANPCK	0.51471	0	0	0	10.5341	9.87447	11.305	9.55516	0	12.9114	14.6465	10.7682	10.0917	12.6865	9.14103	9.47462
O96008	TOM40_HUMAN	Mitochondrial import receptor subunit TOM40 homolog (Protein Haymaker) (Translocase of outer membrane 40 kDa subunit homolog) (p38.5)	TOMM40 C19orf1 PEREC1 TOM40	Homo sapiens (Human)	ion transport [GO:0006811]; protein import into mitochondrial matrix [GO:0030150]; protein insertion into mitochondrial outer membrane [GO:0045040]; protein targeting to mitochondrion [GO:0006626]	cytosol [GO:0005829]; integral component of membrane [GO:0016021]; integral component of mitochondrial outer membrane [GO:0031307]; mitochondria-associated endoplasmic reticulum membrane [GO:0044233]; mitochondrial inner membrane [GO:0005743]; mitochondrial outer membrane [GO:0005741]; mitochondrial outer membrane translocase complex [GO:0005742]; mitochondrion [GO:0005739]; pore complex [GO:0046930]	cytosol [GO:0005829]; integral component of membrane [GO:0016021]; integral component of mitochondrial outer membrane [GO:0031307]; mitochondria-associated endoplasmic reticulum membrane [GO:0044233]; mitochondrial inner membrane [GO:0005743]; mitochondrial outer membrane [GO:0005741]; mitochondrial outer membrane translocase complex [GO:0005742]; mitochondrion [GO:0005739]; pore complex [GO:0046930]; porin activity [GO:0015288]; protein transmembrane transporter activity [GO:0008320]; ion transport [GO:0006811]; protein import into mitochondrial matrix [GO:0030150]; protein insertion into mitochondrial outer membrane [GO:0045040]; protein targeting to mitochondrion [GO:0006626]	porin activity [GO:0015288]; protein transmembrane transporter activity [GO:0008320]	GO:0005739; GO:0005741; GO:0005742; GO:0005743; GO:0005829; GO:0006626; GO:0006811; GO:0008320; GO:0015288; GO:0016021; GO:0030150; GO:0031307; GO:0044233; GO:0045040; GO:0046930	ASDQLQVGVEFEASTR	0.65975	14.0219	9.69399	10.2642	0	0	9.09534	11.5367	0	9.1372	10.7947	12.0158	12.7365	10.5604	10.7498	0
Q9UMX0	UBQL1_HUMAN	Ubiquilin-1 (Protein linking IAP with cytoskeleton 1) (PLIC-1) (hPLIC-1)	UBQLN1 DA41 PLIC1	Homo sapiens (Human)	aggrephagy [GO:0035973]; autophagosome assembly [GO:0000045]; autophagosome maturation [GO:0097352]; cellular response to hypoxia [GO:0071456]; macroautophagy [GO:0016236]; negative regulation of store-operated calcium channel activity [GO:1901340]; negative regulation of toll-like receptor 3 signaling pathway [GO:0034140]; positive regulation of ER-associated ubiquitin-dependent protein catabolic process [GO:1903071]; positive regulation of protein ubiquitination [GO:0031398]; regulation of macroautophagy [GO:0016241]; regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [GO:1902175]; regulation of protein ubiquitination [GO:0031396]; response to endoplasmic reticulum stress [GO:0034976]; ubiquitin-dependent ERAD pathway [GO:0030433]; ubiquitin-dependent protein catabolic process [GO:0006511]	aggresome [GO:0016235]; autophagosome [GO:0005776]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; nucleoplasm [GO:0005654]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; proteasome complex [GO:0000502]; protein-containing complex [GO:0032991]	aggresome [GO:0016235]; autophagosome [GO:0005776]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; nucleoplasm [GO:0005654]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; proteasome complex [GO:0000502]; protein-containing complex [GO:0032991]; identical protein binding [GO:0042802]; kinase binding [GO:0019900]; polyubiquitin modification-dependent protein binding [GO:0031593]; aggrephagy [GO:0035973]; autophagosome assembly [GO:0000045]; autophagosome maturation [GO:0097352]; cellular response to hypoxia [GO:0071456]; macroautophagy [GO:0016236]; negative regulation of store-operated calcium channel activity [GO:1901340]; negative regulation of toll-like receptor 3 signaling pathway [GO:0034140]; positive regulation of ER-associated ubiquitin-dependent protein catabolic process [GO:1903071]; positive regulation of protein ubiquitination [GO:0031398]; regulation of macroautophagy [GO:0016241]; regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [GO:1902175]; regulation of protein ubiquitination [GO:0031396]; response to endoplasmic reticulum stress [GO:0034976]; ubiquitin-dependent ERAD pathway [GO:0030433]; ubiquitin-dependent protein catabolic process [GO:0006511]	identical protein binding [GO:0042802]; kinase binding [GO:0019900]; polyubiquitin modification-dependent protein binding [GO:0031593]	GO:0000045; GO:0000502; GO:0005654; GO:0005737; GO:0005776; GO:0005783; GO:0005829; GO:0005886; GO:0006511; GO:0016235; GO:0016236; GO:0016241; GO:0019900; GO:0030433; GO:0031396; GO:0031398; GO:0031410; GO:0031593; GO:0032991; GO:0034140; GO:0034976; GO:0035973; GO:0042802; GO:0048471; GO:0071456; GO:0097352; GO:1901340; GO:1902175; GO:1903071	AESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMK	0.28788	12.2029	11.0342	10.0228	0	0	0	10.3066	11.9847	11.2082	0	10.7157	11.2195	10.5982	9.5235	10.8488
B4DDK2	B4DDK2_HUMAN	"cDNA FLJ57044, highly similar to Homo sapiens fetal Alzheimer antigen (FALZ), transcript variant 1, mRNA"		Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	NURF complex [GO:0016589]	NURF complex [GO:0016589]; metal ion binding [GO:0046872]; regulation of transcription by RNA polymerase II [GO:0006357]	metal ion binding [GO:0046872]	GO:0006357; GO:0016589; GO:0046872	AKKGDIDNVK	0.89736	11.397	10.6331	0	10.3341	10.4415	0	9.98214	0	10.9722	10.113	10.2104	0	11.8069	11.5277	10.9087
P62987	RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 (CEP52) (Ubiquitin A-52 residue ribosomal protein fusion product 1) [Cleaved into: Ubiquitin; 60S ribosomal protein L40 (Large ribosomal subunit protein eL40)]	UBA52 UBCEP2	Homo sapiens (Human)	cytoplasmic translation [GO:0002181]; modification-dependent protein catabolic process [GO:0019941]; protein modification process [GO:0036211]; protein ubiquitination [GO:0016567]; translation [GO:0006412]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; cytosolic large ribosomal subunit [GO:0022625]; cytosolic ribosome [GO:0022626]; cytosolic small ribosomal subunit [GO:0022627]; endocytic vesicle membrane [GO:0030666]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; lysosomal membrane [GO:0005765]; mitochondrial outer membrane [GO:0005741]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; vesicle [GO:0031982]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; cytosolic large ribosomal subunit [GO:0022625]; cytosolic ribosome [GO:0022626]; cytosolic small ribosomal subunit [GO:0022627]; endocytic vesicle membrane [GO:0030666]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; lysosomal membrane [GO:0005765]; mitochondrial outer membrane [GO:0005741]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; vesicle [GO:0031982]; protein tag [GO:0031386]; structural constituent of ribosome [GO:0003735]; ubiquitin protein ligase binding [GO:0031625]; cytoplasmic translation [GO:0002181]; modification-dependent protein catabolic process [GO:0019941]; protein modification process [GO:0036211]; protein ubiquitination [GO:0016567]; translation [GO:0006412]	protein tag [GO:0031386]; structural constituent of ribosome [GO:0003735]; ubiquitin protein ligase binding [GO:0031625]	GO:0002181; GO:0003735; GO:0005615; GO:0005634; GO:0005654; GO:0005737; GO:0005741; GO:0005765; GO:0005783; GO:0005789; GO:0005829; GO:0005886; GO:0006412; GO:0010008; GO:0016567; GO:0019941; GO:0022625; GO:0022626; GO:0022627; GO:0030666; GO:0031386; GO:0031625; GO:0031982; GO:0036211; GO:0070062	AKIQDKEGIPPDQQR	0.94639	9.99506	11.5685	10.7861	10.347	14.4337	0	0	0	0	10.7208	0	12.0339	14.879	11.4642	11.1854
Q9UBP4	DKK3_HUMAN	Dickkopf-related protein 3 (Dickkopf-3) (Dkk-3) (hDkk-3)	DKK3 REIC UNQ258/PRO295	Homo sapiens (Human)	adrenal gland development [GO:0030325]; anatomical structure morphogenesis [GO:0009653]; negative regulation of aldosterone biosynthetic process [GO:0032348]; negative regulation of anti-Mullerian hormone signaling pathway [GO:1902613]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cortisol biosynthetic process [GO:2000065]; negative regulation of DNA-templated transcription [GO:0045892]; regulation of transforming growth factor beta receptor signaling pathway [GO:0017015]; Wnt signaling pathway [GO:0016055]	extracellular space [GO:0005615]	extracellular space [GO:0005615]; co-receptor binding [GO:0039706]; receptor antagonist activity [GO:0048019]; adrenal gland development [GO:0030325]; anatomical structure morphogenesis [GO:0009653]; negative regulation of aldosterone biosynthetic process [GO:0032348]; negative regulation of anti-Mullerian hormone signaling pathway [GO:1902613]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cortisol biosynthetic process [GO:2000065]; negative regulation of DNA-templated transcription [GO:0045892]; regulation of transforming growth factor beta receptor signaling pathway [GO:0017015]; Wnt signaling pathway [GO:0016055]	co-receptor binding [GO:0039706]; receptor antagonist activity [GO:0048019]	GO:0005615; GO:0009653; GO:0016055; GO:0017015; GO:0030325; GO:0032348; GO:0039706; GO:0045892; GO:0048019; GO:0090090; GO:1902613; GO:2000065	CPCASGLLCQPHSHSLVYVCKPTFVGSR	0.60987	11.5719	9.68236	12.5993	8.96826	0	9.60248	0	0	10.1393	9.80361	11.6064	11.6873	10.854	0	9.7702
B3KSW4	B3KSW4_HUMAN	"Regulator of G-protein-signaling 20 (cDNA FLJ37184 fis, clone BRALZ2001559, highly similar to Regulator of G-protein signaling 20)"	RGS20	Homo sapiens (Human)						DLLQSLSEK	0.98451	0	11.7926	11.8028	11.0591	10.2246	0	0	12.5849	11.7115	9.52368	11.0243	0	0	13.8468	9.69024
B4DFI3	B4DFI3_HUMAN	"CUGBP Elav-like family member 5 (cDNA FLJ52259, highly similar to Homo sapiens bruno-like 5, RNA binding protein, mRNA)"	CELF5	Homo sapiens (Human)			RNA binding [GO:0003723]	RNA binding [GO:0003723]	GO:0003723	ARPIQVKPADSESR	0.93094	0	10.846	10.7244	10.3457	10.1232	0	0	0	0	12.4362	12.0139	11.4607	10.986	10.8966	10.9287
Q0H8T6	Q0H8T6_HUMAN	Hippocampal estrogen receptor alpha isoform TADDI	ESR1	Homo sapiens (Human)	regulation of DNA-templated transcription [GO:0006355]	nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; zinc ion binding [GO:0008270]; regulation of DNA-templated transcription [GO:0006355]	zinc ion binding [GO:0008270]	GO:0005654; GO:0006355; GO:0008270	CYEVGMMKDWPVPMLKHK	0.88291	12.9428	13.2154	0	0	0	11.3611	12.1114	12.7847	11.9585	0	11.196	0	0	12.2761	12.3522
Q9NYA1	SPHK1_HUMAN	Sphingosine kinase 1 (SK 1) (SPK 1) (EC 2.7.1.91) (Acetyltransferase SPHK1) (EC 2.3.1.-)	SPHK1 SK1 SPHK SPK	Homo sapiens (Human)	blood vessel development [GO:0001568]; brain development [GO:0007420]; calcium-mediated signaling [GO:0019722]; cell population proliferation [GO:0008283]; cellular response to growth factor stimulus [GO:0071363]; cellular response to hydrogen peroxide [GO:0070301]; cellular response to vascular endothelial growth factor stimulus [GO:0035924]; DNA biosynthetic process [GO:0071897]; inflammatory response [GO:0006954]; intracellular signal transduction [GO:0035556]; negative regulation of apoptotic process [GO:0043066]; negative regulation of ceramide biosynthetic process [GO:1900060]; phosphorylation [GO:0016310]; positive regulation of angiogenesis [GO:0045766]; positive regulation of cell growth [GO:0030307]; positive regulation of cell migration [GO:0030335]; positive regulation of fibroblast proliferation [GO:0048146]; positive regulation of interleukin-17 production [GO:0032740]; positive regulation of mitotic cell cycle [GO:0045931]; positive regulation of mitotic nuclear division [GO:0045840]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of p38MAPK cascade [GO:1900745]; positive regulation of peptidyl-threonine phosphorylation [GO:0010800]; positive regulation of protein ubiquitination [GO:0031398]; positive regulation of smooth muscle contraction [GO:0045987]; protein acetylation [GO:0006473]; regulation of endocytosis [GO:0030100]; regulation of endosomal vesicle fusion [GO:1905364]; regulation of interleukin-1 beta production [GO:0032651]; regulation of microglial cell activation [GO:1903978]; regulation of neuroinflammatory response [GO:0150077]; regulation of phagocytosis [GO:0050764]; regulation of tumor necrosis factor-mediated signaling pathway [GO:0010803]; response to tumor necrosis factor [GO:0034612]; sphingoid catabolic process [GO:0046521]; sphingolipid biosynthetic process [GO:0030148]; sphingolipid metabolic process [GO:0006665]; sphingosine biosynthetic process [GO:0046512]; sphingosine metabolic process [GO:0006670]	anchoring junction [GO:0070161]; clathrin-coated pit [GO:0005905]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; early endosome membrane [GO:0031901]; endocytic vesicle [GO:0030139]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; presynapse [GO:0098793]	anchoring junction [GO:0070161]; clathrin-coated pit [GO:0005905]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; early endosome membrane [GO:0031901]; endocytic vesicle [GO:0030139]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; presynapse [GO:0098793]; acetyltransferase activity [GO:0016407]; ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; D-erythro-sphingosine kinase activity [GO:0017050]; DNA binding [GO:0003677]; lipid binding [GO:0008289]; lipid kinase activity [GO:0001727]; magnesium ion binding [GO:0000287]; protein phosphatase 2A binding [GO:0051721]; sphinganine kinase activity [GO:0008481]; sphingosine-1-phosphate receptor activity [GO:0038036]; blood vessel development [GO:0001568]; brain development [GO:0007420]; calcium-mediated signaling [GO:0019722]; cell population proliferation [GO:0008283]; cellular response to growth factor stimulus [GO:0071363]; cellular response to hydrogen peroxide [GO:0070301]; cellular response to vascular endothelial growth factor stimulus [GO:0035924]; DNA biosynthetic process [GO:0071897]; inflammatory response [GO:0006954]; intracellular signal transduction [GO:0035556]; negative regulation of apoptotic process [GO:0043066]; negative regulation of ceramide biosynthetic process [GO:1900060]; phosphorylation [GO:0016310]; positive regulation of angiogenesis [GO:0045766]; positive regulation of cell growth [GO:0030307]; positive regulation of cell migration [GO:0030335]; positive regulation of fibroblast proliferation [GO:0048146]; positive regulation of interleukin-17 production [GO:0032740]; positive regulation of mitotic cell cycle [GO:0045931]; positive regulation of mitotic nuclear division [GO:0045840]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of p38MAPK cascade [GO:1900745]; positive regulation of peptidyl-threonine phosphorylation [GO:0010800]; positive regulation of protein ubiquitination [GO:0031398]; positive regulation of smooth muscle contraction [GO:0045987]; protein acetylation [GO:0006473]; regulation of endocytosis [GO:0030100]; regulation of endosomal vesicle fusion [GO:1905364]; regulation of interleukin-1 beta production [GO:0032651]; regulation of microglial cell activation [GO:1903978]; regulation of neuroinflammatory response [GO:0150077]; regulation of phagocytosis [GO:0050764]; regulation of tumor necrosis factor-mediated signaling pathway [GO:0010803]; response to tumor necrosis factor [GO:0034612]; sphingoid catabolic process [GO:0046521]; sphingolipid biosynthetic process [GO:0030148]; sphingolipid metabolic process [GO:0006665]; sphingosine biosynthetic process [GO:0046512]; sphingosine metabolic process [GO:0006670]	acetyltransferase activity [GO:0016407]; ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; D-erythro-sphingosine kinase activity [GO:0017050]; DNA binding [GO:0003677]; lipid binding [GO:0008289]; lipid kinase activity [GO:0001727]; magnesium ion binding [GO:0000287]; protein phosphatase 2A binding [GO:0051721]; sphinganine kinase activity [GO:0008481]; sphingosine-1-phosphate receptor activity [GO:0038036]	GO:0000287; GO:0001568; GO:0001727; GO:0003677; GO:0005516; GO:0005524; GO:0005634; GO:0005737; GO:0005829; GO:0005886; GO:0005905; GO:0006473; GO:0006665; GO:0006670; GO:0006954; GO:0007420; GO:0008283; GO:0008289; GO:0008481; GO:0010800; GO:0010803; GO:0016020; GO:0016310; GO:0016407; GO:0017050; GO:0019722; GO:0030100; GO:0030139; GO:0030148; GO:0030307; GO:0030335; GO:0031398; GO:0031901; GO:0032651; GO:0032740; GO:0034612; GO:0035556; GO:0035924; GO:0038036; GO:0043066; GO:0043231; GO:0045766; GO:0045840; GO:0045931; GO:0045987; GO:0046512; GO:0046521; GO:0048146; GO:0050764; GO:0051092; GO:0051721; GO:0070161; GO:0070301; GO:0071363; GO:0071897; GO:0098793; GO:0150077; GO:1900060; GO:1900745; GO:1901224; GO:1903978; GO:1905364	AGVSRAMLLR	1.0146	11.8312	0	0	8.47123	9.9884	11.2032	8.60566	10.7192	10.4498	8.2465	0	0	9.95067	9.62412	10.8254
P32929	CGL_HUMAN	Cystathionine gamma-lyase (CGL) (CSE) (EC 4.4.1.1) (Cysteine desulfhydrase) (Cysteine-protein sulfhydrase) (Gamma-cystathionase) (Homocysteine desulfhydrase) (EC 4.4.1.2)	CTH	Homo sapiens (Human)	cellular response to leukemia inhibitory factor [GO:1990830]; cysteine biosynthetic process [GO:0019344]; cysteine biosynthetic process via cystathionine [GO:0019343]; cysteine metabolic process [GO:0006534]; endoplasmic reticulum unfolded protein response [GO:0030968]; hydrogen sulfide biosynthetic process [GO:0070814]; lipid metabolic process [GO:0006629]; negative regulation of apoptotic signaling pathway [GO:2001234]; positive regulation of aortic smooth muscle cell differentiation [GO:1904831]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; protein homotetramerization [GO:0051289]; protein sulfhydration [GO:0044524]; protein-pyridoxal-5-phosphate linkage via peptidyl-N6-pyridoxal phosphate-L-lysine [GO:0018272]; transsulfuration [GO:0019346]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; calmodulin binding [GO:0005516]; carbon-sulfur lyase activity [GO:0016846]; cystathionine gamma-lyase activity [GO:0004123]; homocysteine desulfhydrase activity [GO:0047982]; identical protein binding [GO:0042802]; L-cysteine desulfhydrase activity [GO:0080146]; L-cystine L-cysteine-lyase (deaminating) [GO:0044540]; pyridoxal phosphate binding [GO:0030170]; selenocystathionine gamma-lyase activity [GO:0098606]; cellular response to leukemia inhibitory factor [GO:1990830]; cysteine biosynthetic process [GO:0019344]; cysteine biosynthetic process via cystathionine [GO:0019343]; cysteine metabolic process [GO:0006534]; endoplasmic reticulum unfolded protein response [GO:0030968]; hydrogen sulfide biosynthetic process [GO:0070814]; lipid metabolic process [GO:0006629]; negative regulation of apoptotic signaling pathway [GO:2001234]; positive regulation of aortic smooth muscle cell differentiation [GO:1904831]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; protein homotetramerization [GO:0051289]; protein sulfhydration [GO:0044524]; protein-pyridoxal-5-phosphate linkage via peptidyl-N6-pyridoxal phosphate-L-lysine [GO:0018272]; transsulfuration [GO:0019346]	calmodulin binding [GO:0005516]; carbon-sulfur lyase activity [GO:0016846]; cystathionine gamma-lyase activity [GO:0004123]; homocysteine desulfhydrase activity [GO:0047982]; identical protein binding [GO:0042802]; L-cysteine desulfhydrase activity [GO:0080146]; L-cystine L-cysteine-lyase (deaminating) [GO:0044540]; pyridoxal phosphate binding [GO:0030170]; selenocystathionine gamma-lyase activity [GO:0098606]	GO:0004123; GO:0005516; GO:0005737; GO:0005829; GO:0006534; GO:0006629; GO:0016846; GO:0018272; GO:0019343; GO:0019344; GO:0019346; GO:0030170; GO:0030968; GO:0042802; GO:0043123; GO:0044524; GO:0044540; GO:0047982; GO:0051092; GO:0051289; GO:0070062; GO:0070814; GO:0080146; GO:0098606; GO:1904831; GO:1990830; GO:2001234	AAHPPSGSHS	0.93075	9.38724	9.51495	10.7484	9.53327	9.31773	0	0	9.3576	9.01246	10.782	10.1685	10.9699	8.70788	0	0
B7Z1Z5	B7Z1Z5_HUMAN	"Neurotrimin (cDNA FLJ57265, highly similar to Neurotrimin)"	NTM	Homo sapiens (Human)						AGCVWLLPLLVLHLLLK	0.92978	9.25621	9.10617	11.8409	0	0	0	0	10.8953	11.6198	9.82836	11.6658	11.214	9.12928	0	11.2905
B4DFK0	B4DFK0_HUMAN	"cDNA FLJ57352, highly similar to Mus musculus embryonic ectoderm development (Eed), mRNA"		Homo sapiens (Human)	histone methylation [GO:0016571]	ESC/E(Z) complex [GO:0035098]	ESC/E(Z) complex [GO:0035098]; histone methylation [GO:0016571]		GO:0016571; GO:0035098	CKYSFKCVNSLK	0.88182	0	12.7985	8.86044	0	0	0	13.9721	13.9169	13.7117	14.077	14.0827	14.2628	0	0	0
P04156	PRIO_HUMAN	Major prion protein (PrP) (ASCR) (PrP27-30) (PrP33-35C) (CD antigen CD230)	PRNP ALTPRP PRIP PRP	Homo sapiens (Human)	activation of protein kinase activity [GO:0032147]; calcium-mediated signaling using intracellular calcium source [GO:0035584]; cell cycle [GO:0007049]; cellular copper ion homeostasis [GO:0006878]; cellular response to amyloid-beta [GO:1904646]; cellular response to copper ion [GO:0071280]; cellular response to xenobiotic stimulus [GO:0071466]; dendritic spine maintenance [GO:0097062]; learning or memory [GO:0007611]; long-term memory [GO:0007616]; negative regulation of activated T cell proliferation [GO:0046007]; negative regulation of amyloid precursor protein catabolic process [GO:1902992]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of apoptotic process [GO:0043066]; negative regulation of calcineurin-NFAT signaling cascade [GO:0070885]; negative regulation of dendritic spine maintenance [GO:1902951]; negative regulation of DNA-binding transcription factor activity [GO:0043433]; negative regulation of interferon-gamma production [GO:0032689]; negative regulation of interleukin-17 production [GO:0032700]; negative regulation of interleukin-2 production [GO:0032703]; negative regulation of long-term synaptic potentiation [GO:1900272]; negative regulation of protein phosphorylation [GO:0001933]; negative regulation of protein processing [GO:0010955]; negative regulation of T cell receptor signaling pathway [GO:0050860]; neuron projection maintenance [GO:1990535]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of neuron death [GO:1901216]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of protein targeting to membrane [GO:0090314]; positive regulation of protein tyrosine kinase activity [GO:0061098]; protein destabilization [GO:0031648]; protein homooligomerization [GO:0051260]; regulation of calcium ion import across plasma membrane [GO:1905664]; regulation of cell cycle [GO:0051726]; regulation of glutamate receptor signaling pathway [GO:1900449]; regulation of intracellular calcium activated chloride channel activity [GO:1902938]; regulation of peptidyl-tyrosine phosphorylation [GO:0050730]; regulation of potassium ion transmembrane transport [GO:1901379]; response to amyloid-beta [GO:1904645]; response to cadmium ion [GO:0046686]; response to oxidative stress [GO:0006979]	anchored component of external side of plasma membrane [GO:0031362]; cell surface [GO:0009986]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; endoplasmic reticulum [GO:0005783]; extracellular exosome [GO:0070062]; extrinsic component of membrane [GO:0019898]; Golgi apparatus [GO:0005794]; inclusion body [GO:0016234]; intracellular membrane-bounded organelle [GO:0043231]; membrane raft [GO:0045121]; nuclear membrane [GO:0031965]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; postsynaptic density [GO:0014069]; terminal bouton [GO:0043195]	anchored component of external side of plasma membrane [GO:0031362]; cell surface [GO:0009986]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; endoplasmic reticulum [GO:0005783]; extracellular exosome [GO:0070062]; extrinsic component of membrane [GO:0019898]; Golgi apparatus [GO:0005794]; inclusion body [GO:0016234]; intracellular membrane-bounded organelle [GO:0043231]; membrane raft [GO:0045121]; nuclear membrane [GO:0031965]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; postsynaptic density [GO:0014069]; terminal bouton [GO:0043195]; amyloid-beta binding [GO:0001540]; aspartic-type endopeptidase inhibitor activity [GO:0019828]; ATP-dependent protein binding [GO:0043008]; calcium ion binding [GO:0005509]; chaperone binding [GO:0051087]; copper ion binding [GO:0005507]; cupric ion binding [GO:1903135]; cuprous ion binding [GO:1903136]; glycosaminoglycan binding [GO:0005539]; identical protein binding [GO:0042802]; lamin binding [GO:0005521]; microtubule binding [GO:0008017]; molecular adaptor activity [GO:0060090]; molecular condensate scaffold activity [GO:0140693]; molecular function activator activity [GO:0140677]; protease binding [GO:0002020]; protein sequestering activity [GO:0140311]; protein-containing complex binding [GO:0044877]; signaling receptor activity [GO:0038023]; transmembrane transporter binding [GO:0044325]; tubulin binding [GO:0015631]; type 5 metabotropic glutamate receptor binding [GO:0031802]; activation of protein kinase activity [GO:0032147]; calcium-mediated signaling using intracellular calcium source [GO:0035584]; cell cycle [GO:0007049]; cellular copper ion homeostasis [GO:0006878]; cellular response to amyloid-beta [GO:1904646]; cellular response to copper ion [GO:0071280]; cellular response to xenobiotic stimulus [GO:0071466]; dendritic spine maintenance [GO:0097062]; learning or memory [GO:0007611]; long-term memory [GO:0007616]; negative regulation of activated T cell proliferation [GO:0046007]; negative regulation of amyloid precursor protein catabolic process [GO:1902992]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of apoptotic process [GO:0043066]; negative regulation of calcineurin-NFAT signaling cascade [GO:0070885]; negative regulation of dendritic spine maintenance [GO:1902951]; negative regulation of DNA-binding transcription factor activity [GO:0043433]; negative regulation of interferon-gamma production [GO:0032689]; negative regulation of interleukin-17 production [GO:0032700]; negative regulation of interleukin-2 production [GO:0032703]; negative regulation of long-term synaptic potentiation [GO:1900272]; negative regulation of protein phosphorylation [GO:0001933]; negative regulation of protein processing [GO:0010955]; negative regulation of T cell receptor signaling pathway [GO:0050860]; neuron projection maintenance [GO:1990535]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of neuron death [GO:1901216]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of protein targeting to membrane [GO:0090314]; positive regulation of protein tyrosine kinase activity [GO:0061098]; protein destabilization [GO:0031648]; protein homooligomerization [GO:0051260]; regulation of calcium ion import across plasma membrane [GO:1905664]; regulation of cell cycle [GO:0051726]; regulation of glutamate receptor signaling pathway [GO:1900449]; regulation of intracellular calcium activated chloride channel activity [GO:1902938]; regulation of peptidyl-tyrosine phosphorylation [GO:0050730]; regulation of potassium ion transmembrane transport [GO:1901379]; response to amyloid-beta [GO:1904645]; response to cadmium ion [GO:0046686]; response to oxidative stress [GO:0006979]	amyloid-beta binding [GO:0001540]; aspartic-type endopeptidase inhibitor activity [GO:0019828]; ATP-dependent protein binding [GO:0043008]; calcium ion binding [GO:0005509]; chaperone binding [GO:0051087]; copper ion binding [GO:0005507]; cupric ion binding [GO:1903135]; cuprous ion binding [GO:1903136]; glycosaminoglycan binding [GO:0005539]; identical protein binding [GO:0042802]; lamin binding [GO:0005521]; microtubule binding [GO:0008017]; molecular adaptor activity [GO:0060090]; molecular condensate scaffold activity [GO:0140693]; molecular function activator activity [GO:0140677]; protease binding [GO:0002020]; protein sequestering activity [GO:0140311]; protein-containing complex binding [GO:0044877]; signaling receptor activity [GO:0038023]; transmembrane transporter binding [GO:0044325]; tubulin binding [GO:0015631]; type 5 metabotropic glutamate receptor binding [GO:0031802]	GO:0001540; GO:0001933; GO:0002020; GO:0005507; GO:0005509; GO:0005521; GO:0005539; GO:0005634; GO:0005737; GO:0005783; GO:0005794; GO:0005829; GO:0005886; GO:0006878; GO:0006979; GO:0007049; GO:0007611; GO:0007616; GO:0008017; GO:0009986; GO:0010955; GO:0014069; GO:0015631; GO:0016234; GO:0019828; GO:0019898; GO:0030425; GO:0031362; GO:0031648; GO:0031802; GO:0031965; GO:0032147; GO:0032689; GO:0032700; GO:0032703; GO:0035584; GO:0038023; GO:0042802; GO:0043008; GO:0043066; GO:0043195; GO:0043231; GO:0043433; GO:0043525; GO:0044325; GO:0044877; GO:0045121; GO:0046007; GO:0046686; GO:0050730; GO:0050731; GO:0050860; GO:0051087; GO:0051260; GO:0051726; GO:0060090; GO:0061098; GO:0070062; GO:0070885; GO:0071280; GO:0071466; GO:0090314; GO:0097062; GO:0098794; GO:0140311; GO:0140677; GO:0140693; GO:1900272; GO:1900449; GO:1901216; GO:1901379; GO:1902430; GO:1902938; GO:1902951; GO:1902992; GO:1903078; GO:1903135; GO:1903136; GO:1904645; GO:1904646; GO:1905664; GO:1990535	GENFTETDVK	0.2037	10.0709	12.3674	11.834	11.7796	0	0	10.1584	0	0	12.8222	13.05	11.8818	10.5338	0	0
Q6RRM1	Q6RRM1_HUMAN	NADH-ubiquinone oxidoreductase chain 1 (EC 7.1.1.2)	ND1 MTND1	Homo sapiens (Human)		integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]	NADH dehydrogenase (ubiquinone) activity [GO:0008137]	GO:0005743; GO:0008137; GO:0016021	GPNVVGPYGLLQPFADAMK	0.48128	10.2929	0	11.264	11.0338	0	0	11.4494	11.5556	11.7958	12.1193	11.9363	11.8812	0	0	0
P07339	CATD_HUMAN	Cathepsin D (EC 3.4.23.5) [Cleaved into: Cathepsin D light chain; Cathepsin D heavy chain]	CTSD CPSD	Homo sapiens (Human)	antigen processing and presentation of exogenous peptide antigen via MHC class II [GO:0019886]; autophagosome assembly [GO:0000045]; lipoprotein catabolic process [GO:0042159]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; proteolysis [GO:0006508]; regulation of establishment of protein localization [GO:0070201]	collagen-containing extracellular matrix [GO:0062023]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; lysosomal lumen [GO:0043202]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; melanosome [GO:0042470]; membrane raft [GO:0045121]; specific granule lumen [GO:0035580]; tertiary granule lumen [GO:1904724]	collagen-containing extracellular matrix [GO:0062023]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; lysosomal lumen [GO:0043202]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; melanosome [GO:0042470]; membrane raft [GO:0045121]; specific granule lumen [GO:0035580]; tertiary granule lumen [GO:1904724]; aspartic-type endopeptidase activity [GO:0004190]; aspartic-type peptidase activity [GO:0070001]; cysteine-type endopeptidase activity [GO:0004197]; peptidase activity [GO:0008233]; antigen processing and presentation of exogenous peptide antigen via MHC class II [GO:0019886]; autophagosome assembly [GO:0000045]; lipoprotein catabolic process [GO:0042159]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; proteolysis [GO:0006508]; regulation of establishment of protein localization [GO:0070201]	aspartic-type endopeptidase activity [GO:0004190]; aspartic-type peptidase activity [GO:0070001]; cysteine-type endopeptidase activity [GO:0004197]; peptidase activity [GO:0008233]	GO:0000045; GO:0004190; GO:0004197; GO:0005576; GO:0005615; GO:0005764; GO:0005765; GO:0006508; GO:0008233; GO:0010008; GO:0019886; GO:0035580; GO:0042159; GO:0042470; GO:0043065; GO:0043202; GO:0043280; GO:0045121; GO:0062023; GO:0070001; GO:0070062; GO:0070201; GO:1904724; GO:1904813	DNNRVGFAEAAR	0.9536	11.2019	8.74228	11.3881	0	0	0	8.958	0	10.7306	11.125	10.6171	12.2819	9.03105	0	8.82439
B2R966	B2R966_HUMAN	"cDNA, FLJ94239"		Homo sapiens (Human)	bicellular tight junction assembly [GO:0070830]		bicellular tight junction assembly [GO:0070830]		GO:0070830	AIREAQWGQNR	0.93701	9.50032	0	0	0	9.65168	11.2692	0	10.4343	10.0868	11.1927	10.8175	10.7392	8.70141	10.4466	0
Q8NBC4	CT203_HUMAN	Uncharacterized protein C20orf203	C20orf203	Homo sapiens (Human)		cytoplasm [GO:0005737]	cytoplasm [GO:0005737]		GO:0005737	AMGGMPR	0.88088	10.0097	11.0169	11.1191	0	10.1478	0	0	0	11.9442	13.2587	14.2149	0	0	9.6196	9.46316
Q96L46	CPNS2_HUMAN	Calpain small subunit 2 (CSS2) (Calcium-dependent protease small subunit 2)	CAPNS2	Homo sapiens (Human)		calpain complex [GO:0110158]; cytosol [GO:0005829]; plasma membrane [GO:0005886]	calpain complex [GO:0110158]; cytosol [GO:0005829]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; calcium-dependent cysteine-type endopeptidase activity [GO:0004198]	calcium ion binding [GO:0005509]; calcium-dependent cysteine-type endopeptidase activity [GO:0004198]	GO:0004198; GO:0005509; GO:0005829; GO:0005886; GO:0110158	AFKSLDRDR	0.8845	0	0	9.17333	9.19609	0	0	9.8867	10.8577	0	13.2965	12.8505	12.3784	11.0437	11.8498	0
Q4V9L6	TM119_HUMAN	Transmembrane protein 119 (Osteoblast induction factor) (OBIF)	TMEM119 PSEC0199 UNQ731/PRO1415	Homo sapiens (Human)	biomineral tissue development [GO:0031214]; endochondral ossification [GO:0001958]; negative regulation of bone resorption [GO:0045779]; negative regulation of myotube differentiation [GO:0010832]; osteoblast differentiation [GO:0001649]; positive regulation of bone development [GO:1903012]; positive regulation of bone mineralization [GO:0030501]; positive regulation of gene expression [GO:0010628]; positive regulation of osteoblast differentiation [GO:0045669]; positive regulation of osteoblast proliferation [GO:0033690]; positive regulation of protein phosphorylation [GO:0001934]; spermatid differentiation [GO:0048515]; spermatogenesis [GO:0007283]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; biomineral tissue development [GO:0031214]; endochondral ossification [GO:0001958]; negative regulation of bone resorption [GO:0045779]; negative regulation of myotube differentiation [GO:0010832]; osteoblast differentiation [GO:0001649]; positive regulation of bone development [GO:1903012]; positive regulation of bone mineralization [GO:0030501]; positive regulation of gene expression [GO:0010628]; positive regulation of osteoblast differentiation [GO:0045669]; positive regulation of osteoblast proliferation [GO:0033690]; positive regulation of protein phosphorylation [GO:0001934]; spermatid differentiation [GO:0048515]; spermatogenesis [GO:0007283]		GO:0001649; GO:0001934; GO:0001958; GO:0005789; GO:0005886; GO:0007283; GO:0010628; GO:0010832; GO:0016021; GO:0030501; GO:0031214; GO:0033690; GO:0045669; GO:0045779; GO:0048515; GO:1903012	AALGGGDGAR	0.94505	11.2063	10.5624	10.6093	0	0	0	0	10.7331	10.6314	11.7184	10.8855	12.4846	0	0	10.9181
P08174	DAF_HUMAN	Complement decay-accelerating factor (CD antigen CD55)	CD55 CR DAF	Homo sapiens (Human)	"complement activation, classical pathway [GO:0006958]; innate immune response [GO:0045087]; negative regulation of complement activation [GO:0045916]; negative regulation of complement activation, classical pathway [GO:0045959]; positive regulation of CD4-positive, alpha-beta T cell activation [GO:2000516]; positive regulation of CD4-positive, alpha-beta T cell proliferation [GO:2000563]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of T cell cytokine production [GO:0002726]; regulation of complement activation [GO:0030449]; regulation of complement-dependent cytotoxicity [GO:1903659]; regulation of lipopolysaccharide-mediated signaling pathway [GO:0031664]; respiratory burst [GO:0045730]; T cell mediated immunity [GO:0002456]"	anchored component of membrane [GO:0031225]; cell surface [GO:0009986]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; ficolin-1-rich granule membrane [GO:0101003]; Golgi membrane [GO:0000139]; membrane raft [GO:0045121]; plasma membrane [GO:0005886]; secretory granule membrane [GO:0030667]; transport vesicle [GO:0030133]	"anchored component of membrane [GO:0031225]; cell surface [GO:0009986]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; ficolin-1-rich granule membrane [GO:0101003]; Golgi membrane [GO:0000139]; membrane raft [GO:0045121]; plasma membrane [GO:0005886]; secretory granule membrane [GO:0030667]; transport vesicle [GO:0030133]; lipid binding [GO:0008289]; virus receptor activity [GO:0001618]; complement activation, classical pathway [GO:0006958]; innate immune response [GO:0045087]; negative regulation of complement activation [GO:0045916]; negative regulation of complement activation, classical pathway [GO:0045959]; positive regulation of CD4-positive, alpha-beta T cell activation [GO:2000516]; positive regulation of CD4-positive, alpha-beta T cell proliferation [GO:2000563]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of T cell cytokine production [GO:0002726]; regulation of complement activation [GO:0030449]; regulation of complement-dependent cytotoxicity [GO:1903659]; regulation of lipopolysaccharide-mediated signaling pathway [GO:0031664]; respiratory burst [GO:0045730]; T cell mediated immunity [GO:0002456]"	lipid binding [GO:0008289]; virus receptor activity [GO:0001618]	GO:0000139; GO:0001618; GO:0002456; GO:0002726; GO:0005576; GO:0005886; GO:0006958; GO:0007204; GO:0008289; GO:0009986; GO:0030133; GO:0030449; GO:0030667; GO:0031225; GO:0031664; GO:0033116; GO:0045087; GO:0045121; GO:0045730; GO:0045916; GO:0045959; GO:0070062; GO:0101003; GO:1903659; GO:2000516; GO:2000563	CEESFVK	0.98333	12.3932	9.3689	10.9186	9.86908	0	9.69699	11.4755	10.9948	11.7364	12.2623	0	0	0	0	0
P0CG47	UBB_HUMAN	Polyubiquitin-B [Cleaved into: Ubiquitin]	UBB	Homo sapiens (Human)	energy homeostasis [GO:0097009]; fat pad development [GO:0060613]; female gonad development [GO:0008585]; female meiosis I [GO:0007144]; hypothalamus gonadotrophin-releasing hormone neuron development [GO:0021888]; male meiosis I [GO:0007141]; mitochondrion transport along microtubule [GO:0047497]; modification-dependent protein catabolic process [GO:0019941]; neuron projection morphogenesis [GO:0048812]; positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [GO:1902255]; positive regulation of protein monoubiquitination [GO:1902527]; positive regulation of protein ubiquitination [GO:0031398]; protein ubiquitination [GO:0016567]; regulation of mitochondrial membrane potential [GO:0051881]; regulation of neuron death [GO:1901214]; regulation of proteasomal protein catabolic process [GO:0061136]; seminiferous tubule development [GO:0072520]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endocytic vesicle membrane [GO:0030666]; endoplasmic reticulum membrane [GO:0005789]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; extrinsic component of mitochondrial outer membrane [GO:0031315]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; vesicle [GO:0031982]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endocytic vesicle membrane [GO:0030666]; endoplasmic reticulum membrane [GO:0005789]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; extrinsic component of mitochondrial outer membrane [GO:0031315]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; vesicle [GO:0031982]; protein tag [GO:0031386]; ubiquitin protein ligase binding [GO:0031625]; energy homeostasis [GO:0097009]; fat pad development [GO:0060613]; female gonad development [GO:0008585]; female meiosis I [GO:0007144]; hypothalamus gonadotrophin-releasing hormone neuron development [GO:0021888]; male meiosis I [GO:0007141]; mitochondrion transport along microtubule [GO:0047497]; modification-dependent protein catabolic process [GO:0019941]; neuron projection morphogenesis [GO:0048812]; positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [GO:1902255]; positive regulation of protein monoubiquitination [GO:1902527]; positive regulation of protein ubiquitination [GO:0031398]; protein ubiquitination [GO:0016567]; regulation of mitochondrial membrane potential [GO:0051881]; regulation of neuron death [GO:1901214]; regulation of proteasomal protein catabolic process [GO:0061136]; seminiferous tubule development [GO:0072520]	protein tag [GO:0031386]; ubiquitin protein ligase binding [GO:0031625]	GO:0005615; GO:0005634; GO:0005654; GO:0005737; GO:0005739; GO:0005741; GO:0005789; GO:0005829; GO:0005886; GO:0007141; GO:0007144; GO:0008585; GO:0010008; GO:0016567; GO:0019941; GO:0021888; GO:0030666; GO:0031315; GO:0031386; GO:0031398; GO:0031625; GO:0031982; GO:0043005; GO:0043025; GO:0047497; GO:0048812; GO:0051881; GO:0060613; GO:0061136; GO:0070062; GO:0072520; GO:0097009; GO:1901214; GO:1902255; GO:1902527	AKIQDKEGIPPDQQR	0.86	13.5422	8.4184	13.6832	12.1924	0	12.1319	0	0	0	0	0	0	12.61	12.7402	12.822
P32119	PRDX2_HUMAN	Peroxiredoxin-2 (EC 1.11.1.24) (Natural killer cell-enhancing factor B) (NKEF-B) (PRP) (Thiol-specific antioxidant protein) (TSA) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thioredoxin-dependent peroxiredoxin 2)	PRDX2 NKEFB TDPX1	Homo sapiens (Human)	cell redox homeostasis [GO:0045454]; cellular response to oxidative stress [GO:0034599]; defense response to tumor cell [GO:0002357]; extrinsic apoptotic signaling pathway [GO:0097191]; hydrogen peroxide catabolic process [GO:0042744]; leukocyte activation [GO:0045321]; negative regulation of apoptotic process [GO:0043066]; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001240]; negative regulation of lipopolysaccharide-mediated signaling pathway [GO:0031665]; negative regulation of NF-kappaB transcription factor activity [GO:0032088]; negative regulation of T cell differentiation [GO:0045581]; positive regulation of blood coagulation [GO:0030194]; positive regulation of MAPK cascade [GO:0043410]; regulation of apoptotic process [GO:0042981]; regulation of hydrogen peroxide metabolic process [GO:0010310]; removal of superoxide radicals [GO:0019430]; respiratory burst involved in inflammatory response [GO:0002536]; response to lipopolysaccharide [GO:0032496]; response to oxidative stress [GO:0006979]; T cell homeostasis [GO:0043029]; T cell proliferation [GO:0042098]; thymus development [GO:0048538]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; antioxidant activity [GO:0016209]; thioredoxin peroxidase activity [GO:0008379]; thioredoxin-dependent peroxiredoxin activity [GO:0140824]; cell redox homeostasis [GO:0045454]; cellular response to oxidative stress [GO:0034599]; defense response to tumor cell [GO:0002357]; extrinsic apoptotic signaling pathway [GO:0097191]; hydrogen peroxide catabolic process [GO:0042744]; leukocyte activation [GO:0045321]; negative regulation of apoptotic process [GO:0043066]; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001240]; negative regulation of lipopolysaccharide-mediated signaling pathway [GO:0031665]; negative regulation of NF-kappaB transcription factor activity [GO:0032088]; negative regulation of T cell differentiation [GO:0045581]; positive regulation of blood coagulation [GO:0030194]; positive regulation of MAPK cascade [GO:0043410]; regulation of apoptotic process [GO:0042981]; regulation of hydrogen peroxide metabolic process [GO:0010310]; removal of superoxide radicals [GO:0019430]; respiratory burst involved in inflammatory response [GO:0002536]; response to lipopolysaccharide [GO:0032496]; response to oxidative stress [GO:0006979]; T cell homeostasis [GO:0043029]; T cell proliferation [GO:0042098]; thymus development [GO:0048538]	antioxidant activity [GO:0016209]; thioredoxin peroxidase activity [GO:0008379]; thioredoxin-dependent peroxiredoxin activity [GO:0140824]	GO:0002357; GO:0002536; GO:0005737; GO:0005829; GO:0006979; GO:0008379; GO:0010310; GO:0016209; GO:0019430; GO:0030194; GO:0031665; GO:0032088; GO:0032496; GO:0034599; GO:0042098; GO:0042744; GO:0042981; GO:0043029; GO:0043066; GO:0043410; GO:0045321; GO:0045454; GO:0045581; GO:0048538; GO:0070062; GO:0097191; GO:0140824; GO:2001240	ASGNARIGKPAPDFK	0.84228	0	12.1561	0	0	0	8.35614	0	8.52297	12.8106	10.6171	9.4003	13.2663	0	9.15449	13.115
Q6NXT4	ZNT6_HUMAN	Zinc transporter 6 (ZnT-6) (Solute carrier family 30 member 6)	SLC30A6 ZNT6	Homo sapiens (Human)	cellular zinc ion homeostasis [GO:0006882]; insulin processing [GO:0030070]; zinc ion import into organelle [GO:0062111]; zinc ion transmembrane transport [GO:0071577]; zinc ion transport [GO:0006829]	Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; zinc ion transmembrane transporter activity [GO:0005385]; cellular zinc ion homeostasis [GO:0006882]; insulin processing [GO:0030070]; zinc ion import into organelle [GO:0062111]; zinc ion transmembrane transport [GO:0071577]; zinc ion transport [GO:0006829]	zinc ion transmembrane transporter activity [GO:0005385]	GO:0000139; GO:0005385; GO:0005794; GO:0006829; GO:0006882; GO:0016021; GO:0030070; GO:0062111; GO:0071577	DANEQMVLAHVTNR	0.94565	0	11.3626	0	10.3968	10.3771	0	10.601	10.3112	10.0951	0	11.223	0	0	11.0228	11.8139
P04632	CPNS1_HUMAN	Calpain small subunit 1 (CSS1) (Calcium-activated neutral proteinase small subunit) (CANP small subunit) (Calcium-dependent protease small subunit) (CDPS) (Calcium-dependent protease small subunit 1) (Calpain regulatory subunit)	CAPNS1 CAPN4 CAPNS	Homo sapiens (Human)	positive regulation of cell population proliferation [GO:0008284]; proteolysis [GO:0006508]; regulation of macroautophagy [GO:0016241]	calpain complex [GO:0110158]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; membrane [GO:0016020]; plasma membrane [GO:0005886]	calpain complex [GO:0110158]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; membrane [GO:0016020]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; calcium-dependent cysteine-type endopeptidase activity [GO:0004198]; positive regulation of cell population proliferation [GO:0008284]; proteolysis [GO:0006508]; regulation of macroautophagy [GO:0016241]	calcium ion binding [GO:0005509]; calcium-dependent cysteine-type endopeptidase activity [GO:0004198]	GO:0004198; GO:0005509; GO:0005829; GO:0005886; GO:0006508; GO:0008284; GO:0016020; GO:0016241; GO:0070062; GO:0110158	DGTGQIQVNIQEWLQLTMYS	0	9.51881	0	0	0	11.0606	0	0	10.3052	12.3138	10.0456	10.3865	8.64548	11.9896	12.0229	0
P48023	TNFL6_HUMAN	"Tumor necrosis factor ligand superfamily member 6 (Apoptosis antigen ligand) (APTL) (CD95 ligand) (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD antigen CD178) [Cleaved into: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble form (Receptor-binding FasL ectodomain) (Soluble Fas ligand) (sFasL); ADAM10-processed FasL form (APL); FasL intracellular domain (FasL ICD) (SPPL2A-processed FasL form) (SPA)]"	FASLG APT1LG1 CD95L FASL TNFSF6	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; apoptotic process [GO:0006915]; apoptotic signaling pathway [GO:0097190]; cell-cell signaling [GO:0007267]; cellular chloride ion homeostasis [GO:0030644]; cellular response to interferon-gamma [GO:0071346]; endosomal lumen acidification [GO:0048388]; extrinsic apoptotic signaling pathway [GO:0097191]; extrinsic apoptotic signaling pathway via death domain receptors [GO:0008625]; inflammatory cell apoptotic process [GO:0006925]; necroptotic process [GO:0070266]; necroptotic signaling pathway [GO:0097527]; negative regulation of angiogenesis [GO:0016525]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of endothelial cell apoptotic process [GO:2000353]; positive regulation of epidermal growth factor receptor signaling pathway [GO:0045742]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of phosphatidylserine exposure on apoptotic cell surface [GO:1905782]; release of sequestered calcium ion into cytosol by endoplasmic reticulum [GO:1903514]; response to growth factor [GO:0070848]; response to lipopolysaccharide [GO:0032496]; retinal cell programmed cell death [GO:0046666]; signal transduction [GO:0007165]; T cell apoptotic process [GO:0070231]	caveola [GO:0005901]; cytoplasmic vesicle lumen [GO:0060205]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; integral component of plasma membrane [GO:0005887]; lysosomal lumen [GO:0043202]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]	caveola [GO:0005901]; cytoplasmic vesicle lumen [GO:0060205]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; integral component of plasma membrane [GO:0005887]; lysosomal lumen [GO:0043202]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; cytokine activity [GO:0005125]; death receptor binding [GO:0005123]; signaling receptor binding [GO:0005102]; tumor necrosis factor receptor binding [GO:0005164]; activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; apoptotic process [GO:0006915]; apoptotic signaling pathway [GO:0097190]; cell-cell signaling [GO:0007267]; cellular chloride ion homeostasis [GO:0030644]; cellular response to interferon-gamma [GO:0071346]; endosomal lumen acidification [GO:0048388]; extrinsic apoptotic signaling pathway [GO:0097191]; extrinsic apoptotic signaling pathway via death domain receptors [GO:0008625]; inflammatory cell apoptotic process [GO:0006925]; necroptotic process [GO:0070266]; necroptotic signaling pathway [GO:0097527]; negative regulation of angiogenesis [GO:0016525]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of endothelial cell apoptotic process [GO:2000353]; positive regulation of epidermal growth factor receptor signaling pathway [GO:0045742]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of phosphatidylserine exposure on apoptotic cell surface [GO:1905782]; release of sequestered calcium ion into cytosol by endoplasmic reticulum [GO:1903514]; response to growth factor [GO:0070848]; response to lipopolysaccharide [GO:0032496]; retinal cell programmed cell death [GO:0046666]; signal transduction [GO:0007165]; T cell apoptotic process [GO:0070231]	cytokine activity [GO:0005125]; death receptor binding [GO:0005123]; signaling receptor binding [GO:0005102]; tumor necrosis factor receptor binding [GO:0005164]	GO:0000122; GO:0005102; GO:0005123; GO:0005125; GO:0005164; GO:0005576; GO:0005615; GO:0005634; GO:0005886; GO:0005887; GO:0005901; GO:0006915; GO:0006919; GO:0006925; GO:0007165; GO:0007267; GO:0008284; GO:0008625; GO:0009897; GO:0016525; GO:0030644; GO:0032496; GO:0043065; GO:0043123; GO:0043202; GO:0043525; GO:0045742; GO:0046666; GO:0048388; GO:0048471; GO:0060205; GO:0070062; GO:0070231; GO:0070266; GO:0070848; GO:0071346; GO:0097190; GO:0097191; GO:0097527; GO:1903514; GO:1905782; GO:2000353	ELRKVAHLTGK	0.33333	11.4837	11.4821	0	8.5862	0	0	11.8025	0	9.61335	11.6841	11.0588	10.6529	9.60811	0	0
