Protein	Entry name	Gene names	Gene ontology (biological process)	Protein names	Organism	Gene ontology (cellular component)	Gene ontology (GO)	Gene ontology (molecular function)	Peptide	ID Score	MH+ (Da)	0-1_1 Int (Treated)	0-1_2 Int (Treated)	0-1_3 Int (Treated)	0-2_1 Int (Treated)	0-2_2 Int (Treated)	0-2_3 Int (Treated)	0-3_1 Int (Treated)	0-3_2 Int (Treated)	0-3_3 Int (Treated)	0-4_1 Int (Treated)	0-4_2 Int (Treated)	0-4_3 Int (Treated)	0-5_1 Int (Treated)	0-5_2 Int (Treated)	0-5_3 Int (Treated)	0-6_1 Int (Treated)	0-6_2 Int (Treated)	0-6_3 Int (Treated)	10-1_1 Int (Treated)	10-1_2 Int (Treated)	10-1_3 Int (Treated)	10-2_1 Int (Treated)	10-2_2 Int (Treated)	10-2_3 Int (Treated)	10-3_1 Int (Treated)	10-3_2 Int (Treated)	10-3_3 Int (Treated)	10-4_1 Int (Treated)	10-4_2 Int (Treated)	10-4_3 Int (Treated)	10-5_1 Int (Treated)	10-5_2 Int (Treated)	10-5_3 Int (Treated)	10-6_1 Int (Treated)	10-6_2 Int (Treated)	10-6_3 Int (Treated)	20-1_1 Int (Control)	20-1_2 Int (Treated)	20-1_3 Int (Treated)	20-2_1 Int (Treated)	20-2_2 Int (Treated)	20-2_3 Int (Treated)	20-3_1 Int (Treated)	20-3_2 Int (Treated)	20-3_3 Int (Treated)	20-4_1 Int (Treated)	20-4_2 Int (Treated)	20-4_3 Int (Treated)	20-5_1 Int (Treated)	20-5_2 Int (Treated)	20-5_3 Int (Treated)	20-6_1 Int (Treated)	20-6_2 Int (Treated)	20-6_3 Int (Treated)
A0A669EBG7	A0A669EBG7_ORENI	PLCB1	brain development [GO:0007420]; intracellular signal transduction [GO:0035556]; lipid catabolic process [GO:0016042]; regulation of cell cycle [GO:0051726]	"1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (EC 3.1.4.11)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; calcium ion binding [GO:0005509]; phosphatidylinositol phospholipase C activity [GO:0004435]; brain development [GO:0007420]; intracellular signal transduction [GO:0035556]; lipid catabolic process [GO:0016042]; regulation of cell cycle [GO:0051726]	calcium ion binding [GO:0005509]; phosphatidylinositol phospholipase C activity [GO:0004435]	ASQSEDDMEEGSSERVYETPL	6.650000095	2359.825096	0	0	0	10.74605	0	9.446095	13.49468	11.05984	11.58988	10.97335	0	10.44618	0	0	0	8.929657	13.21336	11.9886	12.94267	11.40208	12.71208	19.02796	10.3032	0	0	0	13.48913	0	0	0	0	0	0	0	8.693195	0	10.4238	10.62186	13.00823	12.2653	10.80327	8.0589	14.11608	11.95566	0	10.66104	12.98987	11.11006	0	0	0	0	0	0
A0A669C6F7	A0A669C6F7_ORENI	plcg1	intracellular signal transduction [GO:0035556]; phospholipid catabolic process [GO:0009395]	"1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma (EC 3.1.4.11)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		phosphatidylinositol phospholipase C activity [GO:0004435]; intracellular signal transduction [GO:0035556]; phospholipid catabolic process [GO:0009395]	phosphatidylinositol phospholipase C activity [GO:0004435]	VQEFMFGYLK	2.390000105	1277.409677	12.40292	9.606341	12.42502	10.76569	11.65743	0	14.1525	13.98054	14.45257	13.19423	9.801095	0	17.28242	12.97012	11.42729	9.367545	10.26255	0	0	0	0	13.65783	12.0094	0	0	13.68133	0	0	10.84667	0	11.7787	12.41759	14.02669	12.16466	0	0	13.60371	0	0	0	0	0	0	0	12.13593	0	13.97933	0	0	0	0	0	0	9.471768
A0A669EG83	A0A669EG83_ORENI	pikfyve	intracellular signal transduction [GO:0035556]	1-phosphatidylinositol-3-phosphate 5-kinase (EC 2.7.1.150)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		1-phosphatidylinositol-3-phosphate 5-kinase activity [GO:0000285]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; metal ion binding [GO:0046872]; intracellular signal transduction [GO:0035556]	1-phosphatidylinositol-3-phosphate 5-kinase activity [GO:0000285]; ATPase activity [GO:0016887]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	STGILGGQGK	6.96999979	918.733985	16.1237	12.71742	13.45605	13.25739	13.4255	14.92377	15.55607	13.71463	0	16.04049	12.75374	0	14.9297	0	0	13.55046	14.90377	0	14.33367	14.13255	12.04743	0	14.76933	14.77218	13.76808	13.26133	15.41656	14.70966	14.31345	15.4567	19.08485	18.04619	16.98829	14.21084	10.58929	0	12.90895	11.88317	13.02177	12.41529	13.11535	15.44869	12.62889	14.47399	14.46012	13.64447	14.39827	14.55532	13.8785	15.84681	11.95764	0	14.72122	0
A0A669ED22	A0A669ED22_ORENI	aldh1l2	10-formyltetrahydrofolate catabolic process [GO:0009258]; biosynthetic process [GO:0009058]; one-carbon metabolic process [GO:0006730]	10-formyltetrahydrofolate dehydrogenase (EC 1.5.1.6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	"cytoplasm [GO:0005737]; formyltetrahydrofolate dehydrogenase activity [GO:0016155]; hydroxymethyl-, formyl- and related transferase activity [GO:0016742]; oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]; 10-formyltetrahydrofolate catabolic process [GO:0009258]; biosynthetic process [GO:0009058]; one-carbon metabolic process [GO:0006730]"	"formyltetrahydrofolate dehydrogenase activity [GO:0016155]; hydroxymethyl-, formyl- and related transferase activity [GO:0016742]; oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]"	DGDVDGVLQR	1.470000029	1074.421801	13.71306	14.46862	14.70389	12.15112	16.10358	0	9.181409	9.816377	12.81522	12.78915	14.8653	0	13.77141	7.905588	13.47702	14.35025	0	11.8264	12.45955	9.591816	14.0183	14.15409	7.999648	12.29637	0	11.11447	14.76395	9.916447	0	0	13.24818	12.92087	19.67398	0	0	0	14.31401	0	13.37574	0	0	12.49449	0	0	0	0	0	0	12.30815	14.35474	13.42324	14.15198	0	0
I3K5C9	I3K5C9_ORENI	LOC100711007	peptidyl-histidine dephosphorylation [GO:0035971]	14 kDa phosphohistidine phosphatase (EC 3.9.1.3) (Phosphohistidine phosphatase 1) (Protein histidine phosphatase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]	cytosol [GO:0005829]; protein histidine phosphatase activity [GO:0101006]; peptidyl-histidine dephosphorylation [GO:0035971]	protein histidine phosphatase activity [GO:0101006]	MCTQTK	8.520000458	767.1371194	14.71955	13.94722	14.5399	14.25077	15.44007	16.47073	11.62733	13.41952	14.9285	14.67837	15.05603	18.12172	14.52223	0	0	15.28828	14.55728	14.3868	15.8329	15.65805	12.56482	15.20058	13.88872	0	17.19442	15.34859	0	0	17.50039	0	10.92913	17.0549	16.47965	13.68818	15.94266	12.73999	16.88128	14.98139	13.59102	18.85362	14.30126	13.93373	0	14.41784	16.05452	0	14.19423	15.33148	0	0	18.82379	15.67555	16.51048	0
I3IV16	I3IV16_ORENI	LOC100703537		14_3_3 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AVTEQGAELSNEERNLLSVAYK	6.579999924	2420.493151	0	14.08824	11.69792	0	0	0	12.89471	5.670179	0	13.5151	9.276876	12.82337	0	14.24082	10.60242	0	15.85707	0	12.57857	11.81642	0	0	13.17207	0	0	11.5051	13.51325	0	11.78063	9.411801	10.90891	0	0	0	9.867887	11.11897	9.002621	10.83809	12.63789	0	0	12.79497	9.145647	0	12.11969	0	0	0	14.20049	0	12.73643	9.433178	13.65261	0
A0A669DHC7	A0A669DHC7_ORENI	LOC100702902		15-oxoprostaglandin 13-reductase (EC 1.3.1.48) (EC 1.3.1.74) (Dithiolethione-inducible gene 1 protein) (Leukotriene B4 12-hydroxydehydrogenase) (NAD(P)H-dependent alkenal/one oxidoreductase) (Prostaglandin reductase 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; 13-prostaglandin reductase activity [GO:0036132]; 15-oxoprostaglandin 13-oxidase activity [GO:0047522]; 2-alkenal reductase [NAD(P)+] activity [GO:0032440]; leukotriene B4 12-hydroxy dehydrogenase activity [GO:0097257]	13-prostaglandin reductase activity [GO:0036132]; 15-oxoprostaglandin 13-oxidase activity [GO:0047522]; 2-alkenal reductase [NAD(P)+] activity [GO:0032440]; leukotriene B4 12-hydroxy dehydrogenase activity [GO:0097257]	GFENMPAAFMGMLQGENIGK	4.699999809	2190.814466	9.180559	12.29635	0	12.19203	8.800611	12.7749	16.21415	0	10.53139	11.39313	11.53011	13.5143	0	16.10673	9.812814	0	12.67678	0	0	0	0	0	14.05461	0	14.25812	0	14.52022	12.40217	0	0	0	0	0	11.86862	0	0	0	0	0	0	13.90323	0	0	15.56744	0	12.88023	12.2334	0	14.21992	0	11.06785	0	13.20168	0
I3K7T8	I3K7T8_ORENI	nefh	neurofilament bundle assembly [GO:0033693]	160 kDa neurofilament protein (Neurofilament medium polypeptide) (Neurofilament triplet M protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	axon [GO:0030424]; neurofilament [GO:0005883]	axon [GO:0030424]; neurofilament [GO:0005883]; neurofilament bundle assembly [GO:0033693]		LTYSQPSSVDSLETFNGDMTRK	3.390000105	2491.65354	10.92996	0	13.03798	10.45429	13.16957	0	11.65847	13.4641	0	12.59031	0	12.46072	0	0	11.74302	0	0	15.3516	9.703488	14.83019	0	0	10.57804	0	4.190577	0	11.40228	12.66368	12.81639	11.82398	18.79766	12.60663	0	0	0	13.57321	0	9.713597	0	0	0	0	0	0	0	0	14.27127	0	0	0	0	0	0	0
I3JRN3	I3JRN3_ORENI	cyp17	sex differentiation [GO:0007548]; steroid biosynthetic process [GO:0006694]	"17-alpha-hydroxyprogesterone aldolase (EC 1.14.14.19) (EC 1.14.14.32) (CYPXVII) (Cytochrome P450 17A1) (Cytochrome P450-C17) (Steroid 17-alpha-hydroxylase/17,20 lyase)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; 17-alpha-hydroxyprogesterone aldolase activity [GO:0047442]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; steroid 17-alpha-monooxygenase activity [GO:0004508]; sex differentiation [GO:0007548]; steroid biosynthetic process [GO:0006694]	17-alpha-hydroxyprogesterone aldolase activity [GO:0047442]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; steroid 17-alpha-monooxygenase activity [GO:0004508]	VNYNDHVQR	10.82999992	1144.569918	14.29986	12.46402	13.40305	12.77955	13.04049	13.74333	13.79933	0	14.1838	16.54134	14.67142	0	15.42858	0	0	0	16.48581	0	0	14.73139	0	0	0	0	15.71045	13.69644	13.62273	0	15.71595	0	17.03889	17.19495	0	0	0	0	15.29407	0	14.0652	15.42647	16.77753	14.89097	16.54609	15.61941	15.48143	0	15.45566	0	0	0	14.20856	15.312	0	0