Q8IYC8	Q8IYC8_HUMAN	Beta-secretase 1 (EC 3.4.23.46) (Beta-site amyloid precursor protein cleaving enzyme 1) (Memapsin-2) (Membrane-associated aspartic protease 2)	BACE1	Homo sapiens (Human)	proteolysis [GO:0006508]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]; aspartic-type endopeptidase activity [GO:0004190]; proteolysis [GO:0006508]	aspartic-type endopeptidase activity [GO:0004190]	GO:0004190; GO:0005770; GO:0005794; GO:0006508; GO:0016021; GO:0045121; GO:0055037	AASSTEK	0.6749	13.3536	0	0	0	12.9462	0	12.7058	13.1287	10.2385	11.4302	0	0	0	10.5136	11.0362
U5YV54	U5YV54_HUMAN	ATP synthase protein 8	ATP8 ATPase8 MTATP8 HS5781_0021 HS5782_0021	Homo sapiens (Human)	proton motive force-driven ATP synthesis [GO:0015986]	"integral component of membrane [GO:0016021]; mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) [GO:0000276]"	"integral component of membrane [GO:0016021]; mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) [GO:0000276]; proton transmembrane transporter activity [GO:0015078]; proton motive force-driven ATP synthesis [GO:0015986]"	proton transmembrane transporter activity [GO:0015078]	GO:0000276; GO:0015078; GO:0015986; GO:0016021	MKNYNKPWEPK	0.7786	0	11.2494	0	10.628	0	8.75892	11.4783	11.7042	0	10.8468	0	11.1244	0	9.07275	9.36146
B4DFH2	B4DFH2_HUMAN	"cDNA FLJ60471, highly similar to tRNA-dihydrouridine synthase 4-like"		Homo sapiens (Human)						EAENVWR	0.85113	0	14.1901	0	10.7469	0	10.163	0	0	0	12.2468	11.8855	12.0748	11.1983	11.2482	0
A8K0M3	A8K0M3_HUMAN	"cDNA FLJ75485, highly similar to Homo sapiens G protein-coupled receptor 30 (GPR30), transcript variant 2, mRNA"		Homo sapiens (Human)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; G protein-coupled receptor activity [GO:0004930]	G protein-coupled receptor activity [GO:0004930]	GO:0004930; GO:0016021	AHRHRGLRPR	0.98204	9.54944	18.6731	9.1849	0	9.47153	0	11.0554	0	0	10.5211	0	0	16.1605	0	8.99147
A0A218KGQ4	A0A218KGQ4_HUMAN	Presenilin (EC 3.4.23.-)	PSEN2	Homo sapiens (Human)	amyloid precursor protein catabolic process [GO:0042987]; intracellular signal transduction [GO:0035556]; Notch signaling pathway [GO:0007219]; protein processing [GO:0016485]	cell periphery [GO:0071944]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	"cell periphery [GO:0071944]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; aspartic endopeptidase activity, intramembrane cleaving [GO:0042500]; amyloid precursor protein catabolic process [GO:0042987]; intracellular signal transduction [GO:0035556]; Notch signaling pathway [GO:0007219]; protein processing [GO:0016485]"	"aspartic endopeptidase activity, intramembrane cleaving [GO:0042500]"	GO:0000139; GO:0005789; GO:0007219; GO:0016021; GO:0016485; GO:0035556; GO:0042500; GO:0042987; GO:0071944	LTFMASDSEEEVCDERTSLMSAESPTPR	0.32468	11.503	12.1021	12.0644	0	0	0	0	11.2573	10.0039	13.3939	0	12.4515	0	10.0267	0
P37840	SYUA_HUMAN	Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)	SNCA NACP PARK1	Homo sapiens (Human)	"activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; adult locomotory behavior [GO:0008344]; amyloid fibril formation [GO:1990000]; cellular response to copper ion [GO:0071280]; cellular response to epinephrine stimulus [GO:0071872]; cellular response to oxidative stress [GO:0034599]; chemical synaptic transmission [GO:0007268]; dopamine biosynthetic process [GO:0042416]; dopamine uptake involved in synaptic transmission [GO:0051583]; excitatory postsynaptic potential [GO:0060079]; fatty acid metabolic process [GO:0006631]; localization [GO:0051179]; long-term synaptic potentiation [GO:0060291]; microglial cell activation [GO:0001774]; mitochondrial ATP synthesis coupled electron transport [GO:0042775]; mitochondrial membrane organization [GO:0007006]; negative regulation of apoptotic process [GO:0043066]; negative regulation of chaperone-mediated autophagy [GO:1904715]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of dopamine uptake involved in synaptic transmission [GO:0051585]; negative regulation of exocytosis [GO:0045920]; negative regulation of histone acetylation [GO:0035067]; negative regulation of microtubule polymerization [GO:0031115]; negative regulation of mitochondrial electron transport, NADH to ubiquinone [GO:1902957]; negative regulation of monooxygenase activity [GO:0032769]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of neuron death [GO:1901215]; negative regulation of norepinephrine uptake [GO:0051622]; negative regulation of platelet-derived growth factor receptor signaling pathway [GO:0010642]; negative regulation of protein kinase activity [GO:0006469]; negative regulation of serotonin uptake [GO:0051612]; negative regulation of thrombin-activated receptor signaling pathway [GO:0070495]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transporter activity [GO:0032410]; neuron apoptotic process [GO:0051402]; neutral lipid metabolic process [GO:0006638]; phospholipid metabolic process [GO:0006644]; positive regulation of apoptotic process [GO:0043065]; positive regulation of endocytosis [GO:0045807]; positive regulation of exocytosis [GO:0045921]; positive regulation of glutathione peroxidase activity [GO:1903284]; positive regulation of hydrogen peroxide catabolic process [GO:1903285]; positive regulation of inflammatory response [GO:0050729]; positive regulation of inositol phosphate biosynthetic process [GO:0060732]; positive regulation of neuron death [GO:1901216]; positive regulation of neurotransmitter secretion [GO:0001956]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of protein serine/threonine kinase activity [GO:0071902]; positive regulation of receptor recycling [GO:0001921]; positive regulation of release of sequestered calcium ion into cytosol [GO:0051281]; positive regulation of SNARE complex assembly [GO:0035543]; protein destabilization [GO:0031648]; protein tetramerization [GO:0051262]; receptor internalization [GO:0031623]; regulation of acyl-CoA biosynthetic process [GO:0050812]; regulation of dopamine secretion [GO:0014059]; regulation of glutamate secretion [GO:0014048]; regulation of locomotion [GO:0040012]; regulation of long-term neuronal synaptic plasticity [GO:0048169]; regulation of macrophage activation [GO:0043030]; regulation of neuron death [GO:1901214]; regulation of norepinephrine uptake [GO:0051621]; regulation of phospholipase activity [GO:0010517]; regulation of presynapse assembly [GO:1905606]; regulation of reactive oxygen species biosynthetic process [GO:1903426]; regulation of synaptic vesicle recycling [GO:1903421]; regulation of transmembrane transporter activity [GO:0022898]; response to interferon-gamma [GO:0034341]; response to interleukin-1 [GO:0070555]; response to iron(II) ion [GO:0010040]; response to lipopolysaccharide [GO:0032496]; response to magnesium ion [GO:0032026]; response to xenobiotic stimulus [GO:0009410]; SNARE complex assembly [GO:0035493]; supramolecular fiber organization [GO:0097435]; synapse organization [GO:0050808]; synaptic vesicle endocytosis [GO:0048488]; synaptic vesicle exocytosis [GO:0016079]; synaptic vesicle priming [GO:0016082]; synaptic vesicle transport [GO:0048489]"	actin cytoskeleton [GO:0015629]; anchoring junction [GO:0070161]; axon [GO:0030424]; axon terminus [GO:0043679]; cell cortex [GO:0005938]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; growth cone [GO:0030426]; inclusion body [GO:0016234]; lysosome [GO:0005764]; membrane [GO:0016020]; mitochondrion [GO:0005739]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; protein-containing complex [GO:0032991]; supramolecular fiber [GO:0099512]; synaptic vesicle membrane [GO:0030672]	"actin cytoskeleton [GO:0015629]; anchoring junction [GO:0070161]; axon [GO:0030424]; axon terminus [GO:0043679]; cell cortex [GO:0005938]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; growth cone [GO:0030426]; inclusion body [GO:0016234]; lysosome [GO:0005764]; membrane [GO:0016020]; mitochondrion [GO:0005739]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; protein-containing complex [GO:0032991]; supramolecular fiber [GO:0099512]; synaptic vesicle membrane [GO:0030672]; actin binding [GO:0003779]; alpha-tubulin binding [GO:0043014]; calcium ion binding [GO:0005509]; copper ion binding [GO:0005507]; cuprous ion binding [GO:1903136]; cysteine-type endopeptidase inhibitor activity involved in apoptotic process [GO:0043027]; dynein complex binding [GO:0070840]; ferrous iron binding [GO:0008198]; histone binding [GO:0042393]; Hsp70 protein binding [GO:0030544]; identical protein binding [GO:0042802]; kinesin binding [GO:0019894]; lipid binding [GO:0008289]; magnesium ion binding [GO:0000287]; molecular adaptor activity [GO:0060090]; oxidoreductase activity [GO:0016491]; phospholipid binding [GO:0005543]; phosphoprotein binding [GO:0051219]; protein kinase inhibitor activity [GO:0004860]; SNARE binding [GO:0000149]; tau protein binding [GO:0048156]; transcription cis-regulatory region binding [GO:0000976]; zinc ion binding [GO:0008270]; activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; adult locomotory behavior [GO:0008344]; amyloid fibril formation [GO:1990000]; cellular response to copper ion [GO:0071280]; cellular response to epinephrine stimulus [GO:0071872]; cellular response to oxidative stress [GO:0034599]; chemical synaptic transmission [GO:0007268]; dopamine biosynthetic process [GO:0042416]; dopamine uptake involved in synaptic transmission [GO:0051583]; excitatory postsynaptic potential [GO:0060079]; fatty acid metabolic process [GO:0006631]; localization [GO:0051179]; long-term synaptic potentiation [GO:0060291]; microglial cell activation [GO:0001774]; mitochondrial ATP synthesis coupled electron transport [GO:0042775]; mitochondrial membrane organization [GO:0007006]; negative regulation of apoptotic process [GO:0043066]; negative regulation of chaperone-mediated autophagy [GO:1904715]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of dopamine uptake involved in synaptic transmission [GO:0051585]; negative regulation of exocytosis [GO:0045920]; negative regulation of histone acetylation [GO:0035067]; negative regulation of microtubule polymerization [GO:0031115]; negative regulation of mitochondrial electron transport, NADH to ubiquinone [GO:1902957]; negative regulation of monooxygenase activity [GO:0032769]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of neuron death [GO:1901215]; negative regulation of norepinephrine uptake [GO:0051622]; negative regulation of platelet-derived growth factor receptor signaling pathway [GO:0010642]; negative regulation of protein kinase activity [GO:0006469]; negative regulation of serotonin uptake [GO:0051612]; negative regulation of thrombin-activated receptor signaling pathway [GO:0070495]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transporter activity [GO:0032410]; neuron apoptotic process [GO:0051402]; neutral lipid metabolic process [GO:0006638]; phospholipid metabolic process [GO:0006644]; positive regulation of apoptotic process [GO:0043065]; positive regulation of endocytosis [GO:0045807]; positive regulation of exocytosis [GO:0045921]; positive regulation of glutathione peroxidase activity [GO:1903284]; positive regulation of hydrogen peroxide catabolic process [GO:1903285]; positive regulation of inflammatory response [GO:0050729]; positive regulation of inositol phosphate biosynthetic process [GO:0060732]; positive regulation of neuron death [GO:1901216]; positive regulation of neurotransmitter secretion [GO:0001956]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of protein serine/threonine kinase activity [GO:0071902]; positive regulation of receptor recycling [GO:0001921]; positive regulation of release of sequestered calcium ion into cytosol [GO:0051281]; positive regulation of SNARE complex assembly [GO:0035543]; protein destabilization [GO:0031648]; protein tetramerization [GO:0051262]; receptor internalization [GO:0031623]; regulation of acyl-CoA biosynthetic process [GO:0050812]; regulation of dopamine secretion [GO:0014059]; regulation of glutamate secretion [GO:0014048]; regulation of locomotion [GO:0040012]; regulation of long-term neuronal synaptic plasticity [GO:0048169]; regulation of macrophage activation [GO:0043030]; regulation of neuron death [GO:1901214]; regulation of norepinephrine uptake [GO:0051621]; regulation of phospholipase activity [GO:0010517]; regulation of presynapse assembly [GO:1905606]; regulation of reactive oxygen species biosynthetic process [GO:1903426]; regulation of synaptic vesicle recycling [GO:1903421]; regulation of transmembrane transporter activity [GO:0022898]; response to interferon-gamma [GO:0034341]; response to interleukin-1 [GO:0070555]; response to iron(II) ion [GO:0010040]; response to lipopolysaccharide [GO:0032496]; response to magnesium ion [GO:0032026]; response to xenobiotic stimulus [GO:0009410]; SNARE complex assembly [GO:0035493]; supramolecular fiber organization [GO:0097435]; synapse organization [GO:0050808]; synaptic vesicle endocytosis [GO:0048488]; synaptic vesicle exocytosis [GO:0016079]; synaptic vesicle priming [GO:0016082]; synaptic vesicle transport [GO:0048489]"	actin binding [GO:0003779]; alpha-tubulin binding [GO:0043014]; calcium ion binding [GO:0005509]; copper ion binding [GO:0005507]; cuprous ion binding [GO:1903136]; cysteine-type endopeptidase inhibitor activity involved in apoptotic process [GO:0043027]; dynein complex binding [GO:0070840]; ferrous iron binding [GO:0008198]; histone binding [GO:0042393]; Hsp70 protein binding [GO:0030544]; identical protein binding [GO:0042802]; kinesin binding [GO:0019894]; lipid binding [GO:0008289]; magnesium ion binding [GO:0000287]; molecular adaptor activity [GO:0060090]; oxidoreductase activity [GO:0016491]; phospholipid binding [GO:0005543]; phosphoprotein binding [GO:0051219]; protein kinase inhibitor activity [GO:0004860]; SNARE binding [GO:0000149]; tau protein binding [GO:0048156]; transcription cis-regulatory region binding [GO:0000976]; zinc ion binding [GO:0008270]	GO:0000122; GO:0000149; GO:0000287; GO:0000976; GO:0001774; GO:0001921; GO:0001956; GO:0003779; GO:0004860; GO:0005507; GO:0005509; GO:0005543; GO:0005576; GO:0005615; GO:0005634; GO:0005737; GO:0005739; GO:0005764; GO:0005829; GO:0005886; GO:0005938; GO:0006469; GO:0006631; GO:0006638; GO:0006644; GO:0006919; GO:0007006; GO:0007268; GO:0008198; GO:0008270; GO:0008289; GO:0008344; GO:0009410; GO:0010040; GO:0010517; GO:0010642; GO:0014048; GO:0014059; GO:0015629; GO:0016020; GO:0016079; GO:0016082; GO:0016234; GO:0016491; GO:0019894; GO:0022898; GO:0030424; GO:0030426; GO:0030544; GO:0030672; GO:0031115; GO:0031623; GO:0031648; GO:0032026; GO:0032410; GO:0032496; GO:0032769; GO:0032991; GO:0033138; GO:0034341; GO:0034599; GO:0035067; GO:0035493; GO:0035543; GO:0040012; GO:0042393; GO:0042416; GO:0042775; GO:0042802; GO:0043014; GO:0043025; GO:0043027; GO:0043030; GO:0043065; GO:0043066; GO:0043154; GO:0043524; GO:0043679; GO:0045807; GO:0045920; GO:0045921; GO:0048156; GO:0048169; GO:0048471; GO:0048488; GO:0048489; GO:0050729; GO:0050808; GO:0050812; GO:0051179; GO:0051219; GO:0051262; GO:0051281; GO:0051402; GO:0051583; GO:0051585; GO:0051612; GO:0051621; GO:0051622; GO:0060079; GO:0060090; GO:0060291; GO:0060732; GO:0070161; GO:0070495; GO:0070555; GO:0070840; GO:0071280; GO:0071872; GO:0071902; GO:0097435; GO:0098794; GO:0099512; GO:1901214; GO:1901215; GO:1901216; GO:1902957; GO:1903136; GO:1903284; GO:1903285; GO:1903421; GO:1903426; GO:1904715; GO:1905606; GO:1990000	AKEGVVAAAEK	0.95909	0	10.6583	0	10.0087	9.20962	0	10.8199	9.29698	0	11.3765	0	0	8.5547	10.6153	10.8492
B7Z1Z8	B7Z1Z8_HUMAN	cDNA FLJ52208		Homo sapiens (Human)						CLAGAAGGETR	0.93795	12.7383	0	0	0	0	0	0	0	9.92945	11.3685	10.0485	12.7933	9.44634	11.846	11.5076
O43653	PSCA_HUMAN	Prostate stem cell antigen	PSCA UNQ206/PRO232	Homo sapiens (Human)	negative regulation of ERK1 and ERK2 cascade [GO:0070373]; regulation of neurotransmitter receptor activity [GO:0099601]	anchored component of membrane [GO:0031225]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; plasma membrane [GO:0005886]	anchored component of membrane [GO:0031225]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; plasma membrane [GO:0005886]; acetylcholine receptor binding [GO:0033130]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; regulation of neurotransmitter receptor activity [GO:0099601]	acetylcholine receptor binding [GO:0033130]	GO:0005576; GO:0005886; GO:0031225; GO:0033130; GO:0070062; GO:0070373; GO:0099601	AGLALQPGTALLCYSCK	0.21053	9.5648	10.8452	8.82114	9.44261	9.51011	9.95505	0	0	0	0	9.59137	9.8024	0	11.1139	0
Q9B1D3	Q9B1D3_HUMAN	ATP synthase subunit a	ATP6 atp6 ATPase 6 ATPase6 MTATP6 HS5781_0022 HS5782_0022	Homo sapiens (Human)	proton motive force-driven ATP synthesis [GO:0015986]	"integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; proton-transporting ATP synthase complex, coupling factor F(o) [GO:0045263]"	"integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; proton-transporting ATP synthase complex, coupling factor F(o) [GO:0045263]; proton transmembrane transporter activity [GO:0015078]; proton motive force-driven ATP synthesis [GO:0015986]"	proton transmembrane transporter activity [GO:0015078]	GO:0005743; GO:0015078; GO:0015986; GO:0016021; GO:0045263	LITTQQWLIK	0.74517	9.47527	9.41686	0	0	0	0	0	0	9.07858	10.2175	10.7613	10.373	9.77434	9.78064	9.53041
B6DU70	B6DU70_HUMAN	"Estrogen receptor alpha delta 4,5,6,7 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQCTIDK	0.3268	0	9.78141	11.6288	0	0	0	10.4748	10.2535	10.1504	10.9589	10.9522	12.2891	0	0	0
Q9H492	MLP3A_HUMAN	Microtubule-associated proteins 1A/1B light chain 3A (Autophagy-related protein LC3 A) (Autophagy-related ubiquitin-like modifier LC3 A) (MAP1 light chain 3-like protein 1) (MAP1A/MAP1B light chain 3 A) (MAP1A/MAP1B LC3 A) (Microtubule-associated protein 1 light chain 3 alpha)	MAP1LC3A	Homo sapiens (Human)	autophagosome assembly [GO:0000045]; autophagosome maturation [GO:0097352]; autophagy of mitochondrion [GO:0000422]; cellular response to amino acid starvation [GO:0034198]; cellular response to copper ion [GO:0071280]; cellular response to hydrogen peroxide [GO:0070301]; cellular response to nitrogen starvation [GO:0006995]; cellular response to starvation [GO:0009267]; macroautophagy [GO:0016236]; response to iron(II) ion [GO:0010040]; response to lead ion [GO:0010288]; response to morphine [GO:0043278]	autolysosome [GO:0044754]; autophagosome [GO:0005776]; autophagosome membrane [GO:0000421]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; late endosome [GO:0005770]; microtubule [GO:0005874]; organelle membrane [GO:0031090]; synapse [GO:0045202]	autolysosome [GO:0044754]; autophagosome [GO:0005776]; autophagosome membrane [GO:0000421]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; late endosome [GO:0005770]; microtubule [GO:0005874]; organelle membrane [GO:0031090]; synapse [GO:0045202]; microtubule binding [GO:0008017]; phospholipid binding [GO:0005543]; ubiquitin protein ligase binding [GO:0031625]; autophagosome assembly [GO:0000045]; autophagosome maturation [GO:0097352]; autophagy of mitochondrion [GO:0000422]; cellular response to amino acid starvation [GO:0034198]; cellular response to copper ion [GO:0071280]; cellular response to hydrogen peroxide [GO:0070301]; cellular response to nitrogen starvation [GO:0006995]; cellular response to starvation [GO:0009267]; macroautophagy [GO:0016236]; response to iron(II) ion [GO:0010040]; response to lead ion [GO:0010288]; response to morphine [GO:0043278]	microtubule binding [GO:0008017]; phospholipid binding [GO:0005543]; ubiquitin protein ligase binding [GO:0031625]	GO:0000045; GO:0000421; GO:0000422; GO:0005543; GO:0005770; GO:0005776; GO:0005829; GO:0005874; GO:0006995; GO:0008017; GO:0009267; GO:0010040; GO:0010288; GO:0016236; GO:0031090; GO:0031625; GO:0034198; GO:0043231; GO:0043278; GO:0044754; GO:0045202; GO:0070301; GO:0071280; GO:0097352	DQHPSKIPVIIER	0.93587	10.6562	11.4097	10.7917	9.95912	9.77599	0	0	11.0611	0	0	0	0	10.3549	10.1635	0
Q9NZY2	FA30A_HUMAN	Putative uncharacterized protein FAM30A	FAM30A C14orf110 KIAA0125 HSPC053	Homo sapiens (Human)						AGAPPMPDLLGHR	0.93056	9.74249	9.43752	10.9583	0	0	0	9.76325	9.73887	0	0	9.62108	10.7984	13.9152	0	0
Q99714	HCD2_HUMAN	3-hydroxyacyl-CoA dehydrogenase type-2 (EC 1.1.1.35) (17-beta-estradiol 17-dehydrogenase) (EC 1.1.1.62) (2-methyl-3-hydroxybutyryl-CoA dehydrogenase) (MHBD) (3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+))) (EC 1.1.1.239) (3-hydroxy-2-methylbutyryl-CoA dehydrogenase) (EC 1.1.1.178) (3-hydroxyacyl-CoA dehydrogenase type II) (3alpha(or 20beta)-hydroxysteroid dehydrogenase) (EC 1.1.1.53) (7-alpha-hydroxysteroid dehydrogenase) (EC 1.1.1.159) (Endoplasmic reticulum-associated amyloid beta-peptide-binding protein) (Mitochondrial ribonuclease P protein 2) (Mitochondrial RNase P protein 2) (Short chain dehydrogenase/reductase family 5C member 1) (Short-chain type dehydrogenase/reductase XH98G2) (Type II HADH)	HSD17B10 ERAB HADH2 MRPP2 SCHAD SDR5C1 XH98G2	Homo sapiens (Human)	androgen metabolic process [GO:0008209]; bile acid biosynthetic process [GO:0006699]; brexanolone metabolic process [GO:0062173]; C21-steroid hormone metabolic process [GO:0008207]; estrogen metabolic process [GO:0008210]; fatty acid beta-oxidation [GO:0006635]; fatty acid metabolic process [GO:0006631]; isoleucine catabolic process [GO:0006550]; lipid metabolic process [GO:0006629]; mitochondrial tRNA 3'-end processing [GO:1990180]; mitochondrial tRNA 5'-end processing [GO:0097745]; mitochondrial tRNA methylation [GO:0070901]; mitochondrion organization [GO:0007005]; protein homotetramerization [GO:0051289]	cytoplasm [GO:0005737]; mitochondrial matrix [GO:0005759]; mitochondrial nucleoid [GO:0042645]; mitochondrial ribonuclease P complex [GO:0030678]; mitochondrion [GO:0005739]; plasma membrane [GO:0005886]; tRNA methyltransferase complex [GO:0043527]	"cytoplasm [GO:0005737]; mitochondrial matrix [GO:0005759]; mitochondrial nucleoid [GO:0042645]; mitochondrial ribonuclease P complex [GO:0030678]; mitochondrion [GO:0005739]; plasma membrane [GO:0005886]; tRNA methyltransferase complex [GO:0043527]; 17-beta-hydroxysteroid dehydrogenase (NAD+) activity [GO:0044594]; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity [GO:0047015]; 3-hydroxyacyl-CoA dehydrogenase activity [GO:0003857]; androstan-3-alpha,17-beta-diol dehydrogenase activity [GO:0047044]; chenodeoxycholate 7-alpha-dehydrogenase (NAD+) activity [GO:0106281]; cholate 7-alpha-dehydrogenase activity [GO:0008709]; estradiol 17-beta-dehydrogenase activity [GO:0004303]; isoursodeoxycholate 7-beta-dehydrogenase (NAD+) activity [GO:0106282]; RNA binding [GO:0003723]; testosterone dehydrogenase (NAD+) activity [GO:0047035]; testosterone dehydrogenase [NAD(P)] activity [GO:0030283]; tRNA binding [GO:0000049]; ursodeoxycholate 7-beta-dehydrogenase (NAD+) activity [GO:0106283]; androgen metabolic process [GO:0008209]; bile acid biosynthetic process [GO:0006699]; brexanolone metabolic process [GO:0062173]; C21-steroid hormone metabolic process [GO:0008207]; estrogen metabolic process [GO:0008210]; fatty acid beta-oxidation [GO:0006635]; fatty acid metabolic process [GO:0006631]; isoleucine catabolic process [GO:0006550]; lipid metabolic process [GO:0006629]; mitochondrial tRNA 3'-end processing [GO:1990180]; mitochondrial tRNA 5'-end processing [GO:0097745]; mitochondrial tRNA methylation [GO:0070901]; mitochondrion organization [GO:0007005]; protein homotetramerization [GO:0051289]"	"17-beta-hydroxysteroid dehydrogenase (NAD+) activity [GO:0044594]; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity [GO:0047015]; 3-hydroxyacyl-CoA dehydrogenase activity [GO:0003857]; androstan-3-alpha,17-beta-diol dehydrogenase activity [GO:0047044]; chenodeoxycholate 7-alpha-dehydrogenase (NAD+) activity [GO:0106281]; cholate 7-alpha-dehydrogenase activity [GO:0008709]; estradiol 17-beta-dehydrogenase activity [GO:0004303]; isoursodeoxycholate 7-beta-dehydrogenase (NAD+) activity [GO:0106282]; RNA binding [GO:0003723]; testosterone dehydrogenase (NAD+) activity [GO:0047035]; testosterone dehydrogenase [NAD(P)] activity [GO:0030283]; tRNA binding [GO:0000049]; ursodeoxycholate 7-beta-dehydrogenase (NAD+) activity [GO:0106283]"	GO:0000049; GO:0003723; GO:0003857; GO:0004303; GO:0005737; GO:0005739; GO:0005759; GO:0005886; GO:0006550; GO:0006629; GO:0006631; GO:0006635; GO:0006699; GO:0007005; GO:0008207; GO:0008209; GO:0008210; GO:0008709; GO:0030283; GO:0030678; GO:0042645; GO:0043527; GO:0044594; GO:0047015; GO:0047035; GO:0047044; GO:0051289; GO:0062173; GO:0070901; GO:0097745; GO:0106281; GO:0106282; GO:0106283; GO:1990180	DVQTALALAK	0.23967	11.2609	11.2441	0	0	9.53027	0	0	9.04043	0	10.5133	10.4755	10.2804	0	11.3021	0