I3JHF8	I3JHF8_ORENI	crppa	brain morphogenesis [GO:0048854]; isoprenoid biosynthetic process [GO:0008299]; muscle fiber development [GO:0048747]; protein O-linked mannosylation [GO:0035269]; regulation of protein glycosylation [GO:0060049]	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein (EC 2.7.7.40) (D-ribitol-5-phosphate cytidylyltransferase) (Isoprenoid synthase domain-containing protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]	cytosol [GO:0005829]; D-ribitol-5-phosphate cytidylyltransferase activity [GO:0047349]; brain morphogenesis [GO:0048854]; isoprenoid biosynthetic process [GO:0008299]; muscle fiber development [GO:0048747]; protein O-linked mannosylation [GO:0035269]; regulation of protein glycosylation [GO:0060049]	D-ribitol-5-phosphate cytidylyltransferase activity [GO:0047349]	SVSRVAEIASALIR	3.25999999	1471.317794	13.42731	13.15486	0	15.58053	14.54162	15.53589	13.72187	0	14.08121	0	0	13.91746	13.88126	0	13.87923	16.64814	16.77547	17.88177	0	0	15.65437	17.07405	0	0	0	0	0	0	0	14.59194	0	0	0	0	15.14205	0	0	15.67128	14.14706	16.17368	0	15.54142	17.20837	0	0	16.73044	15.5204	0	16.04246	14.71476	15.32321	0	18.4251	0
I3KYW3	I3KYW3_ORENI			2-aminoethanethiol (cysteamine) dioxygenase b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]"	"metal ion binding [GO:0046872]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]"	AEDGGAPPAQHPYHR	6.179999828	1603.250174	8.450434	9.508678	9.943398	0	11.0405	18.85061	0	0	13.18277	12.79746	15.1685	14.53425	12.59333	14.35268	0	0	14.18567	13.52122	0	16.26492	0	16.33753	14.5961	0	0	0	0	14.44589	0	0	0	0	14.27426	0	15.14782	17.50181	14.03372	0	0	15.73926	15.27996	14.89	0	14.45039	15.80345	16.24449	16.0607	13.80813	16.04785	14.98427	0	0	0	0
A0A669F003	A0A669F003_ORENI		glycolytic process [GO:0006096]	2-phospho-D-glycerate hydro-lyase (EC 4.2.1.11)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	phosphopyruvate hydratase complex [GO:0000015]	phosphopyruvate hydratase complex [GO:0000015]; magnesium ion binding [GO:0000287]; phosphopyruvate hydratase activity [GO:0004634]; glycolytic process [GO:0006096]	magnesium ion binding [GO:0000287]; phosphopyruvate hydratase activity [GO:0004634]	IEKAAEER	3.049999952	940.9478164	12.77693	14.70539	14.11308	14.29987	12.73537	12.71344	14.94027	13.02683	14.38186	6.327478	0	13.44612	14.43168	13.2356	13.89327	13.68663	10.75848	12.37857	0	13.48489	10.15361	10.15051	12.4952	13.96061	12.45841	0	14.80485	12.6812	13.43301	13.04114	15.51089	13.78389	13.02141	14.03711	14.16989	11.19683	0	12.67915	10.52912	14.99327	13.14961	13.20373	14.80562	7.162974	13.96098	14.01815	0	15.07752	13.63376	0	0	0	15.13237	0
I3JD91	I3JD91_ORENI			"28S ribosomal protein S31, mitochondrial"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial small ribosomal subunit [GO:0005763]	mitochondrial small ribosomal subunit [GO:0005763]; structural constituent of ribosome [GO:0003735]	structural constituent of ribosome [GO:0003735]	VGKNPNR	13.22000027	783.79022	16.38239	0	15.57911	0	0	0	0	0	0	0	0	0	17.05466	0	0	14.74317	17.11901	15.67678	16.08821	0	15.50916	18.01149	0	0	0	0	0	16.1007	0	16.25636	0	0	0	15.36436	15.56052	0	16.76322	16.50236	0	0	15.49698	16.23425	18.34706	0	15.26147	16.00195	14.72758	0	15.77435	14.73295	15.16568	16.55546	17.18912	0
A0A669CHC8	A0A669CHC8_ORENI	exd2		3'-5' exonuclease domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; 3'-5' exonuclease activity [GO:0008408]; nucleic acid binding [GO:0003676]	3'-5' exonuclease activity [GO:0008408]; nucleic acid binding [GO:0003676]	AGDGDR	5.769999981	591.1193624	15.18567	15.61393	0	14.93362	14.67557	15.99572	15.832	15.6826	14.95411	16.32943	14.95322	16.56409	15.40833	14.31743	16.48653	16.11428	15.58615	16.20221	16.79905	15.87248	15.90887	14.81522	14.72923	16.13163	15.90641	16.15525	14.94939	15.97865	15.87031	15.39616	16.81921	17.82405	16.96908	16.31156	15.76632	15.81003	15.3964	14.39806	15.81241	16.14179	16.43595	15.77119	15.37947	15.35454	15.21341	15.72391	14.62072	16.17848	15.25141	16.51909	15.67928	14.62569	14.96137	16.05993
A0A669D4H1	A0A669D4H1_ORENI	LOC100696541	branched-chain amino acid catabolic process [GO:0009083]; valine catabolic process [GO:0006574]	3-hydroxyisobutyrate dehydrogenase (HIBADH) (EC 1.1.1.31)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		3-hydroxyisobutyrate dehydrogenase activity [GO:0008442]; NAD binding [GO:0051287]; NADP binding [GO:0050661]; branched-chain amino acid catabolic process [GO:0009083]; valine catabolic process [GO:0006574]	3-hydroxyisobutyrate dehydrogenase activity [GO:0008442]; NAD binding [GO:0051287]; NADP binding [GO:0050661]	LTFMVGGVVEEYNAAK	9.779999733	1744.8511	15.74507	0	17.16249	16.20606	0	0	15.79567	14.96924	0	16.75521	16.44459	16.96384	16.6677	0	0	0	0	0	0	0	15.74472	0	0	0	0	15.79355	16.94562	16.99509	17.10574	0	18.22194	16.85275	14.60342	0	15.6064	0	15.68165	16.90064	0	16.51204	0	0	16.94992	16.00591	15.72899	19.99151	0	0	0	15.86927	17.51668	0	0	0
I3KNC6	I3KNC6_ORENI	mrpl52	mitochondrial translation [GO:0032543]	"39S ribosomal protein L52, mitochondrial"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial large ribosomal subunit [GO:0005762]	mitochondrial large ribosomal subunit [GO:0005762]; structural constituent of ribosome [GO:0003735]; mitochondrial translation [GO:0032543]	structural constituent of ribosome [GO:0003735]	KEHGLAR	20.04999924	810.3011186	16.3278	16.56047	15.31799	15.18325	15.76041	15.74323	0	15.53584	0	15.62306	0	15.93419	15.25221	16.3201	17.27869	0	0	0	16.1323	15.75762	0	17.05235	14.97839	0	0	0	15.94846	0	14.02364	16.58759	16.44573	0	0	0	0	15.42699	15.6481	16.62845	15.21067	15.59788	16.1067	15.4413	15.46134	0	15.91189	16.32479	15.4473	15.8498	14.14149	16.52835	15.03639	14.23396	15.3848	14.98112
A0A669CAN1	A0A669CAN1_ORENI	agl	glycogen biosynthetic process [GO:0005978]; glycogen catabolic process [GO:0005980]	"4-alpha-glucanotransferase (EC 2.4.1.25) (EC 3.2.1.33) (Amylo-alpha-1,6-glucosidase) (Dextrin 6-alpha-D-glucosidase) (Glycogen debrancher) (Glycogen debranching enzyme) (Oligo-1,4-1,4-glucantransferase)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	"cytoplasm [GO:0005737]; 4-alpha-glucanotransferase activity [GO:0004134]; amylo-alpha-1,6-glucosidase activity [GO:0004135]; beta-maltose 4-alpha-glucanotransferase activity [GO:0102500]; glycogen biosynthetic process [GO:0005978]; glycogen catabolic process [GO:0005980]"	"4-alpha-glucanotransferase activity [GO:0004134]; amylo-alpha-1,6-glucosidase activity [GO:0004135]; beta-maltose 4-alpha-glucanotransferase activity [GO:0102500]"	IGGGYIVVDPVLR	14.89000034	1357.40283	11.09705	15.55161	0	0	0	0	0	0	0	0	12.53108	0	0	0	0	0	13.34692	0	0	0	0	0	10.1011	0	0	0	0	14.24333	15.37499	0	0	0	0	0	0	12.33303	0	0	11.14374	0	0	0	0	0	0	13.0621	0	12.69197	0	0	0	0	0	0
A0A669D4F5	A0A669D4F5_ORENI	rps15	translation [GO:0006412]	40S ribosomal protein S15	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	small ribosomal subunit [GO:0015935]	small ribosomal subunit [GO:0015935]; RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]	MADTEIKK	5.800000191	948.6854128	14.09668	14.5191	15.51597	11.2988	0	12.19461	15.12556	13.88856	0	14.24156	0	14.23533	14.54091	0	0	13.55566	12.6724	13.65351	13.74387	15.22431	12.99605	15.31369	14.26584	0	0	17.36504	14.01259	0	0	0	0	14.15726	0	14.81045	12.65508	0	14.54459	13.73044	14.60169	0	10.84007	0	0	15.24749	15.52526	0	0	14.70525	14.58745	15.14631	15.31609	0	14.91933	14.57413
I3KGW5	I3KGW5_ORENI	LOC100689943	brain segmentation [GO:0035284]; chordate embryonic development [GO:0043009]; erythrocyte development [GO:0048821]; hemoglobin biosynthetic process [GO:0042541]; intrinsic apoptotic signaling pathway by p53 class mediator [GO:0072332]; regulation of erythrocyte differentiation [GO:0045646]; regulation of innate immune response [GO:0045088]; translation [GO:0006412]	40S ribosomal protein S19	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; brain segmentation [GO:0035284]; chordate embryonic development [GO:0043009]; erythrocyte development [GO:0048821]; hemoglobin biosynthetic process [GO:0042541]; intrinsic apoptotic signaling pathway by p53 class mediator [GO:0072332]; regulation of erythrocyte differentiation [GO:0045646]; regulation of innate immune response [GO:0045088]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	MPGVTVKDVNQQEFVR	2.460000038	1847.399213	14.06121	0	12.71539	13.96958	0	9.360357	13.29879	0	11.21342	12.51329	16.27954	14.17955	10.75321	0	14.23612	13.28103	0	10.59442	11.47407	12.60612	0	0	13.00823	0	14.44475	0	11.55696	0	0	13.19893	15.14577	14.29802	15.39565	14.75564	14.0451	0	13.14766	12.53479	14.97554	15.13429	14.87314	13.96289	13.34281	13.75728	13.43586	12.83265	0	0	0	11.70314	14.53379	14.48713	12.71991	0
I3J219	I3J219_ORENI	rps2	translation [GO:0006412]	40S ribosomal protein S2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	small ribosomal subunit [GO:0015935]	small ribosomal subunit [GO:0015935]; RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]	CGSVLVRLIPAPR	3.359999895	1437.41998	12.6982	0	13.61258	13.25211	13.29669	8.343197	0	14.49009	15.089	0	10.82578	0	11.59805	0	13.78437	8.571431	10.58339	12.33057	13.62836	0	0	0	13.30677	12.52305	12.7311	14.28182	0	0	12.11537	0	0	17.53331	0	14.85946	13.84989	0	0	0	12.26653	14.54662	0	13.83907	0	14.34751	13.57006	13.1346	11.80072	0	12.93129	11.17018	0	12.90172	0	15.34521
A0A669EHG0	A0A669EHG0_ORENI	rps23	translation [GO:0006412]	40S ribosomal protein S23	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	small ribosomal subunit [GO:0015935]	small ribosomal subunit [GO:0015935]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	KAHLGTALK	15	939.2515774	12.37011	12.81969	11.94364	0	0	16.64907	0	0	14.57625	12.44304	0	10.91429	0	13.89288	10.78507	0	13.68543	0	13.10653	15.22941	0	17.31136	15.2375	0	14.9695	12.97767	0	12.13147	0	12.29099	14.04643	0	11.37539	0	15.45808	12.44837	14.75907	13.23133	15.35068	13.02768	0	14.86569	13.5783	0	0	16.25782	13.99291	12.8658	0	15.55688	0	0	15.71192	16.31463
I3KSA7	I3KSA7_ORENI	rps26	translation [GO:0006412]	40S ribosomal protein S26	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	APPKPM	5.449999809	655.0529642	13.91063	13.59903	0	14.4412	14.13951	0	0	9.785939	13.17973	14.72018	14.99756	0	14.15643	15.21239	13.09688	0	0	11.97935	13.82582	12.91906	11.15413	14.48737	0	12.23691	0	12.61444	14.80784	13.36871	0	0	17.84241	17.644	0	0	0	13.00122	14.30236	0	12.7274	0	14.25548	0	12.19143	14.48715	13.64439	10.02847	14.79772	0	0	0	13.21825	14.82007	15.52629	0
I3K4K6	I3K4K6_ORENI	rps9	translation [GO:0006412]	40S ribosomal protein S9	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	small ribosomal subunit [GO:0015935]	small ribosomal subunit [GO:0015935]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]	KTYVTPR	5.639999866	864.9196595	13.88948	13.98433	0	14.46963	12.58166	0	0	0	9.347575	13.75007	0	0	13.53321	0	13.80865	13.06417	12.48055	14.24156	0	13.69163	0	14.88331	13.11684	0	0	0	0	14.0033	0	0	18.67955	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.56371
I3KIF0	I3KIF0_ORENI	sdf4	sprouting angiogenesis [GO:0002040]	45 kDa calcium-binding protein (Stromal cell-derived factor 4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi lumen [GO:0005796]	Golgi lumen [GO:0005796]; calcium ion binding [GO:0005509]; sprouting angiogenesis [GO:0002040]	calcium ion binding [GO:0005509]	DKSPSSK	12.93999958	746.9641453	13.76329	16.24453	14.59768	0	14.14414	15.15528	15.0423	16.41439	13.71847	15.84383	15.00271	16.78356	13.86695	0	14.86248	17.1394	16.38963	0	14.52587	16.09064	14.37778	18.18065	16.75109	13.01172	17.34776	16.60654	14.41013	0	15.99667	0	14.9526	16.56166	0	14.77871	0	0	0	0	0	0	14.59258	0	0	0	5.467797	0	0	0	0	0	0	0	0	0
I3JBN5	I3JBN5_ORENI	LOC100705530		4F5 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SPMPPELADVQA	12.14000034	1255.75209	0	14.34897	15.27898	0	0	0	14.47267	9.668954	0	0	15.42091	15.75418	0	14.81396	15.72435	15.12552	13.99206	9.159332	11.73954	14.32889	16.79577	12.47686	13.0693	14.36785	14.72164	14.79856	12.81324	0	0	14.46272	15.333	12.4893	0	13.35431	13.45597	12.52781	13.51587	12.04592	0	0	12.84628	12.77148	13.59051	0	14.16292	0	0	13.61427	12.98497	0	0	15.1428	14.26112	0
I3KIQ8	I3KIQ8_ORENI	xrn1	nuclear-transcribed mRNA catabolic process [GO:0000956]	5'-3' exoribonuclease 1 (EC 3.1.13.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; 5'-3' exonuclease activity [GO:0008409]; RNA binding [GO:0003723]; nuclear-transcribed mRNA catabolic process [GO:0000956]	5'-3' exonuclease activity [GO:0008409]; RNA binding [GO:0003723]	VDYTGHK	19.70000076	818.965447	0	0	0	16.72698	15.86142	14.76198	15.12973	18.70386	0	17.12312	17.04083	18.21409	16.52485	16.84963	0	0	16.69185	15.44091	16.9926	0	18.62114	16.60708	18.0673	16.76894	16.74614	0	0	0	0	17.7409	0	0	16.75115	0	0	15.65251	0	17.28966	0	0	17.67563	0	14.916	15.43873	0	0	19.00126	16.2007	16.53348	0	16.75619	0	18.25761	14.93339
I3KR22	I3KR22_ORENI		mRNA processing [GO:0006397]	5'-3' exoribonuclease (EC 3.1.13.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; 5'-3' exoribonuclease activity [GO:0004534]; nucleic acid binding [GO:0003676]; mRNA processing [GO:0006397]	5'-3' exoribonuclease activity [GO:0004534]; nucleic acid binding [GO:0003676]	MQSNMVNDGADSRGVK	4.96999979	1740.683445	0	13.71617	12.2871	11.62461	13.28865	13.14132	13.43627	13.39906	13.56387	11.47257	15.67987	13.35312	0	0	13.8227	14.90973	0	9.020589	0	0	12.7422	14.25583	12.38305	15.57736	7.824545	14.90029	0	13.24367	15.52829	0	13.12378	0	0	12.41176	0	0	0	14.15722	0	0	0	13.61368	0	12.63047	0	10.9814	14.36287	13.65308	13.55965	12.23317	0	0	14.32323	0
I3IW59	I3IW59_ORENI	hddc2		5'-deoxynucleotidase HDDC2 (EC 3.1.3.89) (HD domain-containing protein 2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		5'-deoxynucleotidase activity [GO:0002953]	5'-deoxynucleotidase activity [GO:0002953]	FHHPDVLQLVSSMNKER	5.300000191	2053.23605	12.9065	14.62834	0	14.64159	14.18971	0	16.27878	9.835232	0	12.74576	8.775476	11.26592	0	14.47557	14.29274	10.76577	13.37146	11.97158	17.41392	0	13.04774	13.23356	9.90715	0	13.9027	0	13.68081	9.339484	0	0	0	17.58613	0	0	0	0	0	0	0	0	0	14.40594	0	0	0	0	0	0	0	0	0	0	0	0
A0A669CYW8	A0A669CYW8_ORENI			5'-nucleotidase domain containing 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	TPLQHEAPLWMDQLCTGCMK	11.61999989	2448.593864	0	0	11.54923	14.12522	0	0	0	12.69261	11.54911	10.1424	12.70395	0	14.5842	15.9233	0	13.4808	14.03973	14.09588	18.0593	0	0	0	0	0	0	0	0	0	0	0	0	0	13.7057	0	14.4324	12.05619	8.676023	11.16381	12.32227	0	0	13.24721	0	0	12.51439	0	12.97998	10.92083	17.20148	0	0	0	0	12.47149
A0A669E551	A0A669E551_ORENI			"5'-nucleotidase, cytosolic II, like 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	DIGSIHMRMK	9.399999619	1204.121	0	8.695849	5.297794	0	0	14.08971	0	0	0	19.86472	15.70785	13.51217	0	0	11.00379	12.51943	10.55223	0	0	12.88182	13.95615	14.56951	0	11.24004	17.32124	0	18.84471	11.91213	0	10.19898	13.03673	0	0	19.05977	0	18.1571	0	12.14993	11.51712	12.7476	0	14.83808	0	0	15.79246	14.69777	15.47286	0	15.18444	12.68817	13.54469	12.18974	0	15.32274
I3JRP1	I3JRP1_ORENI			"5'-nucleotidase, cytosolic IIa"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	NRHDVDFK	8.789999962	1031.803338	16.25821	15.30564	16.13007	15.20078	14.90642	17.48997	15.6798	12.106	15.71965	17.63896	15.14163	0	15.0093	14.98046	0	17.14778	15.19581	0	15.51802	13.70201	0	14.00401	0	0	0	0	0	0	8.662683	13.05738	0	0	0	13.0602	0	12.43475	0	14.31011	15.91939	15.43293	0	0	0	0	13.69961	13.92736	0	16.03707	0	0	0	0	0	0
A0A669CFV1	A0A669CFV1_ORENI	ILK		59 kDa serine/threonine-protein kinase (Beta-integrin-linked kinase) (ILK-1) (ILK-2) (Integrin-linked protein kinase) (p59ILK)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	focal adhesion [GO:0005925]; lamellipodium [GO:0030027]; sarcomere [GO:0030017]	focal adhesion [GO:0005925]; lamellipodium [GO:0030027]; sarcomere [GO:0030017]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	GSSAMR	4	607.5534696	14.91885	14.05415	13.99397	14.60204	13.46242	15.10873	0	15.59325	14.93165	0	13.44902	14.67736	0	15.03781	10.45407	14.81518	0	15.35417	13.50087	14.1085	0	0	14.52636	0	0	0	14.3208	14.69099	15.53096	14.61557	0	16.76623	19.08644	14.984	0	14.86233	8.556588	13.20632	0	0	13.79957	12.00513	15.47586	0	0	0	0	0	0	0	13.68057	0	0	14.05924
A0A669B136	A0A669B136_ORENI	LOC100700435	"fructose 2,6-bisphosphate metabolic process [GO:0006003]; fructose metabolic process [GO:0006000]"	"6-phosphofructo-2-kinase (EC 2.7.1.105) (EC 3.1.3.46) (Fructose-2,6-bisphosphatase)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"6-phosphofructo-2-kinase activity [GO:0003873]; ATP binding [GO:0005524]; fructose-2,6-bisphosphate 2-phosphatase activity [GO:0004331]; fructose 2,6-bisphosphate metabolic process [GO:0006003]; fructose metabolic process [GO:0006000]"	"6-phosphofructo-2-kinase activity [GO:0003873]; ATP binding [GO:0005524]; fructose-2,6-bisphosphate 2-phosphatase activity [GO:0004331]"	RAIILSFAMEMGYK	8.840000153	1661.66424	0	15.13499	14.15316	0	14.40986	0	0	0	16.45092	0	14.33922	0	15.5606	13.15387	13.37807	0	14.98738	15.27549	13.59933	13.06031	14.58457	15.26789	15.93622	13.90963	11.41918	14.33316	0	15.48457	7.730986	0	15.47678	11.45097	14.6201	0	15.85575	14.80925	14.40535	14.551	14.49136	14.50216	12.90526	14.95863	0	12.79024	0	14.27067	15.3376	12.13404	0	14.56772	0	13.07822	14.22931	14.04591
A0A669EPC9	A0A669EPC9_ORENI		fructose 6-phosphate metabolic process [GO:0006002]	6-phosphofructokinase (EC 2.7.1.11) (Phosphohexokinase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; 6-phosphofructokinase activity [GO:0003872]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; fructose 6-phosphate metabolic process [GO:0006002]	6-phosphofructokinase activity [GO:0003872]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	MAGASAPK	1.559999943	731.114617	16.32354	13.16086	15.55483	18.13314	11.37422	15.63623	13.74696	15.82684	16.81394	15.44102	15.77211	0	0	11.49443	13.57546	15.61797	15.51952	16.36159	15.89117	15.73286	15.61954	15.98381	15.93003	0	0	16.4461	0	0	17.09702	16.63569	17.83672	0	17.05937	14.27728	15.03408	16.30616	0	15.96946	17.17711	16.40047	16.43036	0	0	0	0	0	0	0	0	0	15.9791	17.24896	0	0