B4DFL3	B4DFL3_HUMAN	Proteasome subunit beta type-4		Homo sapiens (Human)	proteolysis involved in protein catabolic process [GO:0051603]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; proteasome core complex [GO:0005839]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; proteasome core complex [GO:0005839]; proteolysis involved in protein catabolic process [GO:0051603]		GO:0005634; GO:0005737; GO:0005839; GO:0051603	AIHSWLTR	0.85714	11.2158	10.0633	0	0	0	0	0	12.7595	0	12.3876	12.7943	11.7016	0	11.7701	0
P35052	GPC1_HUMAN	Glypican-1 [Cleaved into: Secreted glypican-1]	GPC1	Homo sapiens (Human)	cell migration [GO:0016477]; heparan sulfate proteoglycan catabolic process [GO:0030200]; myelin assembly [GO:0032288]; negative regulation of fibroblast growth factor receptor signaling pathway [GO:0040037]; positive regulation of skeletal muscle cell differentiation [GO:2001016]; regulation of protein localization to membrane [GO:1905475]; Schwann cell differentiation [GO:0014037]	anchored component of plasma membrane [GO:0046658]; cell surface [GO:0009986]; collagen-containing extracellular matrix [GO:0062023]; cytosol [GO:0005829]; endosome [GO:0005768]; extracellular exosome [GO:0070062]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi lumen [GO:0005796]; intrinsic component of plasma membrane [GO:0031226]; lysosomal lumen [GO:0043202]; membrane raft [GO:0045121]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; synapse [GO:0045202]	anchored component of plasma membrane [GO:0046658]; cell surface [GO:0009986]; collagen-containing extracellular matrix [GO:0062023]; cytosol [GO:0005829]; endosome [GO:0005768]; extracellular exosome [GO:0070062]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi lumen [GO:0005796]; intrinsic component of plasma membrane [GO:0031226]; lysosomal lumen [GO:0043202]; membrane raft [GO:0045121]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; synapse [GO:0045202]; copper ion binding [GO:0005507]; fibroblast growth factor binding [GO:0017134]; laminin binding [GO:0043236]; cell migration [GO:0016477]; heparan sulfate proteoglycan catabolic process [GO:0030200]; myelin assembly [GO:0032288]; negative regulation of fibroblast growth factor receptor signaling pathway [GO:0040037]; positive regulation of skeletal muscle cell differentiation [GO:2001016]; regulation of protein localization to membrane [GO:1905475]; Schwann cell differentiation [GO:0014037]	copper ion binding [GO:0005507]; fibroblast growth factor binding [GO:0017134]; laminin binding [GO:0043236]	GO:0005507; GO:0005576; GO:0005615; GO:0005654; GO:0005768; GO:0005796; GO:0005829; GO:0005886; GO:0009986; GO:0014037; GO:0016477; GO:0017134; GO:0030200; GO:0031012; GO:0031226; GO:0032288; GO:0040037; GO:0043202; GO:0043236; GO:0045121; GO:0045202; GO:0046658; GO:0062023; GO:0070062; GO:1905475; GO:2001016	AFRDLYSELR	0.87138	0	0	11.7341	0	9.32202	0	9.00039	12.9037	0	10.5264	0	9.103	10.0242	9.09479	0
B7Z1Y8	B7Z1Y8_HUMAN	"cDNA FLJ50467, highly similar to Homo sapiens C-type lectin domain family 7, member A (CLEC7A), transcript variant 3, mRNA"		Homo sapiens (Human)	cellular response to molecule of fungal origin [GO:0071226]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; (1->3)-beta-D-glucan binding [GO:0001872]; cellular response to molecule of fungal origin [GO:0071226]	(1->3)-beta-D-glucan binding [GO:0001872]	GO:0001872; GO:0016021; GO:0071226	EYHPGLENLDEDGYTQLHFDSQSNTR	0.2087	11.9342	0	0	10.6454	8.53052	0	10.851	8.71723	0	0	0	11.7688	0	9.23225	9.26866
A8K9L3	A8K9L3_HUMAN	"Proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated), isoform CRA_b (Proteolipid protein 1 isoform 2) (cDNA FLJ77822, highly similar to Homo sapiens proteolipid protein 1 (Pelizaeus-Merzbacher disease,spastic paraplegia 2, uncomplicated) (PLP1), mRNA) (cDNA, FLJ92659, highly similar to Homo sapiens proteolipid protein 1 (Pelizaeus-Merzbacher disease,spastic paraplegia 2, uncomplicated) (PLP1), mRNA)"	PLP1 hCG_17970	Homo sapiens (Human)	AMPA selective glutamate receptor signaling pathway [GO:0098990]; astrocyte development [GO:0014002]; axon development [GO:0061564]; central nervous system myelination [GO:0022010]; inflammatory response [GO:0006954]; long-chain fatty acid biosynthetic process [GO:0042759]; positive regulation of calcium ion transmembrane transport [GO:1904427]; positive regulation of cell migration [GO:0030335]; positive regulation of gene expression [GO:0010628]	integrin alphav-beta3 complex [GO:0034683]; myelin sheath [GO:0043209]	integrin alphav-beta3 complex [GO:0034683]; myelin sheath [GO:0043209]; protein-containing complex binding [GO:0044877]; structural constituent of myelin sheath [GO:0019911]; AMPA selective glutamate receptor signaling pathway [GO:0098990]; astrocyte development [GO:0014002]; axon development [GO:0061564]; central nervous system myelination [GO:0022010]; inflammatory response [GO:0006954]; long-chain fatty acid biosynthetic process [GO:0042759]; positive regulation of calcium ion transmembrane transport [GO:1904427]; positive regulation of cell migration [GO:0030335]; positive regulation of gene expression [GO:0010628]	protein-containing complex binding [GO:0044877]; structural constituent of myelin sheath [GO:0019911]	GO:0006954; GO:0010628; GO:0014002; GO:0019911; GO:0022010; GO:0030335; GO:0034683; GO:0042759; GO:0043209; GO:0044877; GO:0061564; GO:0098990; GO:1904427	GLSATVTGGQK	0.98577	10.8584	0	0	0	0	0	11.5457	0	0	11.795	12.388	0	12.1439	10.7	11.1818
Q16143	SYUB_HUMAN	Beta-synuclein	SNCB	Homo sapiens (Human)	chemical synaptic transmission [GO:0007268]; dopamine metabolic process [GO:0042417]; negative regulation of neuron apoptotic process [GO:0043524]; neuron apoptotic process [GO:0051402]; regulation of neuron death [GO:1901214]; synapse organization [GO:0050808]; synaptic vesicle endocytosis [GO:0048488]	axon terminus [GO:0043679]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; inclusion body [GO:0016234]; neuronal cell body [GO:0043025]	axon terminus [GO:0043679]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; inclusion body [GO:0016234]; neuronal cell body [GO:0043025]; calcium ion binding [GO:0005509]; cuprous ion binding [GO:1903136]; phospholipase inhibitor activity [GO:0004859]; transition metal ion binding [GO:0046914]; chemical synaptic transmission [GO:0007268]; dopamine metabolic process [GO:0042417]; negative regulation of neuron apoptotic process [GO:0043524]; neuron apoptotic process [GO:0051402]; regulation of neuron death [GO:1901214]; synapse organization [GO:0050808]; synaptic vesicle endocytosis [GO:0048488]	calcium ion binding [GO:0005509]; cuprous ion binding [GO:1903136]; phospholipase inhibitor activity [GO:0004859]; transition metal ion binding [GO:0046914]	GO:0004859; GO:0005509; GO:0005737; GO:0005829; GO:0007268; GO:0016234; GO:0042417; GO:0043025; GO:0043524; GO:0043679; GO:0046914; GO:0048488; GO:0050808; GO:0051402; GO:1901214; GO:1903136	DVFMKGLSMAK	0.9075	10.1743	0	0	11.142	0	0	13.0244	13.3473	13.3447	0	9.5745	9.98684	0	0	0
B4DFK1	B4DFK1_HUMAN	Proteasome inhibitor PI31 subunit		Homo sapiens (Human)	proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]	endoplasmic reticulum [GO:0005783]; proteasome complex [GO:0000502]	endoplasmic reticulum [GO:0005783]; proteasome complex [GO:0000502]; endopeptidase inhibitor activity [GO:0004866]; proteasome binding [GO:0070628]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]	endopeptidase inhibitor activity [GO:0004866]; proteasome binding [GO:0070628]	GO:0000502; GO:0004866; GO:0005783; GO:0043161; GO:0070628	AGLEVLFASAAPAITCR	0.47917	11.4594	11.9639	11.4073	0	0	0	11.4351	11.6095	0	11.5647	0	11.102	0	0	0
O96018	APBA3_HUMAN	Amyloid-beta A4 precursor protein-binding family A member 3 (Adapter protein X11gamma) (Neuron-specific X11L2 protein) (Neuronal Munc18-1-interacting protein 3) (Mint-3)	APBA3 MINT3 X11L2	Homo sapiens (Human)	chemical synaptic transmission [GO:0007268]; in utero embryonic development [GO:0001701]; negative regulation of catalytic activity [GO:0043086]; protein transport [GO:0015031]; regulation of gene expression [GO:0010468]	cytoplasm [GO:0005737]; dendritic spine [GO:0043197]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; dendritic spine [GO:0043197]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; amyloid-beta binding [GO:0001540]; enzyme binding [GO:0019899]; enzyme inhibitor activity [GO:0004857]; chemical synaptic transmission [GO:0007268]; in utero embryonic development [GO:0001701]; negative regulation of catalytic activity [GO:0043086]; protein transport [GO:0015031]; regulation of gene expression [GO:0010468]	amyloid-beta binding [GO:0001540]; enzyme binding [GO:0019899]; enzyme inhibitor activity [GO:0004857]	GO:0001540; GO:0001701; GO:0004857; GO:0005737; GO:0005886; GO:0007268; GO:0010468; GO:0015031; GO:0019899; GO:0043086; GO:0043197; GO:0048471	APDGETQPMTEVDLFVSTK	0.81911	0	9.83433	9.78395	0	0	0	10.3325	0	0	11.7326	11.5763	0	9.1752	9.12342	8.90222
P04406	G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (EC 1.2.1.12) (Peptidyl-cysteine S-nitrosylase GAPDH) (EC 2.6.99.-)	GAPDH GAPD CDABP0047 OK/SW-cl.12	Homo sapiens (Human)	antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; cellular response to interferon-gamma [GO:0071346]; defense response to fungus [GO:0050832]; glucose metabolic process [GO:0006006]; glycolytic process [GO:0006096]; killing by host of symbiont cells [GO:0051873]; killing of cells of another organism [GO:0031640]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of endopeptidase activity [GO:0010951]; negative regulation of translation [GO:0017148]; neuron apoptotic process [GO:0051402]; peptidyl-cysteine S-trans-nitrosylation [GO:0035606]; positive regulation of cytokine production [GO:0001819]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of type I interferon production [GO:0032481]; protein stabilization [GO:0050821]; regulation of macroautophagy [GO:0016241]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; GAIT complex [GO:0097452]; intracellular membrane-bounded organelle [GO:0043231]; lipid droplet [GO:0005811]; membrane [GO:0016020]; microtubule cytoskeleton [GO:0015630]; nuclear membrane [GO:0031965]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; ribonucleoprotein complex [GO:1990904]; vesicle [GO:0031982]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; GAIT complex [GO:0097452]; intracellular membrane-bounded organelle [GO:0043231]; lipid droplet [GO:0005811]; membrane [GO:0016020]; microtubule cytoskeleton [GO:0015630]; nuclear membrane [GO:0031965]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; ribonucleoprotein complex [GO:1990904]; vesicle [GO:0031982]; aspartic-type endopeptidase inhibitor activity [GO:0019828]; disordered domain specific binding [GO:0097718]; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity [GO:0004365]; identical protein binding [GO:0042802]; microtubule binding [GO:0008017]; NAD binding [GO:0051287]; NADP binding [GO:0050661]; peptidyl-cysteine S-nitrosylase activity [GO:0035605]; antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; cellular response to interferon-gamma [GO:0071346]; defense response to fungus [GO:0050832]; glucose metabolic process [GO:0006006]; glycolytic process [GO:0006096]; killing by host of symbiont cells [GO:0051873]; killing of cells of another organism [GO:0031640]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of endopeptidase activity [GO:0010951]; negative regulation of translation [GO:0017148]; neuron apoptotic process [GO:0051402]; peptidyl-cysteine S-trans-nitrosylation [GO:0035606]; positive regulation of cytokine production [GO:0001819]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of type I interferon production [GO:0032481]; protein stabilization [GO:0050821]; regulation of macroautophagy [GO:0016241]	aspartic-type endopeptidase inhibitor activity [GO:0019828]; disordered domain specific binding [GO:0097718]; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity [GO:0004365]; identical protein binding [GO:0042802]; microtubule binding [GO:0008017]; NAD binding [GO:0051287]; NADP binding [GO:0050661]; peptidyl-cysteine S-nitrosylase activity [GO:0035605]	GO:0000226; GO:0001819; GO:0004365; GO:0005634; GO:0005737; GO:0005811; GO:0005829; GO:0005886; GO:0006006; GO:0006096; GO:0008017; GO:0010951; GO:0015630; GO:0016020; GO:0016241; GO:0017148; GO:0019828; GO:0031640; GO:0031965; GO:0031982; GO:0032481; GO:0035605; GO:0035606; GO:0042802; GO:0043123; GO:0043231; GO:0048471; GO:0050661; GO:0050821; GO:0050832; GO:0051287; GO:0051402; GO:0051873; GO:0061844; GO:0070062; GO:0071346; GO:0097452; GO:0097718; GO:1990904	AAFNSGK	0.91563	11.1128	10.7276	10.8929	0	0	0	0	0	0	13.2457	11.5112	12.0464	9.63345	0	0
B4DFF7	B4DFF7_HUMAN	"cDNA FLJ56964, highly similar to Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A"		Homo sapiens (Human)	signal transduction [GO:0007165]		"3',5'-cyclic-nucleotide phosphodiesterase activity [GO:0004114]; metal ion binding [GO:0046872]; signal transduction [GO:0007165]"	"3',5'-cyclic-nucleotide phosphodiesterase activity [GO:0004114]; metal ion binding [GO:0046872]"	GO:0004114; GO:0007165; GO:0046872	LKPMLDSVATNR	0.85479	11.5372	0	0	0	8.91433	9.60842	0	0	9.14438	10.3403	0	9.3411	9.22374	10.3986	0
Q9UKY0	PRND_HUMAN	Prion-like protein doppel (PrPLP) (Prion protein 2)	PRND DPL UNQ1830/PRO3443	Homo sapiens (Human)	acrosome reaction [GO:0007340]; cellular copper ion homeostasis [GO:0006878]; protein homooligomerization [GO:0051260]	anchored component of external side of plasma membrane [GO:0031362]; extracellular region [GO:0005576]; plasma membrane [GO:0005886]	anchored component of external side of plasma membrane [GO:0031362]; extracellular region [GO:0005576]; plasma membrane [GO:0005886]; copper ion binding [GO:0005507]; acrosome reaction [GO:0007340]; cellular copper ion homeostasis [GO:0006878]; protein homooligomerization [GO:0051260]	copper ion binding [GO:0005507]	GO:0005507; GO:0005576; GO:0005886; GO:0006878; GO:0007340; GO:0031362; GO:0051260	EAFVTGCINATQAANQGEFQKPDNK	0.72619	0	0	9.07644	11.2069	0	9.68557	0	0	0	9.60067	8.92309	0	10.4369	9.42473	9.33593
C9E0E9	C9E0E9_HUMAN	"Estrogen receptor alpha 3*,4,5,6,7,8*/1032 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNHCGLYFIAFLAK	0.33333	9.90778	0	0	0	0	0	10.4625	10.5749	11.2649	10.8981	11.5893	11.7003	0	0	0
B6DU66	B6DU66_HUMAN	"Estrogen receptor alpha delta 2*,3,4,5,6,7*/834 hypothalamic isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]		GO:0005654	CKNVVPLYDLLLEMLDAHR	0.77778	0	0	10.2483	8.74369	9.70965	8.70141	0	9.32057	0	9.46946	0	0	8.63546	9.20455	0
B7Z1Y3	B7Z1Y3_HUMAN	"SPRY domain-containing protein 3 (cDNA FLJ53727, highly similar to SPRY domain-containing protein 3)"	SPRYD3	Homo sapiens (Human)						AFRYQER	0.97763	0	0	9.96607	11.7967	0	11.7947	0	10.5488	0	0	9.80161	9.40096	0	0	8.89748
P01375	TNFA_HUMAN	"Tumor necrosis factor (Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a) [Cleaved into: Tumor necrosis factor, membrane form (N-terminal fragment) (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-domain 1; C-domain 2; Tumor necrosis factor, soluble form]"	TNF TNFA TNFSF2	Homo sapiens (Human)	"activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; acute inflammatory response [GO:0002526]; astrocyte activation [GO:0048143]; calcium-mediated signaling [GO:0019722]; cellular response to amino acid stimulus [GO:0071230]; cellular response to amyloid-beta [GO:1904646]; cellular response to interferon-gamma [GO:0071346]; cellular response to nicotine [GO:0071316]; cellular response to organic cyclic compound [GO:0071407]; cellular response to retinoic acid [GO:0071300]; cellular response to toxic substance [GO:0097237]; chronic inflammatory response to antigenic stimulus [GO:0002439]; circadian rhythm [GO:0007623]; cognition [GO:0050890]; cortical actin cytoskeleton organization [GO:0030866]; defense response to Gram-positive bacterium [GO:0050830]; detection of mechanical stimulus involved in sensory perception of pain [GO:0050966]; embryonic digestive tract development [GO:0048566]; endothelial cell apoptotic process [GO:0072577]; epithelial cell proliferation involved in salivary gland morphogenesis [GO:0060664]; extracellular matrix organization [GO:0030198]; extrinsic apoptotic signaling pathway [GO:0097191]; extrinsic apoptotic signaling pathway via death domain receptors [GO:0008625]; glucose metabolic process [GO:0006006]; humoral immune response [GO:0006959]; I-kappaB kinase/NF-kappaB signaling [GO:0007249]; inflammatory response [GO:0006954]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; JNK cascade [GO:0007254]; leukocyte migration involved in inflammatory response [GO:0002523]; leukocyte tethering or rolling [GO:0050901]; lipopolysaccharide-mediated signaling pathway [GO:0031663]; liver regeneration [GO:0097421]; MAPK cascade [GO:0000165]; microglial cell activation [GO:0001774]; necroptotic signaling pathway [GO:0097527]; negative regulation of alkaline phosphatase activity [GO:0010693]; negative regulation of amyloid-beta clearance [GO:1900222]; negative regulation of apoptotic signaling pathway [GO:2001234]; negative regulation of bicellular tight junction assembly [GO:1903347]; negative regulation of bile acid secretion [GO:0120190]; negative regulation of blood vessel endothelial cell migration [GO:0043537]; negative regulation of branching involved in lung morphogenesis [GO:0061048]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of cytokine production involved in immune response [GO:0002719]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of endothelial cell proliferation [GO:0001937]; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001240]; negative regulation of fat cell differentiation [GO:0045599]; negative regulation of gene expression [GO:0010629]; negative regulation of glucose import [GO:0046325]; negative regulation of heart rate [GO:0010459]; negative regulation of interleukin-6 production [GO:0032715]; negative regulation of L-glutamate import across plasma membrane [GO:0002037]; negative regulation of lipid catabolic process [GO:0050995]; negative regulation of lipid storage [GO:0010888]; negative regulation of miRNA maturation [GO:1903799]; negative regulation of mitotic cell cycle [GO:0045930]; negative regulation of myelination [GO:0031642]; negative regulation of myoblast differentiation [GO:0045662]; negative regulation of myosin-light-chain-phosphatase activity [GO:0035509]; negative regulation of neurogenesis [GO:0050768]; negative regulation of osteoblast differentiation [GO:0045668]; negative regulation of oxidative phosphorylation [GO:0090324]; negative regulation of protein-containing complex disassembly [GO:0043242]; negative regulation of signaling receptor activity [GO:2000272]; negative regulation of systemic arterial blood pressure [GO:0003085]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of vascular wound healing [GO:0061044]; negative regulation of viral genome replication [GO:0045071]; osteoclast differentiation [GO:0030316]; positive regulation of action potential [GO:0045760]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of apoptotic process [GO:0043065]; positive regulation of blood microparticle formation [GO:2000334]; positive regulation of calcidiol 1-monooxygenase activity [GO:0060559]; positive regulation of calcineurin-NFAT signaling cascade [GO:0070886]; positive regulation of cell adhesion [GO:0045785]; positive regulation of chemokine (C-X-C motif) ligand 2 production [GO:2000343]; positive regulation of chemokine production [GO:0032722]; positive regulation of chronic inflammatory response to antigenic stimulus [GO:0002876]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosis [GO:2001272]; positive regulation of cytokine production [GO:0001819]; positive regulation of cytokine production involved in inflammatory response [GO:1900017]; positive regulation of DNA biosynthetic process [GO:2000573]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of extrinsic apoptotic signaling pathway [GO:2001238]; positive regulation of fever generation [GO:0031622]; positive regulation of fractalkine production [GO:0032724]; positive regulation of gene expression [GO:0010628]; positive regulation of glial cell proliferation [GO:0060252]; positive regulation of hair follicle development [GO:0051798]; positive regulation of hepatocyte proliferation [GO:2000347]; positive regulation of heterotypic cell-cell adhesion [GO:0034116]; positive regulation of humoral immune response mediated by circulating immunoglobulin [GO:0002925]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of I-kappaB phosphorylation [GO:1903721]; positive regulation of inflammatory response [GO:0050729]; positive regulation of interferon-gamma production [GO:0032729]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-18 production [GO:0032741]; positive regulation of interleukin-33 production [GO:0150129]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of JNK cascade [GO:0046330]; positive regulation of JUN kinase activity [GO:0043507]; positive regulation of leukocyte adhesion to arterial endothelial cell [GO:1904999]; positive regulation of leukocyte adhesion to vascular endothelial cell [GO:1904996]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of membrane protein ectodomain proteolysis [GO:0051044]; positive regulation of miRNA transcription [GO:1902895]; positive regulation of mitotic nuclear division [GO:0045840]; positive regulation of mononuclear cell migration [GO:0071677]; positive regulation of neuroinflammatory response [GO:0150078]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of neutrophil activation [GO:1902565]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of nitric-oxide synthase activity [GO:0051000]; positive regulation of nitrogen compound metabolic process [GO:0051173]; positive regulation of osteoclast differentiation [GO:0045672]; positive regulation of oxidative stress-induced neuron death [GO:1903223]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of phagocytosis [GO:0050766]; positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; positive regulation of podosome assembly [GO:0071803]; positive regulation of programmed cell death [GO:0043068]; positive regulation of protein catabolic process [GO:0045732]; positive regulation of protein kinase activity [GO:0045860]; positive regulation of protein kinase B signaling [GO:0051897]; positive regulation of protein localization to cell surface [GO:2000010]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein transport [GO:0051222]; positive regulation of protein-containing complex assembly [GO:0031334]; positive regulation of protein-containing complex disassembly [GO:0043243]; positive regulation of receptor signaling pathway via JAK-STAT [GO:0046427]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of superoxide dismutase activity [GO:1901671]; positive regulation of synaptic transmission [GO:0050806]; positive regulation of synoviocyte proliferation [GO:1901647]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of translational initiation by iron [GO:0045994]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]; positive regulation of vascular associated smooth muscle cell proliferation [GO:1904707]; positive regulation of vitamin D biosynthetic process [GO:0060557]; protein kinase B signaling [GO:0043491]; protein localization to plasma membrane [GO:0072659]; regulation of branching involved in salivary gland morphogenesis [GO:0060693]; regulation of endothelial cell apoptotic process [GO:2000351]; regulation of establishment of endothelial barrier [GO:1903140]; regulation of fat cell differentiation [GO:0045598]; regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043122]; regulation of immunoglobulin production [GO:0002637]; regulation of insulin secretion [GO:0050796]; regulation of reactive oxygen species metabolic process [GO:2000377]; regulation of synapse organization [GO:0050807]; regulation of synaptic transmission, glutamatergic [GO:0051966]; regulation of transcription by RNA polymerase II [GO:0006357]; response to 3,3',5-triiodo-L-thyronine [GO:1905242]; response to activity [GO:0014823]; response to ethanol [GO:0045471]; response to fructose [GO:0009750]; response to glucocorticoid [GO:0051384]; response to gold nanoparticle [GO:1990268]; response to Gram-negative bacterium [GO:0140460]; response to hypoxia [GO:0001666]; response to macrophage colony-stimulating factor [GO:0036005]; response to nutrient levels [GO:0031667]; response to paracetamol [GO:1901554]; response to radiation [GO:0009314]; response to salt stress [GO:0009651]; response to virus [GO:0009615]; response to xenobiotic stimulus [GO:0009410]; sequestering of triglyceride [GO:0030730]; skeletal muscle contraction [GO:0003009]; toll-like receptor 3 signaling pathway [GO:0034138]; tumor necrosis factor-mediated signaling pathway [GO:0033209]; vascular endothelial growth factor production [GO:0010573]; vasodilation [GO:0042311]"	cell surface [GO:0009986]; external side of plasma membrane [GO:0009897]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; membrane raft [GO:0045121]; neuronal cell body [GO:0043025]; phagocytic cup [GO:0001891]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; recycling endosome [GO:0055037]	"cell surface [GO:0009986]; external side of plasma membrane [GO:0009897]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; membrane raft [GO:0045121]; neuronal cell body [GO:0043025]; phagocytic cup [GO:0001891]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; recycling endosome [GO:0055037]; cytokine activity [GO:0005125]; identical protein binding [GO:0042802]; protease binding [GO:0002020]; transcription cis-regulatory region binding [GO:0000976]; tumor necrosis factor receptor binding [GO:0005164]; activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; acute inflammatory response [GO:0002526]; astrocyte activation [GO:0048143]; calcium-mediated signaling [GO:0019722]; cellular response to amino acid stimulus [GO:0071230]; cellular response to amyloid-beta [GO:1904646]; cellular response to interferon-gamma [GO:0071346]; cellular response to nicotine [GO:0071316]; cellular response to organic cyclic compound [GO:0071407]; cellular response to retinoic acid [GO:0071300]; cellular response to toxic substance [GO:0097237]; chronic inflammatory response to antigenic stimulus [GO:0002439]; circadian rhythm [GO:0007623]; cognition [GO:0050890]; cortical actin cytoskeleton organization [GO:0030866]; defense response to Gram-positive bacterium [GO:0050830]; detection of mechanical stimulus involved in sensory perception of pain [GO:0050966]; embryonic digestive tract development [GO:0048566]; endothelial cell apoptotic process [GO:0072577]; epithelial cell proliferation involved in salivary gland morphogenesis [GO:0060664]; extracellular matrix organization [GO:0030198]; extrinsic apoptotic signaling pathway [GO:0097191]; extrinsic apoptotic signaling pathway via death domain receptors [GO:0008625]; glucose metabolic process [GO:0006006]; humoral immune response [GO:0006959]; I-kappaB kinase/NF-kappaB signaling [GO:0007249]; inflammatory response [GO:0006954]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; JNK cascade [GO:0007254]; leukocyte migration involved in inflammatory response [GO:0002523]; leukocyte tethering or rolling [GO:0050901]; lipopolysaccharide-mediated signaling pathway [GO:0031663]; liver regeneration [GO:0097421]; MAPK cascade [GO:0000165]; microglial cell activation [GO:0001774]; necroptotic signaling pathway [GO:0097527]; negative regulation of alkaline phosphatase activity [GO:0010693]; negative regulation of amyloid-beta clearance [GO:1900222]; negative regulation of apoptotic signaling pathway [GO:2001234]; negative regulation of bicellular tight junction assembly [GO:1903347]; negative regulation of bile acid secretion [GO:0120190]; negative regulation of blood vessel endothelial cell migration [GO:0043537]; negative regulation of branching involved in lung morphogenesis [GO:0061048]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of cytokine production involved in immune response [GO:0002719]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of endothelial cell proliferation [GO:0001937]; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001240]; negative regulation of fat cell differentiation [GO:0045599]; negative regulation of gene expression [GO:0010629]; negative regulation of glucose import [GO:0046325]; negative regulation of heart rate [GO:0010459]; negative regulation of interleukin-6 production [GO:0032715]; negative regulation of L-glutamate import across plasma membrane [GO:0002037]; negative regulation of lipid catabolic process [GO:0050995]; negative regulation of lipid storage [GO:0010888]; negative regulation of miRNA maturation [GO:1903799]; negative regulation of mitotic cell cycle [GO:0045930]; negative regulation of myelination [GO:0031642]; negative regulation of myoblast differentiation [GO:0045662]; negative regulation of myosin-light-chain-phosphatase activity [GO:0035509]; negative regulation of neurogenesis [GO:0050768]; negative regulation of osteoblast differentiation [GO:0045668]; negative regulation of oxidative phosphorylation [GO:0090324]; negative regulation of protein-containing complex disassembly [GO:0043242]; negative regulation of signaling receptor activity [GO:2000272]; negative regulation of systemic arterial blood pressure [GO:0003085]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of vascular wound healing [GO:0061044]; negative regulation of viral genome replication [GO:0045071]; osteoclast differentiation [GO:0030316]; positive regulation of action potential [GO:0045760]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of apoptotic process [GO:0043065]; positive regulation of blood microparticle formation [GO:2000334]; positive regulation of calcidiol 1-monooxygenase activity [GO:0060559]; positive regulation of calcineurin-NFAT signaling cascade [GO:0070886]; positive regulation of cell adhesion [GO:0045785]; positive regulation of chemokine (C-X-C motif) ligand 2 production [GO:2000343]; positive regulation of chemokine production [GO:0032722]; positive regulation of chronic inflammatory response to antigenic stimulus [GO:0002876]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosis [GO:2001272]; positive regulation of cytokine production [GO:0001819]; positive regulation of cytokine production involved in inflammatory response [GO:1900017]; positive regulation of DNA biosynthetic process [GO:2000573]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of extrinsic apoptotic signaling pathway [GO:2001238]; positive regulation of fever generation [GO:0031622]; positive regulation of fractalkine production [GO:0032724]; positive regulation of gene expression [GO:0010628]; positive regulation of glial cell proliferation [GO:0060252]; positive regulation of hair follicle development [GO:0051798]; positive regulation of hepatocyte proliferation [GO:2000347]; positive regulation of heterotypic cell-cell adhesion [GO:0034116]; positive regulation of humoral immune response mediated by circulating immunoglobulin [GO:0002925]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of I-kappaB phosphorylation [GO:1903721]; positive regulation of inflammatory response [GO:0050729]; positive regulation of interferon-gamma production [GO:0032729]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-18 production [GO:0032741]; positive regulation of interleukin-33 production [GO:0150129]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of JNK cascade [GO:0046330]; positive regulation of JUN kinase activity [GO:0043507]; positive regulation of leukocyte adhesion to arterial endothelial cell [GO:1904999]; positive regulation of leukocyte adhesion to vascular endothelial cell [GO:1904996]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of membrane protein ectodomain proteolysis [GO:0051044]; positive regulation of miRNA transcription [GO:1902895]; positive regulation of mitotic nuclear division [GO:0045840]; positive regulation of mononuclear cell migration [GO:0071677]; positive regulation of neuroinflammatory response [GO:0150078]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of neutrophil activation [GO:1902565]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of nitric-oxide synthase activity [GO:0051000]; positive regulation of nitrogen compound metabolic process [GO:0051173]; positive regulation of osteoclast differentiation [GO:0045672]; positive regulation of oxidative stress-induced neuron death [GO:1903223]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of phagocytosis [GO:0050766]; positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; positive regulation of podosome assembly [GO:0071803]; positive regulation of programmed cell death [GO:0043068]; positive regulation of protein catabolic process [GO:0045732]; positive regulation of protein kinase activity [GO:0045860]; positive regulation of protein kinase B signaling [GO:0051897]; positive regulation of protein localization to cell surface [GO:2000010]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein transport [GO:0051222]; positive regulation of protein-containing complex assembly [GO:0031334]; positive regulation of protein-containing complex disassembly [GO:0043243]; positive regulation of receptor signaling pathway via JAK-STAT [GO:0046427]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of superoxide dismutase activity [GO:1901671]; positive regulation of synaptic transmission [GO:0050806]; positive regulation of synoviocyte proliferation [GO:1901647]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of translational initiation by iron [GO:0045994]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]; positive regulation of vascular associated smooth muscle cell proliferation [GO:1904707]; positive regulation of vitamin D biosynthetic process [GO:0060557]; protein kinase B signaling [GO:0043491]; protein localization to plasma membrane [GO:0072659]; regulation of branching involved in salivary gland morphogenesis [GO:0060693]; regulation of endothelial cell apoptotic process [GO:2000351]; regulation of establishment of endothelial barrier [GO:1903140]; regulation of fat cell differentiation [GO:0045598]; regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043122]; regulation of immunoglobulin production [GO:0002637]; regulation of insulin secretion [GO:0050796]; regulation of reactive oxygen species metabolic process [GO:2000377]; regulation of synapse organization [GO:0050807]; regulation of synaptic transmission, glutamatergic [GO:0051966]; regulation of transcription by RNA polymerase II [GO:0006357]; response to 3,3',5-triiodo-L-thyronine [GO:1905242]; response to activity [GO:0014823]; response to ethanol [GO:0045471]; response to fructose [GO:0009750]; response to glucocorticoid [GO:0051384]; response to gold nanoparticle [GO:1990268]; response to Gram-negative bacterium [GO:0140460]; response to hypoxia [GO:0001666]; response to macrophage colony-stimulating factor [GO:0036005]; response to nutrient levels [GO:0031667]; response to paracetamol [GO:1901554]; response to radiation [GO:0009314]; response to salt stress [GO:0009651]; response to virus [GO:0009615]; response to xenobiotic stimulus [GO:0009410]; sequestering of triglyceride [GO:0030730]; skeletal muscle contraction [GO:0003009]; toll-like receptor 3 signaling pathway [GO:0034138]; tumor necrosis factor-mediated signaling pathway [GO:0033209]; vascular endothelial growth factor production [GO:0010573]; vasodilation [GO:0042311]"	cytokine activity [GO:0005125]; identical protein binding [GO:0042802]; protease binding [GO:0002020]; transcription cis-regulatory region binding [GO:0000976]; tumor necrosis factor receptor binding [GO:0005164]	GO:0000122; GO:0000165; GO:0000976; GO:0001666; GO:0001774; GO:0001819; GO:0001891; GO:0001934; GO:0001937; GO:0002020; GO:0002037; GO:0002439; GO:0002523; GO:0002526; GO:0002637; GO:0002719; GO:0002876; GO:0002925; GO:0003009; GO:0003085; GO:0005125; GO:0005164; GO:0005576; GO:0005615; GO:0005886; GO:0005887; GO:0006006; GO:0006357; GO:0006919; GO:0006954; GO:0006959; GO:0007249; GO:0007254; GO:0007623; GO:0008625; GO:0008630; GO:0009314; GO:0009410; GO:0009615; GO:0009651; GO:0009750; GO:0009897; GO:0009986; GO:0010459; GO:0010573; GO:0010628; GO:0010629; GO:0010693; GO:0010888; GO:0014068; GO:0014823; GO:0016020; GO:0019722; GO:0030198; GO:0030316; GO:0030730; GO:0030866; GO:0031334; GO:0031622; GO:0031642; GO:0031663; GO:0031667; GO:0032715; GO:0032722; GO:0032724; GO:0032729; GO:0032731; GO:0032741; GO:0032755; GO:0032757; GO:0032991; GO:0033138; GO:0033209; GO:0034116; GO:0034138; GO:0035509; GO:0036005; GO:0042311; GO:0042531; GO:0042802; GO:0043025; GO:0043065; GO:0043068; GO:0043122; GO:0043123; GO:0043154; GO:0043242; GO:0043243; GO:0043280; GO:0043406; GO:0043410; GO:0043491; GO:0043507; GO:0043525; GO:0043537; GO:0045071; GO:0045121; GO:0045429; GO:0045471; GO:0045598; GO:0045599; GO:0045662; GO:0045668; GO:0045672; GO:0045732; GO:0045760; GO:0045785; GO:0045840; GO:0045860; GO:0045892; GO:0045893; GO:0045930; GO:0045944; GO:0045994; GO:0046325; GO:0046330; GO:0046427; GO:0048143; GO:0048566; GO:0048661; GO:0050729; GO:0050766; GO:0050768; GO:0050796; GO:0050806; GO:0050807; GO:0050830; GO:0050890; GO:0050901; GO:0050966; GO:0050995; GO:0051000; GO:0051044; GO:0051091; GO:0051092; GO:0051173; GO:0051222; GO:0051384; GO:0051798; GO:0051897; GO:0051966; GO:0055037; GO:0060252; GO:0060557; GO:0060559; GO:0060664; GO:0060693; GO:0061044; GO:0061048; GO:0070374; GO:0070886; GO:0071230; GO:0071300; GO:0071316; GO:0071346; GO:0071407; GO:0071677; GO:0071803; GO:0072577; GO:0072659; GO:0090324; GO:0097191; GO:0097237; GO:0097421; GO:0097527; GO:0120190; GO:0140460; GO:0150078; GO:0150129; GO:1900017; GO:1900222; GO:1901224; GO:1901554; GO:1901647; GO:1901671; GO:1902004; GO:1902565; GO:1902895; GO:1903078; GO:1903140; GO:1903223; GO:1903347; GO:1903721; GO:1903799; GO:1904646; GO:1904707; GO:1904996; GO:1904999; GO:1905242; GO:1990268; GO:2000010; GO:2000272; GO:2000334; GO:2000343; GO:2000347; GO:2000351; GO:2000377; GO:2000573; GO:2001234; GO:2001238; GO:2001240; GO:2001272	ANALLANGVELR	0.45714	0	9.69389	9.57724	0	0	10.2322	9.12704	11.5821	9.33094	11.945	0	0	0	0	0
B5M0Y2	B5M0Y2_HUMAN	"Estrogen receptor alpha delta 1*,2,3*/663 choroid plexus isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	CYEVGMMKGGIR	0.61261	0	11.5782	11.481	0	0	0	11.8379	0	0	12.1589	11.7742	0	11.6179	0	0
P06702	S10A9_HUMAN	Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)	S100A9 CAGB CFAG MRP14	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; apoptotic process [GO:0006915]; astrocyte development [GO:0014002]; autocrine signaling [GO:0035425]; autophagy [GO:0006914]; cell-cell signaling [GO:0007267]; chronic inflammatory response [GO:0002544]; defense response to bacterium [GO:0042742]; defense response to fungus [GO:0050832]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; leukocyte migration involved in inflammatory response [GO:0002523]; modulation of process of another organism [GO:0035821]; neutrophil aggregation [GO:0070488]; neutrophil chemotaxis [GO:0030593]; peptidyl-cysteine S-nitrosylation [GO:0018119]; peptidyl-cysteine S-trans-nitrosylation [GO:0035606]; positive regulation of cell growth [GO:0030307]; positive regulation of inflammatory response [GO:0050729]; positive regulation of intrinsic apoptotic signaling pathway [GO:2001244]; positive regulation of neuron projection development [GO:0010976]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; regulation of cytoskeleton organization [GO:0051493]; regulation of integrin biosynthetic process [GO:0045113]; response to lipopolysaccharide [GO:0032496]; sequestering of zinc ion [GO:0032119]	cell junction [GO:0030054]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; secretory granule lumen [GO:0034774]	cell junction [GO:0030054]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; secretory granule lumen [GO:0034774]; antioxidant activity [GO:0016209]; arachidonic acid binding [GO:0050544]; calcium ion binding [GO:0005509]; calcium-dependent protein binding [GO:0048306]; microtubule binding [GO:0008017]; RAGE receptor binding [GO:0050786]; Toll-like receptor 4 binding [GO:0035662]; zinc ion binding [GO:0008270]; activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; apoptotic process [GO:0006915]; astrocyte development [GO:0014002]; autocrine signaling [GO:0035425]; autophagy [GO:0006914]; cell-cell signaling [GO:0007267]; chronic inflammatory response [GO:0002544]; defense response to bacterium [GO:0042742]; defense response to fungus [GO:0050832]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; leukocyte migration involved in inflammatory response [GO:0002523]; modulation of process of another organism [GO:0035821]; neutrophil aggregation [GO:0070488]; neutrophil chemotaxis [GO:0030593]; peptidyl-cysteine S-nitrosylation [GO:0018119]; peptidyl-cysteine S-trans-nitrosylation [GO:0035606]; positive regulation of cell growth [GO:0030307]; positive regulation of inflammatory response [GO:0050729]; positive regulation of intrinsic apoptotic signaling pathway [GO:2001244]; positive regulation of neuron projection development [GO:0010976]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; regulation of cytoskeleton organization [GO:0051493]; regulation of integrin biosynthetic process [GO:0045113]; response to lipopolysaccharide [GO:0032496]; sequestering of zinc ion [GO:0032119]	antioxidant activity [GO:0016209]; arachidonic acid binding [GO:0050544]; calcium ion binding [GO:0005509]; calcium-dependent protein binding [GO:0048306]; microtubule binding [GO:0008017]; RAGE receptor binding [GO:0050786]; Toll-like receptor 4 binding [GO:0035662]; zinc ion binding [GO:0008270]	GO:0002523; GO:0002544; GO:0005509; GO:0005576; GO:0005615; GO:0005634; GO:0005654; GO:0005737; GO:0005829; GO:0005856; GO:0005886; GO:0006914; GO:0006915; GO:0006919; GO:0006954; GO:0007267; GO:0008017; GO:0008270; GO:0010976; GO:0014002; GO:0016209; GO:0018119; GO:0030054; GO:0030307; GO:0030593; GO:0032119; GO:0032496; GO:0034774; GO:0035425; GO:0035606; GO:0035662; GO:0035821; GO:0042742; GO:0045087; GO:0045113; GO:0048306; GO:0050544; GO:0050729; GO:0050786; GO:0050832; GO:0051092; GO:0051493; GO:0061844; GO:0062023; GO:0070062; GO:0070488; GO:2001244	DLQNFLK	0.78947	0	10.8955	10.2535	0	0	0	0	9.59328	9.699	8.96798	0	0	0	10.5691	10.2038
P10145	IL8_HUMAN	Interleukin-8 (IL-8) (C-X-C motif chemokine 8) (Chemokine (C-X-C motif) ligand 8) (Emoctakin) (Granulocyte chemotactic protein 1) (GCP-1) (Monocyte-derived neutrophil chemotactic factor) (MDNCF) (Monocyte-derived neutrophil-activating peptide) (MONAP) (Neutrophil-activating protein 1) (NAP-1) (Protein 3-10C) (T-cell chemotactic factor) [Cleaved into: MDNCF-a (GCP/IL-8 protein IV) (IL8/NAP1 form I); Interleukin-8 ((Ala-IL-8)77) (GCP/IL-8 protein II) (IL-8(1-77)) (IL8/NAP1 form II) (MDNCF-b); IL-8(5-77); IL-8(6-77) ((Ser-IL-8)72) (GCP/IL-8 protein I) (IL8/NAP1 form III) (Lymphocyte-derived neutrophil-activating factor) (LYNAP) (MDNCF-c) (Neutrophil-activating factor) (NAF); IL-8(7-77) (GCP/IL-8 protein V) (IL8/NAP1 form IV); IL-8(8-77) (GCP/IL-8 protein VI) (IL8/NAP1 form V); IL-8(9-77) (GCP/IL-8 protein III) (IL8/NAP1 form VI)]	CXCL8 IL8	Homo sapiens (Human)	angiogenesis [GO:0001525]; antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; calcium-mediated signaling [GO:0019722]; cellular response to fibroblast growth factor stimulus [GO:0044344]; cellular response to interleukin-1 [GO:0071347]; cellular response to lipopolysaccharide [GO:0071222]; cellular response to tumor necrosis factor [GO:0071356]; chemokine-mediated signaling pathway [GO:0070098]; chemotaxis [GO:0006935]; embryonic digestive tract development [GO:0048566]; G protein-coupled receptor signaling pathway [GO:0007186]; induction of positive chemotaxis [GO:0050930]; inflammatory response [GO:0006954]; intracellular signal transduction [GO:0035556]; killing of cells of another organism [GO:0031640]; negative regulation of cell adhesion molecule production [GO:0060354]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of G protein-coupled receptor signaling pathway [GO:0045744]; negative regulation of gene expression [GO:0010629]; neutrophil activation [GO:0042119]; neutrophil chemotaxis [GO:0030593]; positive regulation of angiogenesis [GO:0045766]; positive regulation of cellular biosynthetic process [GO:0031328]; positive regulation of gene expression [GO:0010628]; positive regulation of neutrophil chemotaxis [GO:0090023]; receptor internalization [GO:0031623]; regulation of cell adhesion [GO:0030155]; regulation of entry of bacterium into host cell [GO:2000535]; regulation of single stranded viral RNA replication via double stranded DNA intermediate [GO:0045091]; response to endoplasmic reticulum stress [GO:0034976]; response to molecule of bacterial origin [GO:0002237]; signal transduction [GO:0007165]	extracellular region [GO:0005576]; extracellular space [GO:0005615]	extracellular region [GO:0005576]; extracellular space [GO:0005615]; chemokine activity [GO:0008009]; CXCR chemokine receptor binding [GO:0045236]; heparin binding [GO:0008201]; interleukin-8 receptor binding [GO:0005153]; angiogenesis [GO:0001525]; antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; calcium-mediated signaling [GO:0019722]; cellular response to fibroblast growth factor stimulus [GO:0044344]; cellular response to interleukin-1 [GO:0071347]; cellular response to lipopolysaccharide [GO:0071222]; cellular response to tumor necrosis factor [GO:0071356]; chemokine-mediated signaling pathway [GO:0070098]; chemotaxis [GO:0006935]; embryonic digestive tract development [GO:0048566]; G protein-coupled receptor signaling pathway [GO:0007186]; induction of positive chemotaxis [GO:0050930]; inflammatory response [GO:0006954]; intracellular signal transduction [GO:0035556]; killing of cells of another organism [GO:0031640]; negative regulation of cell adhesion molecule production [GO:0060354]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of G protein-coupled receptor signaling pathway [GO:0045744]; negative regulation of gene expression [GO:0010629]; neutrophil activation [GO:0042119]; neutrophil chemotaxis [GO:0030593]; positive regulation of angiogenesis [GO:0045766]; positive regulation of cellular biosynthetic process [GO:0031328]; positive regulation of gene expression [GO:0010628]; positive regulation of neutrophil chemotaxis [GO:0090023]; receptor internalization [GO:0031623]; regulation of cell adhesion [GO:0030155]; regulation of entry of bacterium into host cell [GO:2000535]; regulation of single stranded viral RNA replication via double stranded DNA intermediate [GO:0045091]; response to endoplasmic reticulum stress [GO:0034976]; response to molecule of bacterial origin [GO:0002237]; signal transduction [GO:0007165]	chemokine activity [GO:0008009]; CXCR chemokine receptor binding [GO:0045236]; heparin binding [GO:0008201]; interleukin-8 receptor binding [GO:0005153]	GO:0001525; GO:0002237; GO:0005153; GO:0005576; GO:0005615; GO:0006935; GO:0006954; GO:0007165; GO:0007186; GO:0008009; GO:0008201; GO:0008285; GO:0010628; GO:0010629; GO:0019722; GO:0030155; GO:0030593; GO:0031328; GO:0031623; GO:0031640; GO:0034976; GO:0035556; GO:0042119; GO:0044344; GO:0045091; GO:0045236; GO:0045744; GO:0045766; GO:0048566; GO:0050930; GO:0060354; GO:0061844; GO:0070098; GO:0071222; GO:0071347; GO:0071356; GO:0090023; GO:2000535	CQCIKTYSKPFHPK	0.93017	0	11.0968	0	0	0	0	9.83023	0	9.45672	0	9.60777	9.61815	0	9.7616	9.76995
B5TZ83	B5TZ83_HUMAN	Estrogen receptor alpha splice variant	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	CYEVGMMKGGIR	0.44444	0	11.6959	0	10.4855	10.8224	0	0	0	0	0	13.5287	0	11.3636	0	10.7864
B4DFJ8	B4DFJ8_HUMAN	Urea transporter	SLC14A1	Homo sapiens (Human)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; urea transmembrane transporter activity [GO:0015204]	urea transmembrane transporter activity [GO:0015204]	GO:0005886; GO:0015204; GO:0016021	ALLLSQDR	0.81507	10.1689	0	9.59805	0	0	11.9099	0	0	0	10.9457	0	0	0	13.0792	12.4612
A8K0M4	A8K0M4_HUMAN	"Ephrin-A1, isoform CRA_c (cDNA FLJ75959, highly similar to Homo sapiens ephrin-A1 (EFNA1), transcript variant 2, mRNA)"	EFNA1 hCG_1745153	Homo sapiens (Human)	ephrin receptor signaling pathway [GO:0048013]	anchored component of membrane [GO:0031225]; plasma membrane [GO:0005886]	anchored component of membrane [GO:0031225]; plasma membrane [GO:0005886]; ephrin receptor binding [GO:0046875]; ephrin receptor signaling pathway [GO:0048013]	ephrin receptor binding [GO:0046875]	GO:0005886; GO:0031225; GO:0046875; GO:0048013	DQVRWQCNRPSAK	0.62869	0	0	0	0	0	0	0	0	9.69834	8.8874	0	9.9103	10.7429	14.5104	14.2925
P46089	GPR3_HUMAN	G-protein coupled receptor 3 (ACCA orphan receptor)	GPR3 ACCA	Homo sapiens (Human)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; positive regulation of cAMP-mediated signaling [GO:0043950]; positive regulation of cold-induced thermogenesis [GO:0120162]; regulation of cytosolic calcium ion concentration [GO:0051480]; regulation of meiotic nuclear division [GO:0040020]; regulation of metabolic process [GO:0019222]	cytoplasm [GO:0005737]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; G protein-coupled receptor activity [GO:0004930]; adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; positive regulation of cAMP-mediated signaling [GO:0043950]; positive regulation of cold-induced thermogenesis [GO:0120162]; regulation of cytosolic calcium ion concentration [GO:0051480]; regulation of meiotic nuclear division [GO:0040020]; regulation of metabolic process [GO:0019222]	G protein-coupled receptor activity [GO:0004930]	GO:0004930; GO:0005737; GO:0005886; GO:0005887; GO:0007189; GO:0019222; GO:0040020; GO:0043950; GO:0051480; GO:0120162	HAQQIALQR	0.28571	9.97885	10.8339	9.85632	0	0	0	9.57809	0	0	0	9.51489	0	9.63143	0	8.63249
Q9B2U4	Q9B2U4_HUMAN	NADH-ubiquinone oxidoreductase chain 6 (EC 7.1.1.2)	ND6	Homo sapiens (Human)		integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]	NADH dehydrogenase (ubiquinone) activity [GO:0008137]	GO:0005743; GO:0008137; GO:0016021; GO:0070469	EDPIGAGALYDYGR	0.25397	12.4448	12.2254	12.0226	0	9.02525	0	0	0	0	0	0	12.5696	9.36087	0	0
P08700	IL3_HUMAN	Interleukin-3 (IL-3) (Hematopoietic growth factor) (Mast cell growth factor) (MCGF) (Multipotential colony-stimulating factor) (P-cell-stimulating factor)	IL3	Homo sapiens (Human)	cell-cell signaling [GO:0007267]; embryonic hemopoiesis [GO:0035162]; immune response [GO:0006955]; nervous system development [GO:0007399]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]	extracellular region [GO:0005576]; extracellular space [GO:0005615]	extracellular region [GO:0005576]; extracellular space [GO:0005615]; cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; interleukin-3 receptor binding [GO:0005135]; cell-cell signaling [GO:0007267]; embryonic hemopoiesis [GO:0035162]; immune response [GO:0006955]; nervous system development [GO:0007399]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]	cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; interleukin-3 receptor binding [GO:0005135]	GO:0005125; GO:0005135; GO:0005576; GO:0005615; GO:0006955; GO:0007267; GO:0007399; GO:0008083; GO:0008284; GO:0035162; GO:0042531; GO:0050731	AVKSLQNASAIESILK	0.82653	0	9.6731	0	8.40259	9.04264	0	0	9.18889	10.143	10.2181	0	0	0	0	10.1866
Q96I26	Q96I26_HUMAN	"PTPN11 protein (cDNA, FLJ92431)"	PTPN11	Homo sapiens (Human)						CLVKGDR	0.92717	0	0	8.99836	0	0	9.36521	0	0	10.2915	0	10.5036	12.9307	0	10.3718	0
P01583	IL1A_HUMAN	Interleukin-1 alpha (IL-1 alpha) (Hematopoietin-1)	IL1A IL1F1	Homo sapiens (Human)	apoptotic process [GO:0006915]; cellular response to heat [GO:0034605]; cellular response to lipopolysaccharide [GO:0071222]; cellular sodium ion homeostasis [GO:0006883]; connective tissue replacement involved in inflammatory response wound healing [GO:0002248]; cytokine-mediated signaling pathway [GO:0019221]; ectopic germ cell programmed cell death [GO:0035234]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; fever generation [GO:0001660]; heart development [GO:0007507]; immune response [GO:0006955]; inflammatory response [GO:0006954]; keratinization [GO:0031424]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of establishment of Sertoli cell barrier [GO:1904445]; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001240]; positive regulation of angiogenesis [GO:0045766]; positive regulation of cell division [GO:0051781]; positive regulation of cytokine production [GO:0001819]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of gene expression [GO:0010628]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of immature T cell proliferation in thymus [GO:0033092]; positive regulation of interleukin-2 production [GO:0032743]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of JNK cascade [GO:0046330]; positive regulation of mitotic nuclear division [GO:0045840]; positive regulation of neutrophil migration [GO:1902624]; positive regulation of prostaglandin secretion [GO:0032308]; positive regulation of protein secretion [GO:0050714]; positive regulation of steroid biosynthetic process [GO:0010893]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of vascular endothelial growth factor production [GO:0010575]; regulation of actin cytoskeleton organization [GO:0032956]; regulation of nitric-oxide synthase activity [GO:0050999]; regulation of sensory perception of pain [GO:0051930]; response to copper ion [GO:0046688]; response to gamma radiation [GO:0010332]; response to hypoxia [GO:0001666]; response to L-ascorbic acid [GO:0033591]; response to organonitrogen compound [GO:0010243]; response to ozone [GO:0010193]; spermatogenesis [GO:0007283]	cell surface [GO:0009986]; cytosol [GO:0005829]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]	cell surface [GO:0009986]; cytosol [GO:0005829]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]; copper ion binding [GO:0005507]; cytokine activity [GO:0005125]; interleukin-1 receptor binding [GO:0005149]; apoptotic process [GO:0006915]; cellular response to heat [GO:0034605]; cellular response to lipopolysaccharide [GO:0071222]; cellular sodium ion homeostasis [GO:0006883]; connective tissue replacement involved in inflammatory response wound healing [GO:0002248]; cytokine-mediated signaling pathway [GO:0019221]; ectopic germ cell programmed cell death [GO:0035234]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; fever generation [GO:0001660]; heart development [GO:0007507]; immune response [GO:0006955]; inflammatory response [GO:0006954]; keratinization [GO:0031424]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of establishment of Sertoli cell barrier [GO:1904445]; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001240]; positive regulation of angiogenesis [GO:0045766]; positive regulation of cell division [GO:0051781]; positive regulation of cytokine production [GO:0001819]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of gene expression [GO:0010628]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of immature T cell proliferation in thymus [GO:0033092]; positive regulation of interleukin-2 production [GO:0032743]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of JNK cascade [GO:0046330]; positive regulation of mitotic nuclear division [GO:0045840]; positive regulation of neutrophil migration [GO:1902624]; positive regulation of prostaglandin secretion [GO:0032308]; positive regulation of protein secretion [GO:0050714]; positive regulation of steroid biosynthetic process [GO:0010893]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of vascular endothelial growth factor production [GO:0010575]; regulation of actin cytoskeleton organization [GO:0032956]; regulation of nitric-oxide synthase activity [GO:0050999]; regulation of sensory perception of pain [GO:0051930]; response to copper ion [GO:0046688]; response to gamma radiation [GO:0010332]; response to hypoxia [GO:0001666]; response to L-ascorbic acid [GO:0033591]; response to organonitrogen compound [GO:0010243]; response to ozone [GO:0010193]; spermatogenesis [GO:0007283]	copper ion binding [GO:0005507]; cytokine activity [GO:0005125]; interleukin-1 receptor binding [GO:0005149]	GO:0001660; GO:0001666; GO:0001819; GO:0002248; GO:0005125; GO:0005149; GO:0005507; GO:0005576; GO:0005615; GO:0005829; GO:0005886; GO:0006883; GO:0006915; GO:0006954; GO:0006955; GO:0007283; GO:0007507; GO:0008285; GO:0009986; GO:0010193; GO:0010243; GO:0010332; GO:0010575; GO:0010628; GO:0010893; GO:0019221; GO:0031424; GO:0032308; GO:0032743; GO:0032755; GO:0032760; GO:0032956; GO:0033092; GO:0033591; GO:0034605; GO:0035234; GO:0043123; GO:0045766; GO:0045840; GO:0045944; GO:0046330; GO:0046688; GO:0050714; GO:0050999; GO:0051781; GO:0051930; GO:0070374; GO:0071222; GO:0097192; GO:1902624; GO:1904445; GO:2001240	ANDQYLTAAALHNLDEAVK	0.92746	11.2971	0	10.4211	0	0	0	0	9.63205	0	0	11.0461	0	0	9.32249	9.46052
Q5RLM1	Q5RLM1_HUMAN	Neuronal acetylcholine receptor alpha-4 subunit	CHRNA4	Homo sapiens (Human)						DEKNQMMTTNVWVK	0.54167	9.32033	0	0	0	0	0	0	0	8.85175	10.4112	11.0184	9.75629	0	9.93514	0
Q5TCK7	Q5TCK7_HUMAN	"Progestin and adipoQ receptor family member VI, isoform CRA_a (cDNA FLJ54068, highly similar to Progestin and adipoQ receptor family member 6)"	PAQR6 hCG_17185	Homo sapiens (Human)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GO:0016021	APSTCPLLQGGPLEGGTQAK	0.72908	0	10.2037	0	0	0	0	9.81845	9.67569	10.5011	0	9.49231	9.51694	0	0	0
Q71HJ6	Q71HJ6_HUMAN	Synaptopodin		Homo sapiens (Human)						AKQAPRPSFSTR	0.42169	8.19545	10.5929	8.53609	0	0	0	0	10.6212	0	0	7.815	0	0	0	12.8447
Q9Y5Z0	BACE2_HUMAN	Beta-secretase 2 (EC 3.4.23.45) (Aspartic-like protease 56 kDa) (Aspartyl protease 1) (ASP1) (Asp 1) (Beta-site amyloid precursor protein cleaving enzyme 2) (Beta-site APP cleaving enzyme 2) (Down region aspartic protease) (DRAP) (Memapsin-1) (Membrane-associated aspartic protease 1) (Theta-secretase)	BACE2 AEPLC ALP56 ASP21 CDA13 UNQ418/PRO852	Homo sapiens (Human)	amyloid-beta metabolic process [GO:0050435]; glucose homeostasis [GO:0042593]; melanosome organization [GO:0032438]; membrane protein ectodomain proteolysis [GO:0006509]; negative regulation of amyloid precursor protein biosynthetic process [GO:0042985]; peptide hormone processing [GO:0016486]; protein processing [GO:0016485]; proteolysis [GO:0006508]	endoplasmic reticulum [GO:0005783]; endosome [GO:0005768]; Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; melanosome membrane [GO:0033162]; plasma membrane [GO:0005886]; trans-Golgi network [GO:0005802]	endoplasmic reticulum [GO:0005783]; endosome [GO:0005768]; Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; melanosome membrane [GO:0033162]; plasma membrane [GO:0005886]; trans-Golgi network [GO:0005802]; aspartic-type endopeptidase activity [GO:0004190]; amyloid-beta metabolic process [GO:0050435]; glucose homeostasis [GO:0042593]; melanosome organization [GO:0032438]; membrane protein ectodomain proteolysis [GO:0006509]; negative regulation of amyloid precursor protein biosynthetic process [GO:0042985]; peptide hormone processing [GO:0016486]; protein processing [GO:0016485]; proteolysis [GO:0006508]	aspartic-type endopeptidase activity [GO:0004190]	GO:0004190; GO:0005768; GO:0005783; GO:0005794; GO:0005802; GO:0005886; GO:0006508; GO:0006509; GO:0016021; GO:0016485; GO:0016486; GO:0032438; GO:0033162; GO:0042593; GO:0042985; GO:0050435	AAPELAPAPFTLPLR	0.98739	0	0	10.5936	0	0	8.94606	0	0	14.2118	0	11.3734	10.3449	0	0	0
B4DFJ2	B4DFJ2_HUMAN	"cDNA FLJ59018, highly similar to Protein FAM35A"		Homo sapiens (Human)						CGLELETDENR	0.61472	0	0	0	0	0	9.65324	0	0	10.015	11.1621	12.2858	11.5158	0	0	0
Q6ZPB5	SDIM1_HUMAN	Stress-responsive DNAJB4-interacting membrane protein 1	SDIM1	Homo sapiens (Human)	cellular response to hypoxia [GO:0071456]; negative regulation of cell death [GO:0060548]; neuron apoptotic process [GO:0051402]	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; protein homodimerization activity [GO:0042803]; cellular response to hypoxia [GO:0071456]; negative regulation of cell death [GO:0060548]; neuron apoptotic process [GO:0051402]	protein homodimerization activity [GO:0042803]	GO:0016021; GO:0042803; GO:0051402; GO:0060548; GO:0071456	FVICRLDQHIFSGFTK	0.78521	0	0	0	0	0	0	11.1787	0	11.5067	10.4183	11.0327	0	10.2755	0	0
Q4GQ65	Q4GQ65_HUMAN	NADH-ubiquinone oxidoreductase chain 4 (EC 7.1.1.2)	NADH4 ND4	Homo sapiens (Human)	ATP synthesis coupled electron transport [GO:0042773]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]; ATP synthesis coupled electron transport [GO:0042773]	NADH dehydrogenase (ubiquinone) activity [GO:0008137]	GO:0005743; GO:0008137; GO:0016021; GO:0042773; GO:0070469	HLSSEPLSR	0.32609	0	10.6348	0	0	0	0	0	0	11.0658	0	0	12.1384	10.4729	10.0607	0
B4DFK3	B4DFK3_HUMAN	"Rhomboid, veinlet-like 1 (Drosophila), isoform CRA_b (cDNA FLJ50740, highly similar to Rhomboid-related protein 1)"	RHBDL1 hCG_22418	Homo sapiens (Human)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; serine-type endopeptidase activity [GO:0004252]	serine-type endopeptidase activity [GO:0004252]	GO:0004252; GO:0016021	AIANGQR	0.92837	10.7864	0	0	0	0	0	0	0	0	12.2255	11.6497	0	0	10.2733	8.89066
Q6LDQ3	Q6LDQ3_HUMAN	Sulfated glycoprotein 2		Homo sapiens (Human)		extracellular region [GO:0005576]; mitochondrial membrane [GO:0031966]; perinuclear region of cytoplasm [GO:0048471]	extracellular region [GO:0005576]; mitochondrial membrane [GO:0031966]; perinuclear region of cytoplasm [GO:0048471]		GO:0005576; GO:0031966; GO:0048471	FYARVCR	0.37342	0	0	0	0	9.14129	8.85863	8.85215	8.8062	0	0	9.21427	0	0	0	8.77982
B5TZ79	B5TZ79_HUMAN	Estrogen receptor alpha splice variant	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQCTIDK	0.29927	0	0	0	9.87553	0	0	10.8446	9.9276	0	10.8474	0	0	0	0	11.4668
B4DFJ7	B4DFJ7_HUMAN	"Tetraspanin 31, isoform CRA_a (cDNA FLJ55837, highly similar to Tetraspanin-31)"	TSPAN31 hCG_40149	Homo sapiens (Human)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GO:0016021	ANPSAFL	0.94609	10.9656	0	11.2342	8.93708	0	0	0	0	10.6859	0	0	0	11.0062	0	0
B4DFG1	B4DFG1_HUMAN	N-terminal amino-acid N(alpha)-acetyltransferase NatA (EC 2.3.1.255)		Homo sapiens (Human)	N-terminal protein amino acid acetylation [GO:0006474]	NatA complex [GO:0031415]	NatA complex [GO:0031415]; peptide alpha-N-acetyltransferase activity [GO:0004596]; N-terminal protein amino acid acetylation [GO:0006474]	peptide alpha-N-acetyltransferase activity [GO:0004596]	GO:0004596; GO:0006474; GO:0031415	AMIENFNAK	0.41509	10.6055	10.56	0	0	0	0	0	10.9327	0	9.60966	0	0	0	0	10.7647
P39905	GDNF_HUMAN	Glial cell line-derived neurotrophic factor (hGDNF) (Astrocyte-derived trophic factor) (ATF)	GDNF	Homo sapiens (Human)	adult locomotory behavior [GO:0008344]; branching involved in ureteric bud morphogenesis [GO:0001658]; commissural neuron axon guidance [GO:0071679]; dorsal spinal cord development [GO:0021516]; embryonic organ development [GO:0048568]; enteric nervous system development [GO:0048484]; mesenchymal to epithelial transition involved in metanephros morphogenesis [GO:0003337]; metanephros development [GO:0001656]; mRNA stabilization [GO:0048255]; negative regulation of apoptotic process [GO:0043066]; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001240]; negative regulation of neuron apoptotic process [GO:0043524]; nervous system development [GO:0007399]; neural crest cell migration [GO:0001755]; neuron projection development [GO:0031175]; organ induction [GO:0001759]; peripheral nervous system development [GO:0007422]; peristalsis [GO:0030432]; positive regulation of branching involved in ureteric bud morphogenesis [GO:0090190]; positive regulation of cell differentiation [GO:0045597]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of dopamine secretion [GO:0033603]; positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis [GO:0072108]; positive regulation of monooxygenase activity [GO:0032770]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of ureteric bud formation [GO:0072107]; postganglionic parasympathetic fiber development [GO:0021784]; postsynaptic membrane organization [GO:0001941]; regulation of dopamine uptake involved in synaptic transmission [GO:0051584]; regulation of gene expression [GO:0010468]; regulation of morphogenesis of a branching structure [GO:0060688]; regulation of semaphorin-plexin signaling pathway [GO:2001260]; regulation of stem cell differentiation [GO:2000736]; signal transduction [GO:0007165]; sympathetic nervous system development [GO:0048485]; ureteric bud formation [GO:0060676]	extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]	extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; chemoattractant activity involved in axon guidance [GO:1902379]; glial cell-derived neurotrophic factor receptor binding [GO:0030116]; growth factor activity [GO:0008083]; protein homodimerization activity [GO:0042803]; receptor tyrosine kinase binding [GO:0030971]; signaling receptor binding [GO:0005102]; adult locomotory behavior [GO:0008344]; branching involved in ureteric bud morphogenesis [GO:0001658]; commissural neuron axon guidance [GO:0071679]; dorsal spinal cord development [GO:0021516]; embryonic organ development [GO:0048568]; enteric nervous system development [GO:0048484]; mesenchymal to epithelial transition involved in metanephros morphogenesis [GO:0003337]; metanephros development [GO:0001656]; mRNA stabilization [GO:0048255]; negative regulation of apoptotic process [GO:0043066]; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001240]; negative regulation of neuron apoptotic process [GO:0043524]; nervous system development [GO:0007399]; neural crest cell migration [GO:0001755]; neuron projection development [GO:0031175]; organ induction [GO:0001759]; peripheral nervous system development [GO:0007422]; peristalsis [GO:0030432]; positive regulation of branching involved in ureteric bud morphogenesis [GO:0090190]; positive regulation of cell differentiation [GO:0045597]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of dopamine secretion [GO:0033603]; positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis [GO:0072108]; positive regulation of monooxygenase activity [GO:0032770]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of ureteric bud formation [GO:0072107]; postganglionic parasympathetic fiber development [GO:0021784]; postsynaptic membrane organization [GO:0001941]; regulation of dopamine uptake involved in synaptic transmission [GO:0051584]; regulation of gene expression [GO:0010468]; regulation of morphogenesis of a branching structure [GO:0060688]; regulation of semaphorin-plexin signaling pathway [GO:2001260]; regulation of stem cell differentiation [GO:2000736]; signal transduction [GO:0007165]; sympathetic nervous system development [GO:0048485]; ureteric bud formation [GO:0060676]	chemoattractant activity involved in axon guidance [GO:1902379]; glial cell-derived neurotrophic factor receptor binding [GO:0030116]; growth factor activity [GO:0008083]; protein homodimerization activity [GO:0042803]; receptor tyrosine kinase binding [GO:0030971]; signaling receptor binding [GO:0005102]	GO:0001656; GO:0001658; GO:0001755; GO:0001759; GO:0001941; GO:0003337; GO:0005102; GO:0005576; GO:0005615; GO:0005794; GO:0007165; GO:0007399; GO:0007422; GO:0008083; GO:0008284; GO:0008344; GO:0010468; GO:0021516; GO:0021784; GO:0030116; GO:0030432; GO:0030971; GO:0031175; GO:0032770; GO:0033603; GO:0042803; GO:0043066; GO:0043524; GO:0045597; GO:0045944; GO:0048255; GO:0048484; GO:0048485; GO:0048568; GO:0051584; GO:0060676; GO:0060688; GO:0071679; GO:0072107; GO:0072108; GO:0090190; GO:1902379; GO:2000736; GO:2001240; GO:2001260	EELIFRYCSGSCDAAETTYDK	0.98574	11.2115	0	0	8.37595	0	0	0	0	0	9.99577	0	0	0	12.1223	9.54738
A0A7P0T924	A0A7P0T924_HUMAN	Beta-secretase 1 (EC 3.4.23.46) (Beta-site amyloid precursor protein cleaving enzyme 1) (Memapsin-2) (Membrane-associated aspartic protease 2)	BACE1	Homo sapiens (Human)	proteolysis [GO:0006508]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]; aspartic-type endopeptidase activity [GO:0004190]; proteolysis [GO:0006508]	aspartic-type endopeptidase activity [GO:0004190]	GO:0004190; GO:0005770; GO:0005794; GO:0006508; GO:0016021; GO:0045121; GO:0055037	AASSTEK	0.27692	0	10.4853	0	0	9.24809	0	0	10.5602	0	10.0824	0	0	0	0	10.3705
P49755	TMEDA_HUMAN	Transmembrane emp24 domain-containing protein 10 (Protein TMED10) (21 kDa transmembrane-trafficking protein) (S31I125) (S31III125) (Tmp-21-I) (Transmembrane protein Tmp21) (p23) (p24 family protein delta-1) (p24delta1) (p24delta)	TMED10 TMP21	Homo sapiens (Human)	"COPI coating of Golgi vesicle [GO:0048205]; COPI-coated vesicle budding [GO:0035964]; COPII vesicle coating [GO:0048208]; cytosol to ERGIC protein transport [GO:0106273]; endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; Golgi organization [GO:0007030]; intracellular protein transport [GO:0006886]; negative regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902960]; positive regulation of interleukin-1 production [GO:0032732]; positive regulation of protein secretion [GO:0050714]; protein localization to ERGIC [GO:0106272]; regulated exocytosis [GO:0045055]; regulation of amyloid-beta formation [GO:1902003]; retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum [GO:0006890]; vesicle cargo loading [GO:0035459]; vesicle targeting, to, from or within Golgi [GO:0048199]"	cis-Golgi network [GO:0005801]; COPI-coated vesicle [GO:0030137]; COPII-coated ER to Golgi transport vesicle [GO:0030134]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; ER to Golgi transport vesicle membrane [GO:0012507]; gamma-secretase complex [GO:0070765]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; melanosome [GO:0042470]; plasma membrane [GO:0005886]; secretory granule membrane [GO:0030667]; trans-Golgi network transport vesicle [GO:0030140]; transport vesicle [GO:0030133]; zymogen granule membrane [GO:0042589]	"cis-Golgi network [GO:0005801]; COPI-coated vesicle [GO:0030137]; COPII-coated ER to Golgi transport vesicle [GO:0030134]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; ER to Golgi transport vesicle membrane [GO:0012507]; gamma-secretase complex [GO:0070765]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; melanosome [GO:0042470]; plasma membrane [GO:0005886]; secretory granule membrane [GO:0030667]; trans-Golgi network transport vesicle [GO:0030140]; transport vesicle [GO:0030133]; zymogen granule membrane [GO:0042589]; protein transmembrane transporter activity [GO:0008320]; syntaxin binding [GO:0019905]; COPI coating of Golgi vesicle [GO:0048205]; COPI-coated vesicle budding [GO:0035964]; COPII vesicle coating [GO:0048208]; cytosol to ERGIC protein transport [GO:0106273]; endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; Golgi organization [GO:0007030]; intracellular protein transport [GO:0006886]; negative regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process [GO:1902960]; positive regulation of interleukin-1 production [GO:0032732]; positive regulation of protein secretion [GO:0050714]; protein localization to ERGIC [GO:0106272]; regulated exocytosis [GO:0045055]; regulation of amyloid-beta formation [GO:1902003]; retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum [GO:0006890]; vesicle cargo loading [GO:0035459]; vesicle targeting, to, from or within Golgi [GO:0048199]"	protein transmembrane transporter activity [GO:0008320]; syntaxin binding [GO:0019905]	GO:0000139; GO:0005783; GO:0005789; GO:0005793; GO:0005794; GO:0005801; GO:0005886; GO:0006886; GO:0006888; GO:0006890; GO:0007030; GO:0008320; GO:0012507; GO:0016021; GO:0019905; GO:0030133; GO:0030134; GO:0030137; GO:0030140; GO:0030667; GO:0032732; GO:0033116; GO:0035459; GO:0035964; GO:0042470; GO:0042589; GO:0045055; GO:0048199; GO:0048205; GO:0048208; GO:0050714; GO:0070765; GO:0106272; GO:0106273; GO:1902003; GO:1902960	CLREEIHK	0.70325	9.5741	0	0	0	0	8.87609	0	0	10.3851	0	0	0	9.73132	11.971	0
Q8IVG9	HUNIN_HUMAN	Humanin (Humanin mitochondrial) (HNM)	MT-RNR2 HN	Homo sapiens (Human)	apoptotic process [GO:0006915]; cellular iron ion homeostasis [GO:0006879]; cellular response to amyloid-beta [GO:1904646]; leukocyte chemotaxis [GO:0030595]; mitochondrion organization [GO:0007005]; negative regulation of amyloid fibril formation [GO:1905907]; negative regulation of apoptotic process [GO:0043066]; negative regulation of execution phase of apoptosis [GO:1900118]; negative regulation of inflammatory response [GO:0050728]; negative regulation of interleukin-1 production [GO:0032692]; negative regulation of interleukin-18 production [GO:0032701]; negative regulation of neuroinflammatory response [GO:0150079]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of neuron death [GO:1901215]; negative regulation of NLRP3 inflammasome complex assembly [GO:1900226]; negative regulation of response to oxidative stress [GO:1902883]; supramolecular fiber organization [GO:0097435]	cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; sperm flagellum [GO:0036126]; sperm midpiece [GO:0097225]	cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; sperm flagellum [GO:0036126]; sperm midpiece [GO:0097225]; G protein-coupled receptor binding [GO:0001664]; identical protein binding [GO:0042802]; protein self-association [GO:0043621]; receptor antagonist activity [GO:0048019]; signaling receptor binding [GO:0005102]; apoptotic process [GO:0006915]; cellular iron ion homeostasis [GO:0006879]; cellular response to amyloid-beta [GO:1904646]; leukocyte chemotaxis [GO:0030595]; mitochondrion organization [GO:0007005]; negative regulation of amyloid fibril formation [GO:1905907]; negative regulation of apoptotic process [GO:0043066]; negative regulation of execution phase of apoptosis [GO:1900118]; negative regulation of inflammatory response [GO:0050728]; negative regulation of interleukin-1 production [GO:0032692]; negative regulation of interleukin-18 production [GO:0032701]; negative regulation of neuroinflammatory response [GO:0150079]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of neuron death [GO:1901215]; negative regulation of NLRP3 inflammasome complex assembly [GO:1900226]; negative regulation of response to oxidative stress [GO:1902883]; supramolecular fiber organization [GO:0097435]	G protein-coupled receptor binding [GO:0001664]; identical protein binding [GO:0042802]; protein self-association [GO:0043621]; receptor antagonist activity [GO:0048019]; signaling receptor binding [GO:0005102]	GO:0001664; GO:0005102; GO:0005576; GO:0005615; GO:0005634; GO:0005737; GO:0005739; GO:0006879; GO:0006915; GO:0007005; GO:0030595; GO:0032692; GO:0032701; GO:0036126; GO:0042802; GO:0043066; GO:0043524; GO:0043621; GO:0048019; GO:0048471; GO:0050728; GO:0097225; GO:0097435; GO:0150079; GO:1900118; GO:1900226; GO:1901215; GO:1902883; GO:1904646; GO:1905907	GFSCLLLLTSEIDLPVK	0.48485	0	0	0	0	0	0	9.35151	11.933	9.69258	0	0	0	0	9.58184	9.79734