I3K867	I3K867_ORENI	hspd1	fin regeneration [GO:0031101]; protein refolding [GO:0042026]	"60 kDa chaperonin (EC 5.6.1.7) (60 kDa heat shock protein, mitochondrial) (Chaperonin 60) (Heat shock protein 60)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial matrix [GO:0005759]	mitochondrial matrix [GO:0005759]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; isomerase activity [GO:0016853]; fin regeneration [GO:0031101]; protein refolding [GO:0042026]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]; isomerase activity [GO:0016853]	EMPGGMGGMGGMGGMGGGMGF	5.449999809	1910.140262	12.80349	11.04037	14.10367	13.57189	13.60379	13.57824	13.55425	14.62611	0	12.0912	7.375283	12.60954	0	0	14.47945	13.81012	10.9411	12.82568	0	13.09271	14.66513	15.46469	0	0	0	0	13.9261	11.54392	15.41505	0	15.79254	14.79305	0	0	14.88001	0	14.25799	14.49078	0	14.49139	0	14.61313	0	0	0	0	13.67985	14.69	13.71242	0	0	14.86286	0	14.17636
I3JTN7	I3JTN7_ORENI	rpl27	erythrocyte differentiation [GO:0030218]; translation [GO:0006412]	60S ribosomal protein L27	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ribosome [GO:0005840]; rough endoplasmic reticulum [GO:0005791]	ribosome [GO:0005840]; rough endoplasmic reticulum [GO:0005791]; structural constituent of ribosome [GO:0003735]; erythrocyte differentiation [GO:0030218]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	DVFRDPALK	2.5	1060.818585	8.943823	15.47388	16.32225	13.92412	0	11.23057	0	0	15.43795	12.12486	0	0	18.11382	12.60588	16.15748	14.47998	14.77864	11.37516	12.76725	14.77678	14.53877	10.29204	12.36534	16.9235	14.62844	11.45181	0	14.47217	16.34905	11.67892	0	18.91988	0	12.83979	0	13.49905	13.04716	13.36548	0	0	0	0	0	12.28602	0	13.51673	0	14.44167	15.38062	0	0	0	0	0
A0A669B6M9	A0A669B6M9_ORENI	rpl35	translation [GO:0006412]	60S ribosomal protein L35	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	MPIDLR	7.179999828	744.4853366	14.42635	16.06985	15.37071	15.49304	0	0	0	0	15.35523	17.44526	15.74551	15.55898	15.75295	13.52545	15.59588	14.81556	16.86764	16.90856	0	0	16.00992	0	16.90211	16.70224	17.41664	16.35497	0	15.45337	14.75733	0	16.09363	0	0	13.71427	0	0	0	0	0	0	0	0	16.14846	0	0	0	0	0	16.77698	18.50714	0	16.31792	0	0
A0A669D2Q3	A0A669D2Q3_ORENI		translation [GO:0006412]	60S ribosomal protein L35a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	AHGSSGMVR	10.15999985	917.3108865	0	0	17.60651	0	0	0	0	0	18.07678	17.30816	0	0	17.7426	0	0	18.23114	17.81847	18.76061	17.67851	17.83468	0	17.07357	17.29785	16.84808	0	17.80821	0	0	0	16.497	19.05878	17.97698	0	0	0	17.11406	0	0	0	17.33375	0	0	0	0	0	0	0	18.12426	17.17757	0	0	0	17.74159	0
I3JMG5	I3JMG5_ORENI	RPL38	chordate embryonic development [GO:0043009]; translation [GO:0006412]	60S ribosomal protein L38	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; chordate embryonic development [GO:0043009]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	MLCLSPRK	1	1004.432345	0	15.23646	0	14.80633	15.00278	0	15.20753	16.22617	15.63518	15.67921	16.63277	13.1839	14.04585	0	0	16.01723	14.6375	0	0	14.82344	0	14.88402	15.07411	14.32324	14.69132	0	15.19687	0	15.36624	16.84546	14.98042	16.13866	0	16.18961	0	15.57401	15.51726	15.33986	0	0	15.8066	15.86753	16.37117	15.9041	14.31502	0	0	15.70263	0	15.02006	14.93831	13.88071	16.12798	15.38703
A0A669ECH3	A0A669ECH3_ORENI		translation [GO:0006412]	60S ribosomal protein L8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	DAPAGR	5.400000095	586.5166501	14.57968	15.14787	14.02122	15.72392	13.2795	15.30524	0	14.61857	13.57287	15.72989	15.54217	0	0	12.75699	13.94953	14.75844	14.45458	13.31337	0	0	15.65873	14.09554	13.42204	14.66387	13.79391	14.69516	14.47255	15.3972	9.176194	14.05473	17.26674	17.38301	17.3999	14.94167	12.951	15.00818	14.03957	12.74032	14.16827	13.94627	14.92911	12.81338	14.99501	13.7914	16.61019	14.47105	15.59506	15.02515	15.06989	14.31247	14.73915	14.70178	15.26265	15.12983
A0A669BR54	A0A669BR54_ORENI		collagen catabolic process [GO:0030574]	72 kDa gelatinase (EC 3.4.24.24) (72 kDa type IV collagenase) (Matrix metalloproteinase-2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular matrix [GO:0031012]; extracellular region [GO:0005576]	extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]; collagen catabolic process [GO:0030574]	metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	IRLLTSK	4.449999809	831.748466	16.72964	19.52634	16.66759	15.99642	19.76988	14.67369	19.14834	15.8805	16.97963	18.34905	16.26381	16.70509	14.9803	14.2383	12.57936	17.04731	16.78188	16.16127	16.50764	16.72238	15.53279	11.92859	15.92712	17.53713	17.83324	15.05365	15.37237	17.61997	18.30499	16.58727	0	15.31775	15.20749	15.34097	15.91976	16.46612	17.02923	16.6543	16.75819	0	15.5916	17.3115	13.18138	17.87431	15.87498	14.31433	17.93361	15.16948	18.77755	0	17.45603	15.96001	0	17.4002
I3IZN1	I3IZN1_ORENI	LOC100708428		78 kDa glucose-regulated protein (Binding-immunoglobulin protein) (Heat shock protein 70 family protein 5) (Heat shock protein family A member 5) (Immunoglobulin heavy chain-binding protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum lumen [GO:0005788]	endoplasmic reticulum lumen [GO:0005788]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	SKPHIQVDIGGGQMK	4.340000153	1611.787759	0	0	13.62751	0	14.96167	0	13.91175	12.91229	13.06644	12.5436	13.80516	14.78613	13.55034	8.911716	14.27127	0	17.22549	13.97181	12.99092	13.46755	13.47145	0	12.88331	14.23657	14.77073	12.68395	14.12212	10.72176	10.79401	0	17.14847	0	16.40581	15.00074	13.12193	7.197687	14.82274	0	12.94885	0	13.72845	14.13997	12.91756	15.11289	14.43224	13.97249	0	10.90152	0	15.67082	17.24487	12.94898	12.82317	11.93653
I3KHL2	I3KHL2_ORENI			A kinase (PRKA) anchor protein 11	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				YSAKHR	4.940000057	758.8544999	12.75965	14.49051	0	13.8355	16.2928	13.33626	17.09124	13.12071	0	13.68752	12.52718	0	0	0	15.23293	16.4281	14.5226	13.16475	12.22988	0	11.17628	14.81635	0	10.31386	17.9803	14.89746	15.13939	14.57704	13.57196	13.93438	18.53941	17.41801	0	0	0	12.92294	15.11133	13.09398	13.76097	14.18004	11.7921	13.24908	0	14.60586	0	14.79177	16.99866	16.64993	0	14.93765	16.01302	15.05605	15.72597	15.55395
I3K5B5	I3K5B5_ORENI			A2M_recep domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]	extracellular space [GO:0005615]		QPSGTLVMTVTLMSR	7.409999847	1620.400098	15.88312	0	0	15.01362	14.57579	15.14221	14.95598	13.17781	0	15.72236	0	16.41415	0	16.1452	16.16162	0	16.17979	16.40693	0	0	0	0	0	0	0	17.04951	0	16.94447	0	15.20467	15.20652	14.91561	17.06418	15.70872	15.85861	0	16.15778	16.30687	0	0	0	16.36417	0	15.90093	15.57158	0	0	16.64707	0	20.31132	0	0	0	16.77547
I3KNW1	I3KNW1_ORENI	LOC102079736		AAA domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATPase activity [GO:0016887]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	AGLLDEMR	16.61000061	920.5968967	14.60045	15.00969	15.50595	15.34142	15.62631	13.54731	16.24242	16.30579	16.99684	0	17.05818	16.18926	15.97447	16.49091	15.3814	0	14.23712	16.02744	14.73796	16.71566	16.73093	15.12316	12.5081	16.24098	15.04155	16.42475	14.23386	17.86812	15.70422	15.47841	17.67023	17.70026	14.96568	14.64271	0	0	0	17.74625	15.93476	15.62315	16.10026	16.56363	17.63119	0	17.30234	16.08601	17.82642	15.71058	16.54778	16.68723	0	16.58476	0	16.54748
I3KML9	I3KML9_ORENI	LOC100690829	amino acid transport [GO:0006865]	AA_permease_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transmembrane transporter activity [GO:0022857]; amino acid transport [GO:0006865]	transmembrane transporter activity [GO:0022857]	SCSIVK	6.860000134	693.6823325	0	13.68633	15.66872	16.56138	15.32465	11.19419	0	14.81066	13.22879	14.92057	0	14.57102	14.13416	0	14.30121	15.81851	14.87472	15.61294	0	0	0	0	15.46745	16.14725	0	0	14.0212	15.65371	16.2084	0	0	16.71066	0	15.96484	14.91545	14.53266	15.03369	0	14.97371	13.90522	0	0	0	15.41466	14.51431	15.56459	0	0	0	0	0	0	10.71442	0
A0A669E2R7	A0A669E2R7_ORENI	LOC100698626		AB hydrolase-1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	NMLENKYSQMPAMFDGMK	9.859999657	2183.801116	14.45553	0	0	0	11.00951	11.02749	0	13.54919	0	16.86392	7.018659	14.04466	12.5051	9.885843	0	14.51623	0	0	13.25638	14.81077	9.348268	16.79736	0	0	12.39285	11.74513	0	10.72064	18.47767	0	10.51304	0	0	0	0	12.44573	12.17677	13.26516	13.80138	0	0	14.44773	10.81427	14.01969	12.76429	7.370765	11.63142	7.459701	0	0	14.64548	14.7388	14.88569	11.07975
A0A669B2B1	A0A669B2B1_ORENI	LOC100709572	transmembrane transport [GO:0055085]	ABC transporter domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ATP-binding cassette (ABC) transporter complex [GO:0043190]	ATP-binding cassette (ABC) transporter complex [GO:0043190]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; transmembrane transport [GO:0055085]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	GPANSTEMEVR	6.340000153	1207.567657	0	15.31638	15.07329	12.36149	8.845636	14.00461	0	13.45938	0	15.75002	15.83689	14.26377	0	16.25068	16.51864	15.2408	16.83923	14.30427	0	16.30326	0	15.37597	12.32592	14.07422	0	0	0	15.67498	14.12915	0	0	16.8442	0	13.93015	0	0	14.07807	0	13.40012	14.53519	0	15.5447	13.86845	0	0	0	0	0	16.83382	15.85943	0	14.78923	0	0