C8CJL0	C8CJL0_HUMAN	"Estrogen receptor alpha delta 2*,3,4,5,6,7 isoform"	ESR1	Homo sapiens (Human)						ETRYCAVCNDYASGYH	0.47222	9.775	0	9.22776	0	0	8.84213	0	0	0	11.532	10.5177	0	0	0	0
P0C7U1	ASA2B_HUMAN	Putative inactive neutral ceramidase B (ASAH2-like protein) (Putative inactive N-acylsphingosine amidohydrolase 2B) (Putative inactive non-lysosomal ceramidase B)	ASAH2B ASAH2C ASAH2L	Homo sapiens (Human)	ceramide catabolic process [GO:0046514]; long-chain fatty acid biosynthetic process [GO:0042759]; sphingosine biosynthetic process [GO:0046512]	extracellular region [GO:0005576]	extracellular region [GO:0005576]; N-acylsphingosine amidohydrolase activity [GO:0017040]; ceramide catabolic process [GO:0046514]; long-chain fatty acid biosynthetic process [GO:0042759]; sphingosine biosynthetic process [GO:0046512]	N-acylsphingosine amidohydrolase activity [GO:0017040]	GO:0005576; GO:0017040; GO:0042759; GO:0046512; GO:0046514	IRYFGHNR	0.93162	9.49317	0	0	0	0	0	10.0807	0	0	0	0	9.92144	9.81028	9.83468	0
B7Z1X7	B7Z1X7_HUMAN	cDNA FLJ59017		Homo sapiens (Human)						ASLTWASPR	0.87898	0	11.7973	0	0	0	0	0	0	10.0285	13.763	13.3502	0	0	0	0
B4DFF2	B4DFF2_HUMAN	"cDNA FLJ57875, highly similar to Sialin"		Homo sapiens (Human)		integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	GO:0016021; GO:0022857	ACPEHSAPIK	0.90379	0	9.434	0	0	0	0	0	0	0	9.41739	9.99591	9.55664	0	0	10.5254
Q54A46	Q54A46_HUMAN	"Alzheimer's beta-amyloid interaction protein (Amyloid beta (A4) protein-binding, family B, member 3, isoform CRA_g)"	Fe65L2 isoform 484 APBB3 hCG_1980491	Homo sapiens (Human)			amyloid-beta binding [GO:0001540]	amyloid-beta binding [GO:0001540]	GO:0001540	AMGMDVLNEAIGTLTARGDR	0.77174	0	10.7288	10.4341	0	0	9.73373	0	0	8.61706	0	0	9.29124	0	0	0
B5TZ82	B5TZ82_HUMAN	Estrogen receptor alpha splice variant	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AANLWPSPLMIK	0.61572	14.2234	14.3367	0	0	0	0	0	0	0	0	0	0	0	0	15.4315
B2R8N1	B2R8N1_HUMAN	COP9 signalosome complex subunit 8		Homo sapiens (Human)	COP9 signalosome assembly [GO:0010387]; protein deneddylation [GO:0000338]	COP9 signalosome [GO:0008180]; cytoplasm [GO:0005737]	COP9 signalosome [GO:0008180]; cytoplasm [GO:0005737]; COP9 signalosome assembly [GO:0010387]; protein deneddylation [GO:0000338]		GO:0000338; GO:0005737; GO:0008180; GO:0010387	GILEQGWQADSTTR	0.2963	12.0856	0	11.8137	0	0	0	0	0	0	8.58259	11.2051	0	0	0	0
C8CJL5	C8CJL5_HUMAN	"Estrogen receptor alpha delta 3*,4,5,6,7,8*/1029 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATWPLR	0.28244	9.18767	0	0	0	0	0	0	0	0	10.5118	10.2832	0	0	0	9.41191
Q6FGG5	Q6FGG5_HUMAN	"SCRG1 protein (Scrapie responsive protein 1, isoform CRA_a) (cDNA, FLJ92430, Homo sapiens scrapie responsive protein 1 (SCRG1), mRNA)"	SCRG1 hCG_40511	Homo sapiens (Human)	mesenchymal stem cell proliferation [GO:0097168]	Golgi apparatus [GO:0005794]; neuron projection terminus [GO:0044306]	Golgi apparatus [GO:0005794]; neuron projection terminus [GO:0044306]; mesenchymal stem cell proliferation [GO:0097168]		GO:0005794; GO:0044306; GO:0097168	DVFFGPK	0.27907	0	10.57	10.447	0	0	0	0	12.494	0	0	0	0	0	0	0
B4DFG3	B4DFG3_HUMAN	cDNA FLJ51558		Homo sapiens (Human)						EKLDQVATAVYQMMDQLYQGK	0.70968	0	0	10.6077	0	10.7733	0	0	0	0	11.4104	0	0	0	0	0
U5ZC31	U5ZC31_HUMAN	NADH-ubiquinone oxidoreductase chain 5 (EC 7.1.1.2)	ND5 MTND5	Homo sapiens (Human)	ATP synthesis coupled electron transport [GO:0042773]; response to hydrogen peroxide [GO:0042542]; response to hypoxia [GO:0001666]; response to organonitrogen compound [GO:0010243]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; neuron projection [GO:0043005]; respirasome [GO:0070469]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; neuron projection [GO:0043005]; respirasome [GO:0070469]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]; ATP synthesis coupled electron transport [GO:0042773]; response to hydrogen peroxide [GO:0042542]; response to hypoxia [GO:0001666]; response to organonitrogen compound [GO:0010243]	NADH dehydrogenase (ubiquinone) activity [GO:0008137]	GO:0001666; GO:0005743; GO:0008137; GO:0010243; GO:0016021; GO:0042542; GO:0042773; GO:0043005; GO:0070469	ADANTAAIQAILYNR	0.15686	9.9331	0	0	0	0	0	0	11.0826	0	11.1577	0	0	0	0	0
Q9BXQ0	Q9BXQ0_HUMAN	Tissue transglutaminase (EC 2.3.2.13)	TGM2	Homo sapiens (Human)	cAMP-mediated signaling [GO:0019933]; cytokine-mediated signaling pathway [GO:0019221]; G protein-coupled receptor signaling pathway [GO:0007186]; isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine [GO:0018153]; negative regulation of apoptotic process [GO:0043066]; programmed cell death [GO:0012501]		ATP binding [GO:0005524]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; protein-glutamine gamma-glutamyltransferase activity [GO:0003810]; cAMP-mediated signaling [GO:0019933]; cytokine-mediated signaling pathway [GO:0019221]; G protein-coupled receptor signaling pathway [GO:0007186]; isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine [GO:0018153]; negative regulation of apoptotic process [GO:0043066]; programmed cell death [GO:0012501]	ATP binding [GO:0005524]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; protein-glutamine gamma-glutamyltransferase activity [GO:0003810]	GO:0003810; GO:0003924; GO:0005524; GO:0005525; GO:0007186; GO:0012501; GO:0018153; GO:0019221; GO:0019933; GO:0043066	LEPFSGK	0.52404	9.88469	0	0	0	0	0	0	0	0	11.2398	0	10.4915	0	0	0
Q7YEH3	Q7YEH3_HUMAN	NADH-ubiquinone oxidoreductase chain 2 (EC 7.1.1.2)	ND2 NADH2	Homo sapiens (Human)	"mitochondrial electron transport, NADH to ubiquinone [GO:0006120]"	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]	"integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]; mitochondrial electron transport, NADH to ubiquinone [GO:0006120]"	NADH dehydrogenase (ubiquinone) activity [GO:0008137]	GO:0005743; GO:0006120; GO:0008137; GO:0016021; GO:0070469	KMNPRSTEAAIK	0.42236	0	0	0	0	10.3462	0	10.624	0	0	0	0	0	0	0	10.5455
B6DP72	B6DP72_HUMAN	Estrogen receptor alpha splice variant	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQCTIDK	0.62712	0	0	0	0	10.5138	0	0	10.6951	0	0	0	0	0	0	9.79124
Q92686	NEUG_HUMAN	Neurogranin (Ng) (RC3) [Cleaved into: NEUG(55-78)]	NRGN	Homo sapiens (Human)	associative learning [GO:0008306]; nervous system development [GO:0007399]; positive regulation of long-term synaptic potentiation [GO:1900273]; postsynaptic modulation of chemical synaptic transmission [GO:0099170]; signal transduction [GO:0007165]; telencephalon development [GO:0021537]	axon [GO:0030424]; cytosol [GO:0005829]; dendritic spine head [GO:0044327]; glutamatergic synapse [GO:0098978]; mitochondrial membrane [GO:0031966]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; postsynaptic density [GO:0014069]; postsynaptic membrane [GO:0045211]; trans-Golgi network transport vesicle membrane [GO:0012510]	"axon [GO:0030424]; cytosol [GO:0005829]; dendritic spine head [GO:0044327]; glutamatergic synapse [GO:0098978]; mitochondrial membrane [GO:0031966]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; postsynaptic density [GO:0014069]; postsynaptic membrane [GO:0045211]; trans-Golgi network transport vesicle membrane [GO:0012510]; calmodulin binding [GO:0005516]; phosphatidic acid binding [GO:0070300]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547]; associative learning [GO:0008306]; nervous system development [GO:0007399]; positive regulation of long-term synaptic potentiation [GO:1900273]; postsynaptic modulation of chemical synaptic transmission [GO:0099170]; signal transduction [GO:0007165]; telencephalon development [GO:0021537]"	"calmodulin binding [GO:0005516]; phosphatidic acid binding [GO:0070300]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547]"	GO:0005516; GO:0005547; GO:0005634; GO:0005829; GO:0007165; GO:0007399; GO:0008306; GO:0012510; GO:0014069; GO:0021537; GO:0030424; GO:0031966; GO:0043025; GO:0044327; GO:0045211; GO:0070300; GO:0098978; GO:0099170; GO:1900273	GHMARKK	0.90686	0	0	0	0	0	0	0	0	0	9.25854	0	0	11.113	10.5576	0
C0LJA7	C0LJA7_HUMAN	"Estrogen receptor alpha delta 3*4,5*,7 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQCTIDK	0.81818	0	0	0	0	0	0	0	0	8.63996	0	10.5475	11.0696	0	0	0
P02741	CRP_HUMAN	C-reactive protein [Cleaved into: C-reactive protein(1-205)]	CRP PTX1	Homo sapiens (Human)	acute-phase response [GO:0006953]; defense response to Gram-positive bacterium [GO:0050830]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; negative regulation of lipid storage [GO:0010888]; negative regulation of macrophage derived foam cell differentiation [GO:0010745]; negative regulation of mononuclear cell proliferation [GO:0032945]; opsonization [GO:0008228]; positive regulation of gene expression [GO:0010628]; positive regulation of superoxide anion generation [GO:0032930]; regulation of interleukin-8 production [GO:0032677]; vasoconstriction [GO:0042310]	extracellular region [GO:0005576]; extracellular space [GO:0005615]	extracellular region [GO:0005576]; extracellular space [GO:0005615]; calcium ion binding [GO:0005509]; choline binding [GO:0033265]; complement component C1q complex binding [GO:0001849]; identical protein binding [GO:0042802]; low-density lipoprotein particle binding [GO:0030169]; low-density lipoprotein particle receptor binding [GO:0050750]; acute-phase response [GO:0006953]; defense response to Gram-positive bacterium [GO:0050830]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; negative regulation of lipid storage [GO:0010888]; negative regulation of macrophage derived foam cell differentiation [GO:0010745]; negative regulation of mononuclear cell proliferation [GO:0032945]; opsonization [GO:0008228]; positive regulation of gene expression [GO:0010628]; positive regulation of superoxide anion generation [GO:0032930]; regulation of interleukin-8 production [GO:0032677]; vasoconstriction [GO:0042310]	calcium ion binding [GO:0005509]; choline binding [GO:0033265]; complement component C1q complex binding [GO:0001849]; identical protein binding [GO:0042802]; low-density lipoprotein particle binding [GO:0030169]; low-density lipoprotein particle receptor binding [GO:0050750]	GO:0001849; GO:0005509; GO:0005576; GO:0005615; GO:0006953; GO:0006954; GO:0008228; GO:0010628; GO:0010745; GO:0010888; GO:0030169; GO:0032677; GO:0032930; GO:0032945; GO:0033265; GO:0042310; GO:0042802; GO:0045087; GO:0050750; GO:0050830	AFTVCLHFYTELSSTRGYSIFSYATK	0.21818	0	9.70037	0	8.82066	0	0	0	0	11.4047	0	0	0	0	0	0
P05412	JUN_HUMAN	Transcription factor Jun (Activator protein 1) (AP1) (Proto-oncogene c-Jun) (Transcription factor AP-1 subunit Jun) (V-jun avian sarcoma virus 17 oncogene homolog) (p39)	JUN	Homo sapiens (Human)	angiogenesis [GO:0001525]; apoptotic process [GO:0006915]; axon regeneration [GO:0031103]; cell population proliferation [GO:0008283]; cellular response to anisomycin [GO:0072740]; cellular response to cadmium ion [GO:0071276]; cellular response to calcium ion [GO:0071277]; cellular response to reactive oxygen species [GO:0034614]; eyelid development in camera-type eye [GO:0061029]; integrated stress response signaling [GO:0140467]; leading edge cell differentiation [GO:0035026]; liver development [GO:0001889]; microglial cell activation [GO:0001774]; monocyte differentiation [GO:0030224]; negative regulation by host of viral transcription [GO:0043922]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of DNA binding [GO:0043392]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of protein autophosphorylation [GO:0031953]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress [GO:1990441]; outflow tract morphogenesis [GO:0003151]; positive regulation by host of viral transcription [GO:0043923]; positive regulation of apoptotic process [GO:0043065]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of DNA-templated transcription initiation [GO:2000144]; positive regulation of endothelial cell proliferation [GO:0001938]; positive regulation of epithelial cell migration [GO:0010634]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of fibroblast proliferation [GO:0048146]; positive regulation of miRNA transcription [GO:1902895]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus [GO:1901522]; positive regulation of vascular associated smooth muscle cell proliferation [GO:1904707]; Ras protein signal transduction [GO:0007265]; regulation of cell cycle [GO:0051726]; regulation of cell population proliferation [GO:0042127]; regulation of transcription by RNA polymerase II [GO:0006357]; response to muscle stretch [GO:0035994]; response to xenobiotic stimulus [GO:0009410]; SMAD protein signal transduction [GO:0060395]; transforming growth factor beta receptor signaling pathway [GO:0007179]	chromatin [GO:0000785]; euchromatin [GO:0000791]; nuclear chromosome [GO:0000228]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; RNA polymerase II transcription regulator complex [GO:0090575]; transcription factor AP-1 complex [GO:0035976]; transcription regulator complex [GO:0005667]; transcription repressor complex [GO:0017053]	"chromatin [GO:0000785]; euchromatin [GO:0000791]; nuclear chromosome [GO:0000228]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; RNA polymerase II transcription regulator complex [GO:0090575]; transcription factor AP-1 complex [GO:0035976]; transcription regulator complex [GO:0005667]; transcription repressor complex [GO:0017053]; cAMP response element binding [GO:0035497]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; enzyme binding [GO:0019899]; general transcription initiation factor binding [GO:0140296]; GTPase activator activity [GO:0005096]; identical protein binding [GO:0042802]; R-SMAD binding [GO:0070412]; RNA binding [GO:0003723]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; sequence-specific double-stranded DNA binding [GO:1990837]; transcription cis-regulatory region binding [GO:0000976]; ubiquitin protein ligase binding [GO:0031625]; ubiquitin-like protein ligase binding [GO:0044389]; angiogenesis [GO:0001525]; apoptotic process [GO:0006915]; axon regeneration [GO:0031103]; cell population proliferation [GO:0008283]; cellular response to anisomycin [GO:0072740]; cellular response to cadmium ion [GO:0071276]; cellular response to calcium ion [GO:0071277]; cellular response to reactive oxygen species [GO:0034614]; eyelid development in camera-type eye [GO:0061029]; integrated stress response signaling [GO:0140467]; leading edge cell differentiation [GO:0035026]; liver development [GO:0001889]; microglial cell activation [GO:0001774]; monocyte differentiation [GO:0030224]; negative regulation by host of viral transcription [GO:0043922]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of DNA binding [GO:0043392]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of protein autophosphorylation [GO:0031953]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress [GO:1990441]; outflow tract morphogenesis [GO:0003151]; positive regulation by host of viral transcription [GO:0043923]; positive regulation of apoptotic process [GO:0043065]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of DNA-templated transcription initiation [GO:2000144]; positive regulation of endothelial cell proliferation [GO:0001938]; positive regulation of epithelial cell migration [GO:0010634]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of fibroblast proliferation [GO:0048146]; positive regulation of miRNA transcription [GO:1902895]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus [GO:1901522]; positive regulation of vascular associated smooth muscle cell proliferation [GO:1904707]; Ras protein signal transduction [GO:0007265]; regulation of cell cycle [GO:0051726]; regulation of cell population proliferation [GO:0042127]; regulation of transcription by RNA polymerase II [GO:0006357]; response to muscle stretch [GO:0035994]; response to xenobiotic stimulus [GO:0009410]; SMAD protein signal transduction [GO:0060395]; transforming growth factor beta receptor signaling pathway [GO:0007179]"	"cAMP response element binding [GO:0035497]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; enzyme binding [GO:0019899]; general transcription initiation factor binding [GO:0140296]; GTPase activator activity [GO:0005096]; identical protein binding [GO:0042802]; R-SMAD binding [GO:0070412]; RNA binding [GO:0003723]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; sequence-specific double-stranded DNA binding [GO:1990837]; transcription cis-regulatory region binding [GO:0000976]; ubiquitin protein ligase binding [GO:0031625]; ubiquitin-like protein ligase binding [GO:0044389]"	GO:0000122; GO:0000228; GO:0000785; GO:0000791; GO:0000976; GO:0000978; GO:0000981; GO:0001227; GO:0001228; GO:0001525; GO:0001774; GO:0001889; GO:0001938; GO:0003151; GO:0003677; GO:0003682; GO:0003700; GO:0003723; GO:0005096; GO:0005634; GO:0005654; GO:0005667; GO:0005886; GO:0006357; GO:0006915; GO:0007179; GO:0007265; GO:0008283; GO:0008285; GO:0009410; GO:0010634; GO:0017053; GO:0019899; GO:0030224; GO:0031103; GO:0031625; GO:0031953; GO:0034614; GO:0035026; GO:0035497; GO:0035976; GO:0035994; GO:0042127; GO:0042802; GO:0043065; GO:0043392; GO:0043524; GO:0043922; GO:0043923; GO:0044389; GO:0045892; GO:0045893; GO:0045944; GO:0048146; GO:0051726; GO:0060395; GO:0061029; GO:0061629; GO:0070374; GO:0070412; GO:0071276; GO:0071277; GO:0072740; GO:0090575; GO:0140296; GO:0140467; GO:1901522; GO:1902895; GO:1904707; GO:1990441; GO:1990837; GO:2000144	AKNSDLLTSPDVGLLKLASPELER	0.98617	9.76442	0	0	0	0	0	0	0	0	0	10.1481	0	0	0	9.9275
Q6ZT90	Q6ZT90_HUMAN	"cDNA FLJ44861 fis, clone BRALZ2008930"		Homo sapiens (Human)						ARLECRGGAR	0.99571	0	0	0	0	0	0	0	10.0378	0	0	0	10.26	0	0	9.16922
Q92876	KLK6_HUMAN	Kallikrein-6 (EC 3.4.21.-) (Neurosin) (Protease M) (SP59) (Serine protease 18) (Serine protease 9) (Zyme)	KLK6 PRSS18 PRSS9	Homo sapiens (Human)	amyloid precursor protein metabolic process [GO:0042982]; central nervous system development [GO:0007417]; collagen catabolic process [GO:0030574]; hormone metabolic process [GO:0042445]; myelination [GO:0042552]; positive regulation of G protein-coupled receptor signaling pathway [GO:0045745]; protein autoprocessing [GO:0016540]; regulation of cell differentiation [GO:0045595]; regulation of neuron projection development [GO:0010975]; response to wounding [GO:0009611]; tissue regeneration [GO:0042246]	cornified envelope [GO:0001533]; cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; mitochondrion [GO:0005739]; nucleolus [GO:0005730]; secretory granule [GO:0030141]	cornified envelope [GO:0001533]; cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; mitochondrion [GO:0005739]; nucleolus [GO:0005730]; secretory granule [GO:0030141]; serine-type endopeptidase activity [GO:0004252]; amyloid precursor protein metabolic process [GO:0042982]; central nervous system development [GO:0007417]; collagen catabolic process [GO:0030574]; hormone metabolic process [GO:0042445]; myelination [GO:0042552]; positive regulation of G protein-coupled receptor signaling pathway [GO:0045745]; protein autoprocessing [GO:0016540]; regulation of cell differentiation [GO:0045595]; regulation of neuron projection development [GO:0010975]; response to wounding [GO:0009611]; tissue regeneration [GO:0042246]	serine-type endopeptidase activity [GO:0004252]	GO:0001533; GO:0004252; GO:0005576; GO:0005615; GO:0005730; GO:0005737; GO:0005739; GO:0005783; GO:0007417; GO:0009611; GO:0010975; GO:0016540; GO:0030141; GO:0030574; GO:0042246; GO:0042445; GO:0042552; GO:0042982; GO:0045595; GO:0045745	DSCQGDSGGPLVCGDHLR	0.75	0	0	10.2048	0	0	0	0	0	9.32053	9.83838	0	0	0	0	0
B4DFF6	B4DFF6_HUMAN	cDNA FLJ57264		Homo sapiens (Human)		endosome membrane [GO:0010008]; integral component of membrane [GO:0016021]; lysosomal membrane [GO:0005765]	endosome membrane [GO:0010008]; integral component of membrane [GO:0016021]; lysosomal membrane [GO:0005765]; heme transmembrane transporter activity [GO:0015232]	heme transmembrane transporter activity [GO:0015232]	GO:0005765; GO:0010008; GO:0015232; GO:0016021	HQSLTDPTSYYLSSVWSFISFK	0.42593	9.49691	0	9.4183	0	0	0	0	0	0	0	0	0	0	0	9.65741
Q9P0D2	Q9P0D2_HUMAN	Beta-secretase 1 (EC 3.4.23.46) (Beta-site amyloid precursor protein cleaving enzyme 1) (Memapsin-2) (Membrane-associated aspartic protease 2)		Homo sapiens (Human)	proteolysis [GO:0006508]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]; aspartic-type endopeptidase activity [GO:0004190]; proteolysis [GO:0006508]	aspartic-type endopeptidase activity [GO:0004190]	GO:0004190; GO:0005770; GO:0005794; GO:0006508; GO:0016021; GO:0045121; GO:0055037	AASSTEK	0.47644	0	0	0	0	10.609	0	11.6591	0	0	0	0	0	0	0	0
Q8TEY4	Q8TEY4_HUMAN	Adaptor protein FE65a2	APBB1	Homo sapiens (Human)		growth cone [GO:0030426]; lamellipodium [GO:0030027]; synapse [GO:0045202]	growth cone [GO:0030426]; lamellipodium [GO:0030027]; synapse [GO:0045202]; amyloid-beta binding [GO:0001540]	amyloid-beta binding [GO:0001540]	GO:0001540; GO:0030027; GO:0030426; GO:0045202	AATAHRDQNR	0.83838	0	0	0	0	10.4636	0	0	0	0	0	0	0	0	0	10.9287
A0A024R3D5	A0A024R3D5_HUMAN	Beta-secretase 1 (EC 3.4.23.46) (Beta-site amyloid precursor protein cleaving enzyme 1) (Memapsin-2) (Membrane-associated aspartic protease 2)	BACE1 hCG_37942	Homo sapiens (Human)	proteolysis [GO:0006508]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]; aspartic-type endopeptidase activity [GO:0004190]; proteolysis [GO:0006508]	aspartic-type endopeptidase activity [GO:0004190]	GO:0004190; GO:0005770; GO:0005794; GO:0006508; GO:0016021; GO:0045121; GO:0055037	AASSTEK	0.46629	0	0	10.6482	0	0	0	0	0	0	0	10.0653	0	0	0	0
Q8IWL8	STH_HUMAN	Saitohin	STH	Homo sapiens (Human)	"positive regulation of mRNA splicing, via spliceosome [GO:0048026]"	cytoplasm [GO:0005737]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]	"cytoplasm [GO:0005737]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; positive regulation of mRNA splicing, via spliceosome [GO:0048026]"		GO:0005634; GO:0005737; GO:0048026; GO:0048471	GESQATSCQV	0.61842	0	0	0	0	0	0	0	8.05251	12.1884	0	0	0	0	0	0
A8K0N6	A8K0N6_HUMAN	"cDNA FLJ76599, highly similar to Homo sapiens nucleoporin 35kDa (NUP35), transcript variant 2, mRNA"		Homo sapiens (Human)						SISGPSVGVMEMR	0.31915	9.92099	0	0	0	0	0	0	0	0	9.75432	0	0	0	0	0
C0LJA9	C0LJA9_HUMAN	"Estrogen receptor alpha delta 3*4*,7 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQCTIDK	0.60455	0	0	9.42675	0	0	0	0	0	0	10.1228	0	0	0	0	0
C9E0F1	C9E0F1_HUMAN	"Estrogen receptor alpha delta 4*,5,6,7*/654 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]		GO:0005654	CKNVVPLYDLLLEMLDAHR	0.9385	0	0	0	0	0	0	0	0	0	9.84213	0	9.49989	0	0	0
Q4VFD5	Q4VFD5_HUMAN	Cytochrome b	CYTB cytb	Homo sapiens (Human)	respiratory electron transport chain [GO:0022904]	mitochondrial inner membrane [GO:0005743]; respiratory chain complex III [GO:0045275]	mitochondrial inner membrane [GO:0005743]; respiratory chain complex III [GO:0045275]; metal ion binding [GO:0046872]; ubiquinol-cytochrome-c reductase activity [GO:0008121]; respiratory electron transport chain [GO:0022904]	metal ion binding [GO:0046872]; ubiquinol-cytochrome-c reductase activity [GO:0008121]	GO:0005743; GO:0008121; GO:0022904; GO:0045275; GO:0046872	DVNYGWIIR	0.48469	0	0	0	0	0	0	10.0872	0	9.23336	0	0	0	0	0	0
B4DFF9	B4DFF9_HUMAN	"cDNA FLJ60469, highly similar to COP9 signalosome complex subunit 8"		Homo sapiens (Human)	COP9 signalosome assembly [GO:0010387]; protein deneddylation [GO:0000338]	COP9 signalosome [GO:0008180]; cytoplasm [GO:0005737]	COP9 signalosome [GO:0008180]; cytoplasm [GO:0005737]; COP9 signalosome assembly [GO:0010387]; protein deneddylation [GO:0000338]		GO:0000338; GO:0005737; GO:0008180; GO:0010387	MPVAVMAEGAFSFK	0.33784	9.34145	0	0	0	0	0	0	0	0	0	0	0	0	9.64839	0
O43914	TYOBP_HUMAN	TYRO protein tyrosine kinase-binding protein (DNAX-activation protein 12) (Killer-activating receptor-associated protein) (KAR-associated protein)	TYROBP DAP12 KARAP	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; apoptotic cell clearance [GO:0043277]; apoptotic signaling pathway [GO:0097190]; cellular defense response [GO:0006968]; forebrain development [GO:0030900]; intracellular signal transduction [GO:0035556]; microglial cell activation involved in immune response [GO:0002282]; myeloid leukocyte activation [GO:0002274]; negative regulation of B cell proliferation [GO:0030889]; negative regulation of interleukin-10 production [GO:0032693]; negative regulation of long-term synaptic potentiation [GO:1900272]; negative regulation of transforming growth factor beta1 production [GO:0032911]; neutrophil activation involved in immune response [GO:0002283]; osteoclast differentiation [GO:0030316]; positive regulation of gene expression [GO:0010628]; positive regulation of hippocampal neuron apoptotic process [GO:0110090]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of macrophage fusion [GO:0034241]; positive regulation of microglial cell mediated cytotoxicity [GO:1904151]; positive regulation of natural killer cell activation [GO:0032816]; positive regulation of neuron death [GO:1901216]; positive regulation of osteoclast development [GO:2001206]; positive regulation of protein localization to cell surface [GO:2000010]; positive regulation of receptor localization to synapse [GO:1902685]; positive regulation of superoxide anion generation [GO:0032930]; positive regulation of tumor necrosis factor production [GO:0032760]; protein stabilization [GO:0050821]; response to axon injury [GO:0048678]; signal transduction [GO:0007165]; stimulatory C-type lectin receptor signaling pathway [GO:0002223]; stimulatory killer cell immunoglobulin-like receptor signaling pathway [GO:0002222]	cell surface [GO:0009986]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; secretory granule membrane [GO:0030667]	cell surface [GO:0009986]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; secretory granule membrane [GO:0030667]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; protein homodimerization activity [GO:0042803]; signaling receptor binding [GO:0005102]; actin cytoskeleton organization [GO:0030036]; apoptotic cell clearance [GO:0043277]; apoptotic signaling pathway [GO:0097190]; cellular defense response [GO:0006968]; forebrain development [GO:0030900]; intracellular signal transduction [GO:0035556]; microglial cell activation involved in immune response [GO:0002282]; myeloid leukocyte activation [GO:0002274]; negative regulation of B cell proliferation [GO:0030889]; negative regulation of interleukin-10 production [GO:0032693]; negative regulation of long-term synaptic potentiation [GO:1900272]; negative regulation of transforming growth factor beta1 production [GO:0032911]; neutrophil activation involved in immune response [GO:0002283]; osteoclast differentiation [GO:0030316]; positive regulation of gene expression [GO:0010628]; positive regulation of hippocampal neuron apoptotic process [GO:0110090]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of macrophage fusion [GO:0034241]; positive regulation of microglial cell mediated cytotoxicity [GO:1904151]; positive regulation of natural killer cell activation [GO:0032816]; positive regulation of neuron death [GO:1901216]; positive regulation of osteoclast development [GO:2001206]; positive regulation of protein localization to cell surface [GO:2000010]; positive regulation of receptor localization to synapse [GO:1902685]; positive regulation of superoxide anion generation [GO:0032930]; positive regulation of tumor necrosis factor production [GO:0032760]; protein stabilization [GO:0050821]; response to axon injury [GO:0048678]; signal transduction [GO:0007165]; stimulatory C-type lectin receptor signaling pathway [GO:0002223]; stimulatory killer cell immunoglobulin-like receptor signaling pathway [GO:0002222]	identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; protein homodimerization activity [GO:0042803]; signaling receptor binding [GO:0005102]	GO:0002222; GO:0002223; GO:0002274; GO:0002282; GO:0002283; GO:0005102; GO:0005886; GO:0005887; GO:0006968; GO:0007165; GO:0009986; GO:0010628; GO:0016021; GO:0030036; GO:0030316; GO:0030667; GO:0030889; GO:0030900; GO:0032693; GO:0032731; GO:0032755; GO:0032760; GO:0032816; GO:0032911; GO:0032930; GO:0034241; GO:0035556; GO:0042802; GO:0042803; GO:0043277; GO:0046872; GO:0048678; GO:0050821; GO:0097190; GO:0110090; GO:1900272; GO:1901216; GO:1902685; GO:1904151; GO:2000010; GO:2001206	GAAEAATR	0.75094	0	0	0	0	0	0	0	0	0	10.0308	0	0	0	0	8.43659
P27449	VATL_HUMAN	V-type proton ATPase 16 kDa proteolipid subunit c (V-ATPase 16 kDa proteolipid subunit c) (Vacuolar proton pump 16 kDa proteolipid subunit c)	ATP6V0C ATP6C ATP6L ATPL	Homo sapiens (Human)	endosomal lumen acidification [GO:0048388]; Golgi lumen acidification [GO:0061795]; intracellular pH reduction [GO:0051452]; lysosomal lumen acidification [GO:0007042]; positive regulation of Wnt signaling pathway [GO:0030177]; proton transmembrane transport [GO:1902600]; regulation of macroautophagy [GO:0016241]; vacuolar acidification [GO:0007035]	"azurophil granule membrane [GO:0035577]; clathrin-coated vesicle membrane [GO:0030665]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; ficolin-1-rich granule membrane [GO:0101003]; focal adhesion [GO:0005925]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; phagocytic vesicle membrane [GO:0030670]; plasma membrane [GO:0005886]; proton-transporting V-type ATPase complex [GO:0033176]; synaptic vesicle membrane [GO:0030672]; tertiary granule membrane [GO:0070821]; vacuolar proton-transporting V-type ATPase, V0 domain [GO:0000220]"	"azurophil granule membrane [GO:0035577]; clathrin-coated vesicle membrane [GO:0030665]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; ficolin-1-rich granule membrane [GO:0101003]; focal adhesion [GO:0005925]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; phagocytic vesicle membrane [GO:0030670]; plasma membrane [GO:0005886]; proton-transporting V-type ATPase complex [GO:0033176]; synaptic vesicle membrane [GO:0030672]; tertiary granule membrane [GO:0070821]; vacuolar proton-transporting V-type ATPase, V0 domain [GO:0000220]; proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]; proton-transporting ATPase activity, rotational mechanism [GO:0046961]; ubiquitin protein ligase binding [GO:0031625]; endosomal lumen acidification [GO:0048388]; Golgi lumen acidification [GO:0061795]; intracellular pH reduction [GO:0051452]; lysosomal lumen acidification [GO:0007042]; positive regulation of Wnt signaling pathway [GO:0030177]; proton transmembrane transport [GO:1902600]; regulation of macroautophagy [GO:0016241]; vacuolar acidification [GO:0007035]"	"proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]; proton-transporting ATPase activity, rotational mechanism [GO:0046961]; ubiquitin protein ligase binding [GO:0031625]"	GO:0000139; GO:0000220; GO:0005765; GO:0005886; GO:0005925; GO:0007035; GO:0007042; GO:0010008; GO:0016020; GO:0016021; GO:0016241; GO:0030177; GO:0030665; GO:0030670; GO:0030672; GO:0031625; GO:0033176; GO:0035577; GO:0046933; GO:0046961; GO:0048388; GO:0051452; GO:0061795; GO:0070062; GO:0070821; GO:0101003; GO:1902600	GTAQQPR	0.43713	0	0	0	0	0	0	0	0	8.1004	0	0	0	9.28177	0	0
C9E0F3	C9E0F3_HUMAN	"Estrogen receptor alpha 3*,4,5,6,7,8*/984 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQCTIDK	0.25197	0	0	0	0	8.67384	0	0	0	0	0	0	0	0	8.2987	0
B5TKC2	B5TKC2_HUMAN	Estrogen receptor alpha cingulate gyrus isoform	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQQHQR	0.23932	0	0	0	0	0	0	0	0	14.6076	0	0	0	0	0	0
A0A218KGP1	A0A218KGP1_HUMAN	Presenilin (EC 3.4.23.-)	PSEN1	Homo sapiens (Human)	amyloid precursor protein catabolic process [GO:0042987]; apoptotic process [GO:0006915]; cell adhesion [GO:0007155]; intracellular signal transduction [GO:0035556]; Notch signaling pathway [GO:0007219]; protein processing [GO:0016485]	anchoring junction [GO:0070161]; axon [GO:0030424]; early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; synapse [GO:0045202]	"anchoring junction [GO:0070161]; axon [GO:0030424]; early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; synapse [GO:0045202]; aspartic endopeptidase activity, intramembrane cleaving [GO:0042500]; amyloid precursor protein catabolic process [GO:0042987]; apoptotic process [GO:0006915]; cell adhesion [GO:0007155]; intracellular signal transduction [GO:0035556]; Notch signaling pathway [GO:0007219]; protein processing [GO:0016485]"	"aspartic endopeptidase activity, intramembrane cleaving [GO:0042500]"	GO:0000139; GO:0005789; GO:0005886; GO:0006915; GO:0007155; GO:0007219; GO:0016021; GO:0016485; GO:0030424; GO:0031901; GO:0035556; GO:0042500; GO:0042987; GO:0045202; GO:0070161	AAVQELSSSILAGEDPEERGVK	0.8722	0	0	0	0	0	0	0	0	0	11.4169	0	0	0	0	0
B4DFI2	B4DFI2_HUMAN	Claudin		Homo sapiens (Human)		bicellular tight junction [GO:0005923]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	bicellular tight junction [GO:0005923]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; structural molecule activity [GO:0005198]	structural molecule activity [GO:0005198]	GO:0005198; GO:0005886; GO:0005923; GO:0016021	MGQEPGVAKYR	0.85246	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10.9947
P25713	MT3_HUMAN	Metallothionein-3 (MT-3) (GIFB) (GIF) (Growth inhibitory factor) (Metallothionein-III) (MT-III)	MT3	Homo sapiens (Human)	activation of protein kinase B activity [GO:0032148]; astrocyte development [GO:0014002]; brain development [GO:0007420]; cadmium ion homeostasis [GO:0055073]; cellular lipid catabolic process [GO:0044242]; cellular metal ion homeostasis [GO:0006875]; cellular response to cadmium ion [GO:0071276]; cellular response to copper ion [GO:0071280]; cellular response to hypoxia [GO:0071456]; cellular response to nitric oxide [GO:0071732]; cellular response to oxidative stress [GO:0034599]; cellular response to reactive oxygen species [GO:0034614]; cellular response to zinc ion [GO:0071294]; cellular zinc ion homeostasis [GO:0006882]; cholesterol catabolic process [GO:0006707]; detoxification of copper ion [GO:0010273]; energy reserve metabolic process [GO:0006112]; ERK1 and ERK2 cascade [GO:0070371]; histone modification [GO:0016570]; leptin-mediated signaling pathway [GO:0033210]; negative regulation of apoptotic process [GO:0043066]; negative regulation of autophagy [GO:0010507]; negative regulation of axon extension [GO:0030517]; negative regulation of cell growth [GO:0030308]; negative regulation of cysteine-type endopeptidase activity [GO:2000117]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of hydrogen peroxide catabolic process [GO:2000296]; negative regulation of necrotic cell death [GO:0060547]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of neuron projection development [GO:0010977]; negative regulation of oxidoreductase activity [GO:0051354]; negative regulation of reactive oxygen species metabolic process [GO:2000378]; positive regulation of catalytic activity [GO:0043085]; positive regulation of cell death [GO:0010942]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of gene expression [GO:0010628]; positive regulation of lysosomal membrane permeability [GO:0097214]; positive regulation of necrotic cell death [GO:0010940]; positive regulation of oxygen metabolic process [GO:2000376]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of vascular endothelial growth factor receptor signaling pathway [GO:0030949]; protein kinase B signaling [GO:0043491]; protein stabilization [GO:0050821]; regulation of protein glycosylation [GO:0060049]; regulation of response to food [GO:0032095]; removal of superoxide radicals [GO:0019430]; response to hypoxia [GO:0001666]; zinc ion homeostasis [GO:0055069]; zinc ion transport [GO:0006829]	astrocyte end-foot [GO:0097450]; axon [GO:0030424]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendritic spine [GO:0043197]; extracellular space [GO:0005615]; inclusion body [GO:0016234]; microtubule [GO:0005874]; mitochondrial outer membrane [GO:0005741]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; ribosome [GO:0005840]; rough endoplasmic reticulum [GO:0005791]; synaptic vesicle [GO:0008021]	astrocyte end-foot [GO:0097450]; axon [GO:0030424]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendritic spine [GO:0043197]; extracellular space [GO:0005615]; inclusion body [GO:0016234]; microtubule [GO:0005874]; mitochondrial outer membrane [GO:0005741]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; ribosome [GO:0005840]; rough endoplasmic reticulum [GO:0005791]; synaptic vesicle [GO:0008021]; antioxidant activity [GO:0016209]; cadmium ion binding [GO:0046870]; copper ion binding [GO:0005507]; cysteine-type endopeptidase inhibitor activity involved in apoptotic process [GO:0043027]; metal ion binding [GO:0046872]; protein kinase activator activity [GO:0030295]; zinc ion binding [GO:0008270]; activation of protein kinase B activity [GO:0032148]; astrocyte development [GO:0014002]; brain development [GO:0007420]; cadmium ion homeostasis [GO:0055073]; cellular lipid catabolic process [GO:0044242]; cellular metal ion homeostasis [GO:0006875]; cellular response to cadmium ion [GO:0071276]; cellular response to copper ion [GO:0071280]; cellular response to hypoxia [GO:0071456]; cellular response to nitric oxide [GO:0071732]; cellular response to oxidative stress [GO:0034599]; cellular response to reactive oxygen species [GO:0034614]; cellular response to zinc ion [GO:0071294]; cellular zinc ion homeostasis [GO:0006882]; cholesterol catabolic process [GO:0006707]; detoxification of copper ion [GO:0010273]; energy reserve metabolic process [GO:0006112]; ERK1 and ERK2 cascade [GO:0070371]; histone modification [GO:0016570]; leptin-mediated signaling pathway [GO:0033210]; negative regulation of apoptotic process [GO:0043066]; negative regulation of autophagy [GO:0010507]; negative regulation of axon extension [GO:0030517]; negative regulation of cell growth [GO:0030308]; negative regulation of cysteine-type endopeptidase activity [GO:2000117]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of hydrogen peroxide catabolic process [GO:2000296]; negative regulation of necrotic cell death [GO:0060547]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of neuron projection development [GO:0010977]; negative regulation of oxidoreductase activity [GO:0051354]; negative regulation of reactive oxygen species metabolic process [GO:2000378]; positive regulation of catalytic activity [GO:0043085]; positive regulation of cell death [GO:0010942]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of gene expression [GO:0010628]; positive regulation of lysosomal membrane permeability [GO:0097214]; positive regulation of necrotic cell death [GO:0010940]; positive regulation of oxygen metabolic process [GO:2000376]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of vascular endothelial growth factor receptor signaling pathway [GO:0030949]; protein kinase B signaling [GO:0043491]; protein stabilization [GO:0050821]; regulation of protein glycosylation [GO:0060049]; regulation of response to food [GO:0032095]; removal of superoxide radicals [GO:0019430]; response to hypoxia [GO:0001666]; zinc ion homeostasis [GO:0055069]; zinc ion transport [GO:0006829]	antioxidant activity [GO:0016209]; cadmium ion binding [GO:0046870]; copper ion binding [GO:0005507]; cysteine-type endopeptidase inhibitor activity involved in apoptotic process [GO:0043027]; metal ion binding [GO:0046872]; protein kinase activator activity [GO:0030295]; zinc ion binding [GO:0008270]	GO:0001666; GO:0001934; GO:0005507; GO:0005615; GO:0005634; GO:0005737; GO:0005741; GO:0005791; GO:0005829; GO:0005840; GO:0005874; GO:0005886; GO:0006112; GO:0006707; GO:0006829; GO:0006875; GO:0006882; GO:0007420; GO:0008021; GO:0008270; GO:0010273; GO:0010507; GO:0010628; GO:0010940; GO:0010942; GO:0010977; GO:0014002; GO:0014069; GO:0016209; GO:0016234; GO:0016570; GO:0019430; GO:0030295; GO:0030308; GO:0030424; GO:0030517; GO:0030949; GO:0032095; GO:0032148; GO:0033210; GO:0034599; GO:0034614; GO:0043027; GO:0043066; GO:0043085; GO:0043154; GO:0043197; GO:0043491; GO:0043524; GO:0044242; GO:0045892; GO:0045893; GO:0046870; GO:0046872; GO:0048471; GO:0050821; GO:0051354; GO:0055069; GO:0055073; GO:0060049; GO:0060547; GO:0070371; GO:0070374; GO:0071276; GO:0071280; GO:0071294; GO:0071456; GO:0071732; GO:0097214; GO:0097450; GO:2000117; GO:2000296; GO:2000376; GO:2000378	CAKDCVCKGGEAAEAEAEK	0.77091	0	0	0	0	0	0	0	0	0	0	10.9692	0	0	0	0
Q8N698	Q8N698_HUMAN	Beta-secretase 1 (EC 3.4.23.46) (Beta-site amyloid precursor protein cleaving enzyme 1) (Memapsin-2) (Membrane-associated aspartic protease 2)	BACE	Homo sapiens (Human)	proteolysis [GO:0006508]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]; aspartic-type endopeptidase activity [GO:0004190]; proteolysis [GO:0006508]	aspartic-type endopeptidase activity [GO:0004190]	GO:0004190; GO:0005770; GO:0005794; GO:0006508; GO:0016021; GO:0045121; GO:0055037	AASSQYLRPVEDVATSQDDCYK	0.48187	0	0	0	0	0	0	0	0	0	0	0	0	0	10.8159	0
B7Z3K2	B7Z3K2_HUMAN	Beta-secretase 1 (EC 3.4.23.46) (Beta-site amyloid precursor protein cleaving enzyme 1) (Memapsin-2) (Membrane-associated aspartic protease 2)		Homo sapiens (Human)	proteolysis [GO:0006508]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]; aspartic-type endopeptidase activity [GO:0004190]; proteolysis [GO:0006508]	aspartic-type endopeptidase activity [GO:0004190]	GO:0004190; GO:0005770; GO:0005794; GO:0006508; GO:0016021; GO:0045121; GO:0055037	AASSTEK	0.46243	0	0	0	0	0	0	0	0	0	0	10.5836	0	0	0	0
C0LLI6	C0LLI6_HUMAN	"Estrogen receptor alpha delta 4*,5,6,7*/633 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQCTIDK	0.78014	0	0	0	0	0	0	0	0	0	0	0	10.3206	0	0	0
C9E0F2	C9E0F2_HUMAN	"Estrogen receptor alpha 3*,4,5,6,7,8*/1068 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	RSIQGHNYFIAFLAK	0.48148	0	0	0	0	0	0	0	0	0	0	0	10.315	0	0	0
U5ZAD9	U5ZAD9_HUMAN	NADH-ubiquinone oxidoreductase chain 3 (EC 7.1.1.2)	ND3 MTND3 HS5781_0025 HS5782_0025	Homo sapiens (Human)		integral component of membrane [GO:0016021]; mitochondrial membrane [GO:0031966]; respirasome [GO:0070469]	integral component of membrane [GO:0016021]; mitochondrial membrane [GO:0031966]; respirasome [GO:0070469]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]	NADH dehydrogenase (ubiquinone) activity [GO:0008137]	GO:0008137; GO:0016021; GO:0031966; GO:0070469	STPYECGFDPMSPAR	0.48352	0	0	10.0938	0	0	0	0	0	0	0	0	0	0	0	0
C8CJL2	C8CJL2_HUMAN	"Estrogen receptor alpha delta 3*,4,5,6,7,8*/969 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	ATWPLRALLHRIPCK	0.45763	0	0	0	0	0	0	0	0	0	0	0	9.97111	0	0	0
B4DM40	B4DM40_HUMAN	"cDNA FLJ56464, highly similar to Fetal Alzheimer antigen"		Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	NURF complex [GO:0016589]	NURF complex [GO:0016589]; metal ion binding [GO:0046872]; regulation of transcription by RNA polymerase II [GO:0006357]	metal ion binding [GO:0046872]	GO:0006357; GO:0016589; GO:0046872	AADDPENGER	0.28125	0	0	0	0	0	0	0	0	0	0	9.94872	0	0	0	0
B4DFF3	B4DFF3_HUMAN	Battenin	CLN3 hCG_1745226	Homo sapiens (Human)		integral component of membrane [GO:0016021]; lysosomal membrane [GO:0005765]	integral component of membrane [GO:0016021]; lysosomal membrane [GO:0005765]		GO:0005765; GO:0016021	ERWTVFK	0.33557	0	0	9.90682	0	0	0	0	0	0	0	0	0	0	0	0
Q8TEY3	Q8TEY3_HUMAN	Sphingomyelin phosphodiesterase	SMPD1	Homo sapiens (Human)						GHMQLFQTFWFLYHK	0.42683	0	0	0	0	0	0	0	0	0	0	0	0	0	9.81084	0
Q7GXZ4	Q7GXZ4_HUMAN	NADH-ubiquinone oxidoreductase chain 4L (EC 7.1.1.2)	ND4L MTND4L NADH4L HS5781_0027 HS5782_0027	Homo sapiens (Human)	ATP synthesis coupled electron transport [GO:0042773]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]; ATP synthesis coupled electron transport [GO:0042773]	NADH dehydrogenase (ubiquinone) activity [GO:0008137]	GO:0005743; GO:0008137; GO:0016021; GO:0042773; GO:0070469	MPLIYMNIMLAFTISLLGMLVYR	0.46369	0	0	0	0	0	0	0	0	0	0	0	9.7501	0	0	0
B3KSW6	B3KSW6_HUMAN	"cDNA FLJ37186 fis, clone BRALZ2001834, highly similar to H.sapiens glutamine transaminase K"		Homo sapiens (Human)	biosynthetic process [GO:0009058]; cellular modified amino acid metabolic process [GO:0006575]		cysteine-S-conjugate beta-lyase activity [GO:0047804]; kynurenine-oxoglutarate transaminase activity [GO:0016212]; L-glutamine aminotransferase activity [GO:0070548]; pyridoxal phosphate binding [GO:0030170]; biosynthetic process [GO:0009058]; cellular modified amino acid metabolic process [GO:0006575]	cysteine-S-conjugate beta-lyase activity [GO:0047804]; kynurenine-oxoglutarate transaminase activity [GO:0016212]; L-glutamine aminotransferase activity [GO:0070548]; pyridoxal phosphate binding [GO:0030170]	GO:0006575; GO:0009058; GO:0016212; GO:0030170; GO:0047804; GO:0070548	MAKQLQAR	0.89164	0	0	9.5748	0	0	0	0	0	0	0	0	0	0	0	0
B4DFM1	B4DFM1_HUMAN	AP-2 complex subunit mu (AP-2 mu chain) (Clathrin assembly protein complex 2 mu medium chain) (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein)		Homo sapiens (Human)	endocytosis [GO:0006897]; intracellular protein transport [GO:0006886]	clathrin adaptor complex [GO:0030131]; clathrin-coated pit [GO:0005905]	clathrin adaptor complex [GO:0030131]; clathrin-coated pit [GO:0005905]; lipid binding [GO:0008289]; endocytosis [GO:0006897]; intracellular protein transport [GO:0006886]	lipid binding [GO:0008289]	GO:0005905; GO:0006886; GO:0006897; GO:0008289; GO:0030131	AKYKASENAIVWK	0.48634	0	0	0	0	0	0	0	0	0	0	0	9.53238	0	0	0
B5LY05	B5LY05_HUMAN	"Estrogen receptor alpha delta 3,4,5,6 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	CKNVVPLYDLLLEMLDAHR	0.81944	0	0	0	0	0	0	0	0	0	0	0	0	9.52918	0	0
B5TKC0	B5TKC0_HUMAN	Estrogen receptor alpha substantia nigra isoform	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQCTIDK	0.73946	0	0	0	0	0	0	0	0	0	0	0	0	0	9.40574	0
E9PJG7	E9PJG7_HUMAN	Beta-secretase 1 (EC 3.4.23.46) (Beta-site amyloid precursor protein cleaving enzyme 1) (Memapsin-2) (Membrane-associated aspartic protease 2)	BACE1	Homo sapiens (Human)	proteolysis [GO:0006508]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome [GO:0005770]; membrane raft [GO:0045121]; recycling endosome [GO:0055037]; aspartic-type endopeptidase activity [GO:0004190]; proteolysis [GO:0006508]	aspartic-type endopeptidase activity [GO:0004190]	GO:0004190; GO:0005770; GO:0005794; GO:0006508; GO:0016021; GO:0045121; GO:0055037	ANIAAITESDK	0.49	9.27629	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q9B2Z5	Q9B2Z5_HUMAN	NADH-ubiquinone oxidoreductase chain 5 (EC 7.1.1.2)	ND5 NADH5	Homo sapiens (Human)	ATP synthesis coupled electron transport [GO:0042773]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]; ATP synthesis coupled electron transport [GO:0042773]	NADH dehydrogenase (ubiquinone) activity [GO:0008137]	GO:0005743; GO:0008137; GO:0016021; GO:0042773; GO:0070469	ADANTAAIQAILYNR	0.54245	0	0	0	0	0	0	0	0	0	0	0	0	0	9.25484	0
A0A218KGN4	A0A218KGN4_HUMAN	Presenilin (EC 3.4.23.-)	PSEN1	Homo sapiens (Human)	amyloid precursor protein catabolic process [GO:0042987]; apoptotic process [GO:0006915]; cell adhesion [GO:0007155]; intracellular signal transduction [GO:0035556]; Notch signaling pathway [GO:0007219]; protein processing [GO:0016485]	anchoring junction [GO:0070161]; axon [GO:0030424]; early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; synapse [GO:0045202]	"anchoring junction [GO:0070161]; axon [GO:0030424]; early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; synapse [GO:0045202]; aspartic endopeptidase activity, intramembrane cleaving [GO:0042500]; amyloid precursor protein catabolic process [GO:0042987]; apoptotic process [GO:0006915]; cell adhesion [GO:0007155]; intracellular signal transduction [GO:0035556]; Notch signaling pathway [GO:0007219]; protein processing [GO:0016485]"	"aspartic endopeptidase activity, intramembrane cleaving [GO:0042500]"	GO:0000139; GO:0005789; GO:0005886; GO:0006915; GO:0007155; GO:0007219; GO:0016021; GO:0016485; GO:0030424; GO:0031901; GO:0035556; GO:0042500; GO:0042987; GO:0045202; GO:0070161	AAVQELSSSILAGEDPEERGVK	0.44706	0	8.9794	0	0	0	0	0	0	0	0	0	0	0	0	0
C0L927	C0L927_HUMAN	"Estrogen receptor alpha delta 4,5,7 isoform"	ESR1	Homo sapiens (Human)		nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	GO:0003700; GO:0005654; GO:0008270; GO:0043565	AFFKRSIQGHNDYMCPATNQCTIDK	0.53333	0	0	0	0	0	0	0	0	0	8.04374	0	0	0	0	0