A0A669BZY6	A0A669BZY6_ORENI	acbd4		ACB domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		fatty-acyl-CoA binding [GO:0000062]	fatty-acyl-CoA binding [GO:0000062]	CAFFTVKCK	6.079999924	1160.209133	15.30843	13.4423	13.00437	14.41295	14.98493	16.86049	14.56483	15.65649	15.22515	0	0	15.54584	0	14.1729	15.42767	11.75251	0	0	15.49923	0	0	0	0	0	0	0	0	0	0	12.05002	14.77207	0	13.66083	0	12.64898	0	14.27034	0	0	15.65381	0	0	0	0	14.34481	17.60189	14.7944	16.0097	0	0	12.83535	0	0	17.28439
A0A669BQ47	A0A669BQ47_ORENI	ADAM12		ADAM metallopeptidase domain 12	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; metalloendopeptidase activity [GO:0004222]	metalloendopeptidase activity [GO:0004222]	VPSSSFCR	6.150000095	939.0808722	0	13.76817	12.53892	0	0	10.60975	15.58235	11.77003	14.99442	0	14.61443	15.7221	13.91279	0	13.04341	14.21613	8.171118	0	14.4142	11.17747	0	0	13.43644	14.55561	11.76006	12.85946	9.11224	14.04528	10.38792	0	15.84663	14.85475	16.95595	14.65284	13.93684	13.84253	12.07074	12.67307	15.34357	13.34072	0	13.34152	15.84712	14.55527	9.79671	0	14.18769	13.29058	15.22327	15.7616	12.19402	12.89362	13.99835	16.05675
A0A669F2Y8	A0A669F2Y8_ORENI			ADAM metallopeptidase domain 17b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; metalloendopeptidase activity [GO:0004222]; SH3 domain binding [GO:0017124]	metalloendopeptidase activity [GO:0004222]; SH3 domain binding [GO:0017124]	LDINTFGK	15.81999969	908.8825794	12.42	12.87612	13.84101	13.33426	13.18672	14.7815	14.61692	15.84238	5.68907	15.31238	14.30196	13.6102	15.30954	12.21692	13.87188	14.41132	13.67043	0	13.28561	0	14.42834	0	11.21282	15.0903	13.44051	12.84113	0	13.53784	0	16.1456	11.26301	13.00619	0	11.60808	0	0	0	0	11.18351	12.40796	0	0	0	10.60079	0	0	14.26907	16.83569	0	14.03485	12.00131	14.0372	0	0
I3KA20	I3KA20_ORENI			"ADAM metallopeptidase with thrombospondin type 1 motif, 12"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	QCCITCGT	1.559999943	999.1329268	13.88158	14.74504	11.81248	13.74765	14.56335	11.64612	13.72138	15.35317	12.8608	0	15.20532	14.45814	12.59311	14.11568	0	0	15.75742	0	0	13.03823	15.36299	15.69126	12.82045	0	0	0	0	0	10.73449	14.18617	0	0	0	0	0	13.88405	12.76275	0	14.52304	0	0	15.5022	0	0	15.00912	0	12.84494	13.14191	13.17741	0	0	0	0	15.55071
A0A669BYI0	A0A669BYI0_ORENI			"ADAM metallopeptidase with thrombospondin type 1 motif, 15b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	collagen-containing extracellular matrix [GO:0062023]; extracellular region [GO:0005576]	collagen-containing extracellular matrix [GO:0062023]; extracellular region [GO:0005576]; metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	DFTLNLIPDTSFIAPSFTIQRVK	2.00999999	2624.580103	0	0	0	0	0	16.45663	16.46524	0	15.64599	16.83395	0	0	0	15.37231	0	0	16.69565	15.23927	0	0	16.54899	0	0	17.99357	14.4231	0	15.37048	0	17.05454	0	0	0	0	16.48456	15.0798	14.19555	0	0	14.90816	0	14.59707	0	15.66166	16.46145	0	0	14.44031	0	15.72652	0	16.30706	0	15.82578	16.93757
A0A669CNS1	A0A669CNS1_ORENI	ADAMTSL1		ADAMTS like 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]		VSSGKGIEK	21.64999962	904.4491355	0	14.7947	13.4109	0	15.81869	13.86318	0	0	15.5798	15.15972	16.73831	15.0268	12.62543	11.95048	12.96177	0	0	0	0	0	0	16.14055	0	0	0	0	0	0	0	0	0	17.93224	0	0	0	0	0	16.45514	0	17.07764	0	0	15.92888	0	0	0	15.98737	0	0	0	15.89253	0	0	17.228
A0A669B4E3	A0A669B4E3_ORENI			AE binding protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; metallocarboxypeptidase activity [GO:0004181]; zinc ion binding [GO:0008270]	metallocarboxypeptidase activity [GO:0004181]; zinc ion binding [GO:0008270]	GIKGIVR	14.73999977	741.330966	14.3159	16.09437	16.5656	15.58558	14.49883	15.60822	16.19998	15.58209	17.44645	16.09827	16.72153	0	16.11043	16.52685	16.93219	15.22746	15.67702	15.88334	16.52794	0	14.94857	0	15.69447	15.3456	15.86151	14.85138	0	17.31561	16.70503	16.96051	16.90345	15.94415	15.85738	0	0	15.05087	16.6612	15.22244	16.22559	17.1462	16.76818	0	16.58133	16.34614	16.10504	0	14.60764	17.13496	16.35629	16.6062	0	16.54775	17.22609	17.08045
I3KFL5	I3KFL5_ORENI	aff2	regulation of gene expression [GO:0010468]	AF-4_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; regulation of gene expression [GO:0010468]		GERQEEENER	15.80000019	1274.665761	19.0131	20.18401	0	19.81375	15.85368	0	21.04079	19.82817	20.80033	17.29108	18.89109	20.90668	17.27069	20.26319	0	19.72942	18.71943	19.80475	18.87861	0	0	19.69835	0	20.0498	0	19.16333	20.03999	0	0	17.04944	18.78395	20.25459	17.08281	0	20.94322	0	16.82086	18.38784	21.01148	0	16.28145	18.15702	0	21.27867	16.17058	16.84159	0	20.39537	19.5385	17.08579	19.65016	0	20.48946	0
I3KH43	I3KH43_ORENI	LOC100695847	carbohydrate biosynthetic process [GO:0016051]	AFP-like domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; catalytic activity [GO:0003824]; carbohydrate biosynthetic process [GO:0016051]	catalytic activity [GO:0003824]	EDDSILADMIE	2.50999999	1265.380128	12.5699	11.18572	12.60227	16.42914	14.01069	0	10.66113	10.17373	18.72033	12.3308	10.29254	12.10685	0	10.38863	12.11821	11.79113	0	0	11.26597	11.89723	15.04288	14.68747	0	0	0	13.37386	0	13.14664	10.25912	13.46672	10.6978	10.80201	14.18763	0	12.21078	13.42359	0	13.47813	0	0	13.32936	0	0	0	0	0	0	11.09512	0	0	0	12.7782	0	0
I3JJQ8	I3JJQ8_ORENI	LOC100689988		AIG1-type G domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]	GTP binding [GO:0005525]	LFDLFRSEDGVHEVHAVGLVMK	2.410000086	2498.122085	0	0	0	8.462533	0	11.73465	0	16.58432	0	0	12.89931	0	13.49319	0	12.16662	0	0	0	0	0	0	0	11.29372	12.98716	10.88045	10.10898	12.7943	0	17.44941	12.4548	11.52686	0	17.18383	9.229846	0	9.688411	0	0	0	12.8186	0	0	0	0	0	0	0	9.313745	0	0	0	0	0	0
I3JTI2	I3JTI2_ORENI	LOC102081231	embryonic skeletal system development [GO:0048706]	AIP3 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		embryonic skeletal system development [GO:0048706]		ALTDTLSSLR	2.940000057	1074.998135	12.88371	11.36729	0	0	12.15195	0	0	15.7195	0	0	0	0	15.06769	13.72231	14.39586	16.39142	15.76814	16.89631	16.25337	0	0	0	0	0	0	0	0	0	18.22601	0	15.419	0	15.54717	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669CXW5	A0A669CXW5_ORENI		'de novo' IMP biosynthetic process [GO:0006189]	AIR carboxylase (EC 4.1.1.21) (EC 6.3.2.6) (Multifunctional protein ADE2) (Phosphoribosylaminoimidazole carboxylase) (Phosphoribosylaminoimidazole-succinocarboxamide synthase) (SAICAR synthetase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		5-amino-4-imidazole carboxylate lyase activity [GO:0043727]; ATP binding [GO:0005524]; phosphoribosylaminoimidazole carboxylase activity [GO:0004638]; phosphoribosylaminoimidazolesuccinocarboxamide synthase activity [GO:0004639]; 'de novo' IMP biosynthetic process [GO:0006189]	5-amino-4-imidazole carboxylate lyase activity [GO:0043727]; ATP binding [GO:0005524]; phosphoribosylaminoimidazole carboxylase activity [GO:0004638]; phosphoribosylaminoimidazolesuccinocarboxamide synthase activity [GO:0004639]	VVLLMGSISDVAHCEK	9.539999962	1756.907316	12.52426	10.37495	12.73836	14.27839	13.38946	9.240763	14.04243	13.735	0	14.42826	13.84373	15.47388	15.20968	0	0	0	0	13.42715	13.30853	13.23429	15.88166	15.15177	14.5964	13.00652	14.96335	0	12.97038	14.63565	14.33532	12.16027	0	0	13.82013	0	0	14.14909	0	13.37817	14.41688	13.2304	10.2814	0	13.29052	0	14.98289	12.74608	16.20839	13.04605	13.52224	14.75773	12.61625	0	14.12889	13.91065
I3JHK1	I3JHK1_ORENI	ajap1		AJAP1_PANP_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		QLIPVAFVSEK	2.380000114	1231.414855	12.09412	0	14.97408	12.97049	13.39226	13.49895	14.46439	14.24848	13.85641	15.46217	14.34125	13.52592	14.32617	0	13.3744	11.53032	15.77359	12.42505	12.6649	0	0	0	15.05473	0	0	14.44189	0	16.36878	0	0	15.0278	0	17.02783	0	17.29676	0	0	0	0	0	0	0	17.27195	16.08531	16.74209	0	16.38162	16.96541	16.19569	15.16261	0	15.61493	0	0
I3JDZ6	I3JDZ6_ORENI	sphkap		AKAP_110 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SDSCLYQR	5.400000095	1027.23316	13.7806	15.58637	0	14.97276	15.22672	13.6241	11.33256	14.74033	17.58212	0	11.6414	0	13.2228	14.93541	8.624146	11.18933	0	15.15161	14.37781	15.41702	12.95944	14.6175	13.06277	16.63643	14.855	0	0	0	18.31491	0	0	16.18113	17.83043	15.39641	12.57585	8.023682	0	14.48102	0	0	14.98665	0	16.14441	14.16252	18.19218	13.85684	14.57118	0	0	18.39192	0	13.19331	14.70284	8.197104
I3JSQ3	I3JSQ3_ORENI			ALG1 chitobiosyldiphosphodolichol beta-mannosyltransferase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; mannosyltransferase activity [GO:0000030]	mannosyltransferase activity [GO:0000030]	MRGSFK	4.510000229	726.411446	15.57854	15.67902	13.42775	12.64207	15.32129	13.55175	15.38427	13.60152	11.64126	0	14.94793	13.80099	11.25666	12.43131	13.77002	11.64823	13.454	11.38361	0	14.87863	12.71005	13.60886	13.01567	14.54892	13.76154	0	0	0	15.52138	13.27428	16.21602	16.33401	16.38696	15.53903	12.23858	13.56151	14.15057	0	0	0	11.88277	0	12.62562	13.61016	14.10575	14.69218	14.19095	0	15.34924	8.238172	12.7528	13.63105	13.47701	0
A0A669C540	A0A669C540_ORENI	cep295		ALMS_motif domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]	cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]		NLSKMHQR	4.349999905	1029.47166	12.92994	14.03115	17.06248	15.3893	13.35042	17.79707	0	18.675	18.70232	15.52417	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.0273	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3JUR8	I3JUR8_ORENI			AMOP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SGPEHR	2.329999924	680.4996793	15.46062	14.84614	15.26426	0	14.81804	15.29109	0	15.15458	15.91194	0	16.34181	0	0	15.07846	15.67558	0	13.93184	15.58687	0	0	0	0	0	0	0	14.59241	16.4424	0	0	0	15.60682	16.07985	0	16.96902	0	9.985341	0	0	18.4397	0	16.36501	0	0	16.78273	17.25502	0	0	15.6715	0	14.56527	14.34688	17.24331	0	0
I3JS50	I3JS50_ORENI	ampd1	IMP salvage [GO:0032264]	AMP deaminase (EC 3.5.4.6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		AMP deaminase activity [GO:0003876]; metal ion binding [GO:0046872]; IMP salvage [GO:0032264]	AMP deaminase activity [GO:0003876]; metal ion binding [GO:0046872]	MPKVLVPETDDK	9	1371.645775	15.23049	13.17587	15.7708	14.41753	8.097101	0	0	13.51731	13.43553	15.3395	15.5217	14.69051	16.34357	15.19028	14.59048	15.24202	0	0	15.71752	14.70881	15.86203	14.31875	15.44791	15.07424	16.65938	13.83246	15.17596	14.46488	13.39311	0	16.42019	13.66368	16.22471	15.91351	14.845	15.14555	0	12.78757	14.67523	12.19143	16.12073	0	0	13.5515	15.83191	0	0	15.04506	13.97411	11.02602	15.29399	15.85813	0	16.25667
A0A669CMJ2	A0A669CMJ2_ORENI	LOC100707217		AMP-binding domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				YGDHPALVSKK	8.930000305	1215.789342	13.71606	15.10545	0	13.8709	15.06461	11.42443	14.44573	14.58055	0	16.0363	14.19649	14.62965	14.4093	14.07007	14.68832	14.24559	13.95248	14.30263	13.69599	0	0	12.87671	0	13.78583	14.33757	15.59878	14.9449	14.94112	0	0	17.81765	13.31186	18.03972	0	15.14104	0	14.73696	15.51432	14.09165	13.82768	0	14.63635	0	0	15.8038	0	13.9817	14.06052	0	14.26486	13.68444	0	15.30492	14.32532
I3KYR0	I3KYR0_ORENI	ANKRD34A		ANK_REP_REGION domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ILVPVAPASPK	6.670000076	1091.859066	11.24568	13.19036	12.47816	8.842155	11.79516	13.03157	10.95289	12.10265	0	6.712765	12.62638	16.35615	14.81778	14.06805	18.06939	12.93433	12.834	9.193584	14.82127	13.36368	13.66563	13.26131	14.3036	13.39202	13.2464	15.08486	14.67655	17.66944	14.45662	14.2941	15.05747	11.84589	14.55764	14.64722	14.22529	14.1789	13.03435	10.54561	15.74312	0	13.05651	12.81528	13.34477	12.4709	0	16.77298	12.25926	13.51631	15.27891	14.60833	13.40788	15.51048	11.47733	14.47741
A0A669CZI3	A0A669CZI3_ORENI			ANTXR cell adhesion molecule 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; signaling receptor activity [GO:0038023]	signaling receptor activity [GO:0038023]	MRVSYIVFSAR	6.460000038	1328.647158	12.43189	12.58416	13.09087	14.6726	0	0	15.37835	0	0	11.21038	12.85364	14.24719	0	0	15.05159	13.83091	14.5829	11.44067	12.59476	11.75313	0	0	0	14.84497	0	0	15.79533	0	9.238029	0	16.90422	0	13.17677	11.46873	0	13.69747	0	0	12.44598	13.41582	12.95788	6.717881	11.46939	13.01511	0	0	13.30209	11.77155	0	12.96702	15.07601	0	13.11954	0
A0A669BVU3	A0A669BVU3_ORENI	ap1s1	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	AP complex subunit sigma	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane coat [GO:0030117]	membrane coat [GO:0030117]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]		MRFMLLFSR	2.730000019	1215.457022	13.72965	10.62571	7.838347	11.43986	11.58624	13.06261	0	0	0	0	0	10.69564	0	0	10.92737	0	13.54478	0	14.44349	0	0	0	10.16409	0	0	0	0	0	11.94224	0	11.04306	9.128992	10.8686	0	0	8.99168	11.58144	11.90592	9.813003	13.35158	13.34129	13.74838	0	0	0	13.32544	0	13.61495	14.2358	12.92905	14.00495	0	0	0
A0A669DBV1	A0A669DBV1_ORENI		clathrin-dependent endocytosis [GO:0072583]; intracellular protein transport [GO:0006886]	AP-2 complex subunit alpha	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	AP-2 adaptor complex [GO:0030122]	AP-2 adaptor complex [GO:0030122]; clathrin adaptor activity [GO:0035615]; clathrin-dependent endocytosis [GO:0072583]; intracellular protein transport [GO:0006886]	clathrin adaptor activity [GO:0035615]	PAVSKGDGMR	6.980000019	1032.542272	15.16869	15.7602	0	15.10111	15.89567	15.67576	15.83712	16.20557	14.66448	15.03234	13.82279	12.783	0	14.25904	17.93786	14.54521	15.23531	0	0	14.66724	15.24855	0	15.06094	0	16.28827	15.23335	15.36892	0	15.99821	15.38453	20.77564	0	0	17.22027	15.80819	16.41389	13.97139	0	13.3179	14.4206	0	17.28551	13.66821	14.70205	13.97764	21.33279	15.76303	15.97284	16.24079	15.51248	15.29495	14.24186	0	0
A0A669F3E7	A0A669F3E7_ORENI	tfap2a		AP-2 transcription factor (Activating enhancer-binding protein 2-alpha) (Activator protein 2) (Transcription factor AP-2-alpha)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	MSIMGKMMEWQDR	8.680000305	1689.328619	0	16.30286	0	0	0	15.08789	15.0734	13.36637	0	13.25909	14.7031	0	14.43391	0	0	0	0	0	0	0	0	0	0	0	15.00824	0	14.9977	0	0	0	16.34214	0	0	0	14.73459	0	0	0	0	0	0	0	0	0	0	15.51033	0	0	0	16.08574	0	0	0	0
A0A669DKU0	A0A669DKU0_ORENI	AP3B2	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	AP-3 complex subunit beta	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	AP-3 adaptor complex [GO:0030123]; clathrin-coated vesicle membrane [GO:0030665]	AP-3 adaptor complex [GO:0030123]; clathrin-coated vesicle membrane [GO:0030665]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]		GLKDPNQLIR	7.840000153	1153.301846	10.54053	0	12.2937	12.59531	11.76698	0	14.2622	14.49754	0	13.79967	0	14.82816	0	13.77856	10.83425	0	13.62718	8.071899	12.72517	13.34695	14.75777	13.44562	14.38788	0	12.45457	11.15116	15.58311	13.47677	12.05201	12.31739	0	15.10217	15.2401	17.58043	13.16854	9.164936	0	13.15487	0	0	13.03461	0	0	12.04582	15.4737	12.56918	12.7171	12.48576	12.79114	8.517446	12.42771	12.36264	18.54734	0
I3JI46	I3JI46_ORENI	LOC100696470	chromatin remodeling [GO:0006338]	ARID domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	brahma complex [GO:0035060]; SWI/SNF complex [GO:0016514]	brahma complex [GO:0035060]; SWI/SNF complex [GO:0016514]; DNA binding [GO:0003677]; chromatin remodeling [GO:0006338]	DNA binding [GO:0003677]	ETEGSSHVKEEEDQK	1.5	1732.499296	14.6354	0	0	12.13604	14.5562	12.50159	0	0	15.10485	0	16.33445	15.15387	0	0	14.60051	0	0	0	13.58611	0	0	16.32119	16.11064	0	0	14.66274	0	15.77626	17.14294	14.98587	0	0	0	14.24312	0	0	14.41073	0	13.4148	0	0	0	0	15.95434	14.12327	14.22316	16.43407	13.96058	15.23494	16.60331	15.69662	0	16.58962	0
I3JE95	I3JE95_ORENI	trip4	"axonogenesis [GO:0007409]; myotome development [GO:0061055]; neuromuscular junction development [GO:0007528]; regulation of transcription, DNA-templated [GO:0006355]; thigmotaxis [GO:0001966]"	ASCH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; zinc ion binding [GO:0008270]; axonogenesis [GO:0007409]; myotome development [GO:0061055]; neuromuscular junction development [GO:0007528]; regulation of transcription, DNA-templated [GO:0006355]; thigmotaxis [GO:0001966]"	zinc ion binding [GO:0008270]	KGLVPSAAD	4.980000019	855.7886788	11.79474	10.90753	12.97708	15.67088	14.83747	13.2511	16.22934	16.64043	14.03686	11.61692	0	14.15351	14.93807	10.8498	14.93888	16.31134	12.39382	0	14.60262	13.1805	14.34784	0	14.5005	14.57541	15.36351	0	0	15.37991	9.633701	14.73806	14.45597	15.82775	15.44723	14.93176	13.82111	15.0762	12.93831	0	12.62744	13.14682	14.17922	13.09178	0	14.27806	8.134524	13.78086	14.18776	0	14.87948	15.74172	14.5118	0	0	14.78339
A0A669ETM8	A0A669ETM8_ORENI		"regulation of transcription, DNA-templated [GO:0006355]; transcription, DNA-templated [GO:0006351]"	ASXL transcriptional regulator 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; regulation of transcription, DNA-templated [GO:0006355]; transcription, DNA-templated [GO:0006351]"	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	GGVDVDFETPGSILVNTNIR	2.670000076	2102.727252	13.97873	0	12.56253	12.41763	0	0	0	15.30655	0	13.71712	19.09122	0	11.56976	12.61735	18.44777	12.82849	12.25545	0	12.70242	11.89336	0	9.825923	0	15.40704	0	0	0	0	0	0	0	0	0	19.13161	17.6485	0	14.51058	0	11.56192	0	0	0	0	19.40737	0	0	0	6.758158	14.48479	8.530202	14.07593	19.05963	0	0
A0A669DAB7	A0A669DAB7_ORENI			"AT hook, DNA binding motif, containing 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GGRGGGVGR	16.04999924	773.3261703	20.74078	18.55873	19.38892	21.43978	21.94217	21.48468	19.55329	20.63352	19.21906	22.73069	22.01831	20.62528	21.21236	18.59253	20.42309	19.07158	22.69181	22.00232	17.64266	21.64031	21.31703	23.53937	21.90056	22.65261	21.41362	21.87017	21.45983	19.65347	18.43713	0	20.59962	19.40561	20.77018	19.44384	20.02398	20.65393	21.65014	19.90839	20.96858	20.95288	19.84457	20.25389	23.27781	22.25539	22.09125	18.7873	18.49917	18.06424	21.53825	20.67429	21.1384	22.74193	22.0254	22.59403
I3JMR8	I3JMR8_ORENI	ARID1B	chromatin remodeling [GO:0006338]	AT-rich interaction domain 1B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	brahma complex [GO:0035060]; integral component of membrane [GO:0016021]; nBAF complex [GO:0071565]; SWI/SNF complex [GO:0016514]	brahma complex [GO:0035060]; integral component of membrane [GO:0016021]; nBAF complex [GO:0071565]; SWI/SNF complex [GO:0016514]; DNA binding [GO:0003677]; chromatin remodeling [GO:0006338]	DNA binding [GO:0003677]	AIAMQK	6.110000134	661.260019	14.11643	15.29716	0	0	12.12604	14.2388	16.04866	13.21217	14.93685	14.12781	15.86456	0	13.75305	13.07746	15.90588	15.57137	14.7277	0	14.74271	15.3104	14.05423	13.81862	14.12645	14.3576	0	0	14.61992	15.16872	15.84071	13.88193	0	21.08788	0	16.73577	13.55828	14.35848	15.30154	13.24418	13.93677	12.92344	15.22272	13.12929	15.82892	14.8862	17.62333	14.0528	16.5431	15.8831	14.49462	15.49627	15.07659	14.90656	16.1567	15.11537
A0A669EFF4	A0A669EFF4_ORENI			AT-rich interaction domain 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		DNA binding [GO:0003677]	DNA binding [GO:0003677]	IISSSL	5.059999943	619.7084739	13.95305	0	16.72771	13.43528	10.80754	13.89576	16.74174	0	14.45945	16.39423	0	17.01616	0	18.85623	15.88256	0	13.46727	15.37811	17.81004	15.9351	15.49955	16.65397	15.49629	0	14.9826	0	16.2449	16.66742	15.49523	16.85491	22.86232	21.85935	17.75692	15.66931	0	0	16.4426	17.11932	0	0	14.628	0	0	0	0	0	10.15567	12.12981	0	0	0	16.23515	0	0
I3IWY5	I3IWY5_ORENI	arid5b	adipose tissue development [GO:0060612]; positive regulation of DNA-binding transcription factor activity [GO:0051091]	AT-rich interactive domain-containing protein 5B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; transcription coactivator activity [GO:0003713]; adipose tissue development [GO:0060612]; positive regulation of DNA-binding transcription factor activity [GO:0051091]	DNA binding [GO:0003677]; transcription coactivator activity [GO:0003713]	TVPNGK	9.380000114	613.7998245	16.02653	12.81642	0	16.45841	0	16.86638	15.87713	16.08222	14.05614	17.30004	17.74503	0	17.12686	15.21572	0	16.47817	0	15.81905	15.4916	16.12191	17.63136	16.88482	0	0	0	17.6034	17.94816	16.72686	0	0	16.7424	0	17.71994	16.66521	0	0	0	0	0	16.45543	15.39033	18.45611	0	17.4085	16.91588	16.25985	19.24552	17.2182	19.8615	19.57145	0	16.8177	20.83887	18.9487
I3KKU7	I3KKU7_ORENI			ATG16 autophagy related 16-like 1 (S. cerevisiae)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ETDAEQVMAERR	4.550000191	1433.807682	8.350131	13.81624	14.04792	0	14.93712	0	14.16983	0	14.81416	16.18449	16.52446	15.39001	13.30788	13.92815	12.74699	13.65141	0	12.78768	0	14.38119	0	0	12.1935	11.77765	13.98609	14.41376	11.80457	0	10.56836	12.44951	15.65283	0	15.92035	10.65447	16.48728	14.06542	0	0	14.55578	0	0	14.64741	11.76406	15.20208	0	12.60794	14.59164	0	0	11.59716	14.13911	0	0	14.54135
A0A669EUD9	A0A669EUD9_ORENI	ABCC4		ATP binding cassette subfamily C member 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	QFLLLDEVAPQHLGLPVAEKK	10.81999969	2345.94657	0	14.37386	16.58777	10.22837	12.57857	0	16.00322	0	13.85264	16.27094	0	0	0	0	15.92461	0	15.289	15.75998	0	14.29216	0	0	14.55404	0	0	13.73871	0	0	0	0	13.88729	0	0	12.66487	0	0	0	0	0	0	15.76032	17.53284	12.80291	0	0	14.81386	0	0	18.94701	0	14.71065	17.48992	0	0
A0A669BRH2	A0A669BRH2_ORENI			ATP synthase F1 subunit epsilon	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1) [GO:0000275]"	"mitochondrial proton-transporting ATP synthase complex, catalytic sector F(1) [GO:0000275]; proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]"	"proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]"	FSAICANALR	4.929999828	1122.296218	15.27191	12.73053	13.71663	0	0	11.81026	12.58158	0	13.89903	12.72224	14.47487	14.0074	12.77152	13.61397	0	14.27638	16.29124	0	0	0	0	0	0	0	0	0	13.88453	0	14.47004	13.897	0	0	12.82206	0	12.97672	0	14.44598	12.22459	13.88242	12.65324	0	12.60435	0	0	0	0	12.07793	13.69149	13.79649	0	0	0	0	13.1349
A0A669BHD8	A0A669BHD8_ORENI	LOC100702162		ATP-binding cassette sub-family C member 7 (EC 5.6.1.6) (Channel conductance-controlling ATPase) (Cystic fibrosis transmembrane conductance regulator) (cAMP-dependent chloride channel)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	apical plasma membrane [GO:0016324]; chloride channel complex [GO:0034707]; early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; recycling endosome membrane [GO:0055038]	apical plasma membrane [GO:0016324]; chloride channel complex [GO:0034707]; early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; recycling endosome membrane [GO:0055038]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; intracellularly ATP-gated chloride channel activity [GO:0005260]; isomerase activity [GO:0016853]	ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]; intracellularly ATP-gated chloride channel activity [GO:0005260]; isomerase activity [GO:0016853]	VAMCHMIYKK	5.119999886	1279.85834	10.27122	0	11.7716	0	9.660636	12.15674	10.53869	0	11.94278	12.88916	0	9.291741	0	0	9.87941	12.09181	14.41306	9.209975	13.77636	12.0343	15.23827	11.01924	0	0	0	12.16787	15.13292	12.7754	0	11.13994	10.60848	13.2794	13.34478	12.37606	12.99884	14.60929	13.5344	0	0	13.90709	10.64963	0	0	0	13.97124	12.45858	9.959521	16.62491	17.17328	16.02604	0	12.53304	0	13.54532
A0A669E9I1	A0A669E9I1_ORENI		lipid transport [GO:0006869]	"ATP-binding cassette, sub-family A (ABC1), member 12"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; lipid transport [GO:0006869]	ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	DADSSRNK	5.860000134	891.5221076	0	14.86678	13.13652	14.97502	15.3948	13.73998	0	17.69094	16.97754	15.84496	14.49948	0	0	14.67155	14.99585	14.89226	16.75448	15.28033	14.25759	0	16.0395	14.68713	15.59031	16.20538	15.25922	0	14.78636	15.32379	0	0	16.08138	0	13.52985	14.35444	15.35957	15.13675	0	13.95807	0	15.87162	16.44025	14.58911	0	14.79554	15.09409	14.6535	15.35321	16.2685	0	13.14902	0	14.93513	14.15947	11.52477
A0A669CRM0	A0A669CRM0_ORENI			"ATP-binding cassette, sub-family A (ABC1), member 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	LKEVMK	10.60000038	764.8130567	21.83456	19.50656	17.05877	0	0	0	13.48192	20.70534	0	0	0	0	14.62164	18.60097	0	0	18.00971	0	0	16.44973	0	18.18197	14.58836	15.06314	13.46291	20.88859	0	14.89049	18.31363	0	0	14.22876	0	16.75219	0	0	16.36213	20.51936	14.24767	0	0	0	0	0	18.67816	0	16.73424	18.64891	19.22952	16.01823	16.21548	0	14.38008	0
A0A669DHE2	A0A669DHE2_ORENI			"ATP-binding cassette, sub-family A (ABC1), member 4a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	EPGERR	5.730000019	743.655338	13.00192	13.66293	10.16873	12.07911	13.53802	14.22781	10.35054	13.41713	14.38641	13.03308	0	0	15.29211	13.16931	15.39385	14.12495	0	0	13.46235	0	16.17117	0	0	15.33734	0	0	0	0	0	13.45334	18.49853	16.5858	0	15.50786	11.8613	13.19833	15.35082	0	0	0	0	14.78892	0	0	0	0	0	0	0	0	0	0	0	14.45134
A0A669AZE6	A0A669AZE6_ORENI			"ATP-binding cassette, sub-family B (MDR/TAP), member 7"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	ILNSSK	3.720000029	661.7665484	0	15.4772	13.87596	0	0	15.08821	17.12867	16.0062	14.67113	15.65068	16.25704	14.92163	15.5929	0	15.15423	12.743	0	16.18264	12.949	16.6657	16.92936	12.43086	0	17.85508	0	16.04358	14.3328	0	17.77317	0	0	18.19745	0	0	15.04867	0	0	18.55353	15.27272	13.29159	13.89082	0	15.32428	0	0	0	0	10.54334	0	0	0	0	0	0
A0A669CEG4	A0A669CEG4_ORENI			"ATP-binding cassette, sub-family C (CFTR/MRP), member 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	KVSPHTCWPTNGCIEMR	17.37000084	2088.180393	0	15.83244	15.07363	0	15.20542	14.85397	14.92338	14.41135	0	14.70855	15.44393	14.63397	0	15.48341	15.92073	0	0	13.80957	15.55815	18.30119	0	20.29397	15.18647	0	0	14.97582	0	17.02619	15.22584	0	9.718717	14.99861	14.36747	13.56658	0	0	0	13.09085	13.84514	0	14.26889	0	12.50415	0	14.16385	14.42077	14.80314	0	18.98506	17.43066	17.03592	13.40805	11.29026	10.30597
A0A669BE04	A0A669BE04_ORENI			"ATP-binding cassette, sub-family C (CFTR/MRP), member 12"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	YCLAAGGLIYR	2.980000019	1256.94189	0	0	0	0	0	0	0	17.97557	15.26231	11.045	0	0	0	17.4354	0	0	0	16.58318	0	0	18.18209	0	13.88425	0	0	19.19256	0	0	17.58945	0	0	0	0	18.38652	0	16.09113	16.64181	0	15.24993	17.57409	0	15.045	13.96578	0	13.22267	14.53864	15.8638	13.34728	17.42465	15.93124	0	0	17.70529	0
A0A669B1G7	A0A669B1G7_ORENI		potassium ion transport [GO:0006813]	"ATP-binding cassette, sub-family C (CFTR/MRP), member 9"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; sulfonylurea receptor activity [GO:0008281]; potassium ion transport [GO:0006813]	ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]; sulfonylurea receptor activity [GO:0008281]	KPMGMTK	4.409999847	824.4304684	0	0	14.73108	16.61581	0	17.01923	16.19276	17.13862	15.95048	16.99477	16.60413	16.87881	0	16.44969	15.56504	16.16135	13.73713	15.01894	15.90104	15.67332	16.86817	0	0	15.96989	20.3798	15.3675	17.13943	16.33717	15.83928	17.03644	17.67957	16.78558	17.47284	17.46312	17.25251	15.99366	16.83396	0	16.95146	15.20677	16.37839	18.93479	17.11965	15.81764	0	17.37215	0	15.71901	16.17737	16.29616	15.62542	20.76681	17.47589	16.04695
A0A669ES47	A0A669ES47_ORENI		fatty acid beta-oxidation [GO:0006635]; very long-chain fatty acid metabolic process [GO:0000038]	"ATP-binding cassette, sub-family D (ALD), member 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; peroxisome [GO:0005777]	integral component of membrane [GO:0016021]; peroxisome [GO:0005777]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; fatty acid beta-oxidation [GO:0006635]; very long-chain fatty acid metabolic process [GO:0000038]	ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	DPGSNHRASK	18.46999931	1068.763419	0	0	0	13.50426	12.74047	14.03539	0	0	13.08997	0	0	14.5522	0	14.14752	13.59109	0	11.34638	10.31209	0	14.89625	0	13.96115	0	0	0	0	0	0	16.73765	19.32034	15.99263	0	17.78978	0	15.05978	0	14.02617	11.38192	12.16787	10.94292	11.20313	15.10916	13.12516	14.20837	0	15.08949	0	0	0	15.41258	12.7673	0	15.2106	0
A0A669C508	A0A669C508_ORENI			"ATP-binding cassette, sub-family F (GCN20), member 3"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATPase activity [GO:0016887]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	EDLLGEER	9.819999695	960.2412916	16.71152	0	17.60191	0	0	0	0	0	0	0	0	14.78146	0	14.39927	0	0	0	0	17.72546	18.0036	0	0	18.03777	17.74872	17.65919	17.71916	0	0	0	17.19807	0	0	0	0	0	7.98735	14.86078	16.3101	13.74002	18.58978	14.27169	17.2634	0	0	15.22736	19.47767	19.17795	0	16.30243	17.07446	14.73413	0	17.32608	0
A0A669DC68	A0A669DC68_ORENI			"ATP-binding cassette, sub-family G (WHITE), member 2b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	MNNITSNAR	9.06000042	1020.957972	14.73893	14.61753	18.76629	17.61437	17.9027	15.58636	0	15.1886	14.88179	17.20866	13.30755	0	0	15.0747	13.90211	0	17.05586	11.68868	0	14.16496	16.21131	0	17.29174	0	12.50155	0	0	0	15.1651	0	13.41063	0	17.78874	15.95823	0	0	0	12.07227	0	0	16.48535	0	0	15.13381	14.03513	0	0	0	18.60564	16.93094	0	0	16.51237	0
A0A669ELI7	A0A669ELI7_ORENI			"ATP-binding cassette, sub-family G (WHITE), member 4b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	ELIGIMGPSGAGK	5.099999905	1246.205368	10.69681	7.011539	8.52969	10.52124	8.726587	0	0	16.27252	16.63931	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.64736	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669CRG5	A0A669CRG5_ORENI	LOC100706997	acetyl-CoA biosynthetic process [GO:0006085]; citrate metabolic process [GO:0006101]; lipid metabolic process [GO:0006629]	ATP-citrate synthase (EC 2.3.3.8) (ATP-citrate (pro-S-)-lyase) (Citrate cleavage enzyme)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]	cytosol [GO:0005829]; ATP binding [GO:0005524]; ATP citrate synthase activity [GO:0003878]; metal ion binding [GO:0046872]; acetyl-CoA biosynthetic process [GO:0006085]; citrate metabolic process [GO:0006101]; lipid metabolic process [GO:0006629]	ATP binding [GO:0005524]; ATP citrate synthase activity [GO:0003878]; metal ion binding [GO:0046872]	MSAKAISEQTGK	8.479999542	1267.649462	11.39796	0	0	0	0	8.357513	13.84019	14.50956	0	10.66395	12.20643	17.03015	9.124625	0	11.80045	0	0	11.26375	15.91314	12.27156	0	0	12.22095	8.978722	8.608506	14.2254	12.08749	11.6567	0	14.1667	0	15.74051	0	10.22921	7.177069	11.12053	0	0	0	8.72029	0	0	6.809172	9.700376	0	0	9.600102	0	0	0	0	0	0	0
A0A669CRZ3	A0A669CRZ3_ORENI	LOC100702997	fructose 6-phosphate metabolic process [GO:0006002]	ATP-dependent 6-phosphofructokinase (ATP-PFK) (Phosphofructokinase) (EC 2.7.1.11) (Phosphohexokinase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; 6-phosphofructokinase activity [GO:0003872]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; fructose 6-phosphate metabolic process [GO:0006002]	6-phosphofructokinase activity [GO:0003872]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	SDSACVLGMRK	6.46999979	1240.118833	0	10.26162	0	12.80301	0	11.0738	14.75481	11.03629	0	0	12.04544	0	12.46039	14.12454	13.72786	0	10.86277	13.85653	7.163863	0	12.75776	11.88736	14.27826	0	11.90385	0	12.70164	10.81879	17.97208	10.072	15.67724	16.90117	0	0	13.31663	0	9.132036	0	0	0	0	0	0	0	17.97165	0	0	0	14.03881	11.49927	14.78512	0	12.27533	12.34685
I3KUL9	I3KUL9_ORENI		DNA recombination [GO:0006310]; double-strand break repair via nonhomologous end joining [GO:0006303]; telomere maintenance [GO:0000723]	ATP-dependent DNA helicase 2 subunit 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Ku70:Ku80 complex [GO:0043564]	Ku70:Ku80 complex [GO:0043564]; ATP binding [GO:0005524]; damaged DNA binding [GO:0003684]; DNA helicase activity [GO:0003678]; telomeric DNA binding [GO:0042162]; DNA recombination [GO:0006310]; double-strand break repair via nonhomologous end joining [GO:0006303]; telomere maintenance [GO:0000723]	ATP binding [GO:0005524]; damaged DNA binding [GO:0003684]; DNA helicase activity [GO:0003678]; telomeric DNA binding [GO:0042162]	EIVSKLR	4.300000191	843.6819596	0	16.12538	0	13.18052	0	15.27529	14.4992	15.07261	0	14.69255	0	15.56776	13.03239	15.47967	16.12508	0	15.47291	17.37488	0	16.37403	0	0	15.55617	0	16.16559	16.55333	0	16.00051	13.33228	11.48396	0	0	0	0	0	0	0	0	15.32848	0	0	0	0	0	0	0	0	0	0	0	0	0	17.93048	17.02694
A0A669C3K9	A0A669C3K9_ORENI	LOC109195818	DNA recombination [GO:0006310]; DNA repair [GO:0006281]; telomere maintenance [GO:0000723]	ATP-dependent DNA helicase (EC 3.6.4.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; DNA helicase activity [GO:0003678]; DNA recombination [GO:0006310]; DNA repair [GO:0006281]; telomere maintenance [GO:0000723]	ATP binding [GO:0005524]; DNA helicase activity [GO:0003678]	MTSLNDK	8.569999695	825.0755892	13.7003	16.02965	15.74643	15.2213	0	15.1621	15.04638	15.34778	17.18576	15.50477	17.1503	15.92	16.0842	0	16.34944	13.96512	18.12822	15.36008	0	16.30843	16.9838	17.91636	0	17.52886	16.4459	13.87225	17.59024	16.42744	15.4005	14.95058	16.56056	18.47185	18.03208	14.8161	0	16.11898	16.56577	15.10234	15.29744	14.84283	15.77031	14.6431	12.97468	16.41788	15.1055	16.01645	16.89964	15.05545	16.96803	0	19.37763	17.89669	16.07372	17.36239
A0A669D2B3	A0A669D2B3_ORENI	pif1 PIF1	DNA recombination [GO:0006310]; DNA repair [GO:0006281]; mitochondrial genome maintenance [GO:0000002]; telomere maintenance [GO:0000723]	ATP-dependent DNA helicase PIF1 (EC 3.6.4.12) (DNA repair and recombination helicase PIF1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]; nucleus [GO:0005634]	mitochondrion [GO:0005739]; nucleus [GO:0005634]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA recombination [GO:0006310]; DNA repair [GO:0006281]; mitochondrial genome maintenance [GO:0000002]; telomere maintenance [GO:0000723]	5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; DNA binding [GO:0003677]	HGLPRVR	4.28000021	835.3806939	15.66035	13.40203	0	15.60965	14.92304	15.54874	16.49087	15.98313	16.57768	0	14.53852	16.19379	14.88176	14.47085	14.23868	15.62377	15.88334	14.29998	15.08302	17.03766	16.77148	14.88455	13.92728	0	15.59398	16.31126	16.4155	15.39988	0	15.37284	0	17.68849	16.62477	0	0	15.94735	15.89011	16.75935	0	0	0	0	16.94551	0	0	16.87672	15.9243	0	0	16.81108	15.64035	0	0	17.11327
A0A669CRY2	A0A669CRY2_ORENI	ddx1	tRNA processing [GO:0008033]	ATP-dependent RNA helicase DDX1 (EC 3.6.4.13) (DEAD box protein 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; exonuclease activity [GO:0004527]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]; tRNA processing [GO:0008033]	ATP binding [GO:0005524]; exonuclease activity [GO:0004527]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]	AERMGLAISLVAMEK	10.52999973	1633.980439	0	0	0	0	17.03214	15.93201	15.00178	0	0	14.94091	0	0	18.92116	0	16.88108	17.13106	15.47665	0	15.05782	15.02018	0	0	12.54325	0	0	0	20.42588	0	0	0	0	0	0	15.74154	15.18508	16.15921	14.75572	14.73885	16.26751	14.72581	13.3876	15.71803	16.43551	16.04748	13.66285	0	14.89631	0	0	15.13247	14.1663	17.00546	16.38712	17.35663
I3JL17	I3JL17_ORENI	DHX29 dhx29	positive regulation of translational initiation [GO:0045948]	ATP-dependent RNA helicase DHX29 (EC 3.6.4.13) (DEAH box protein 29)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; RNA helicase activity [GO:0003724]; translation initiation factor activity [GO:0003743]; positive regulation of translational initiation [GO:0045948]	ATP binding [GO:0005524]; RNA helicase activity [GO:0003724]; translation initiation factor activity [GO:0003743]	AGQRMAQDR	5.099999905	1047.792347	12.74022	12.96647	14.08151	12.60143	14.23198	10.35803	13.31993	17.29129	13.03676	12.92937	12.81543	0	12.66379	13.52182	14.72582	17.38358	13.68912	0	14.42875	14.60332	9.447611	13.18946	17.54445	11.47129	11.87696	11.89423	12.71666	0	13.82916	15.90828	0	13.99885	13.3743	16.88015	11.76415	12.15505	11.79459	12.51276	13.93632	17.1826	13.33707	13.83889	11.3661	13.39291	16.53348	13.07395	13.23183	14.34248	0	0	14.41415	12.37973	15.58713	0
A0A669BDD0	A0A669BDD0_ORENI	LOC102081219		"ATP-dependent RNA helicase SUPV3L1, mitochondrial (EC 3.6.4.13) (Suppressor of var1 3-like protein 1)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial nucleoid [GO:0042645]	mitochondrial nucleoid [GO:0042645]; ATP binding [GO:0005524]; RNA helicase activity [GO:0003724]	ATP binding [GO:0005524]; RNA helicase activity [GO:0003724]	QDNMHRR	8.970000267	972.425129	15.63863	16.32218	15.8108	15.6069	15.19987	15.45121	15.79135	14.96193	0	16.24138	15.95015	15.29712	15.94229	0	15.99973	17.60866	15.47487	16.91003	15.26104	14.82825	15.32058	17.1588	0	16.53415	16.0911	17.24736	17.36718	15.17702	17.31247	17.17201	18.10548	20.11335	20.29037	16.14986	15.62428	16.29912	16.38489	16.05275	16.07167	0	0	17.32053	15.83343	16.55477	16.07497	17.17872	17.71376	17.52409	0	0	14.52639	17.92074	18.06723	16.83109
A0A669B1M5	A0A669B1M5_ORENI	tkfc	glycerol metabolic process [GO:0006071]	ATP-dependent dihydroxyacetone kinase (EC 4.6.1.15) (Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)) (FAD-AMP lyase (cyclic FMN forming)) (FAD-AMP lyase (cyclizing)) (FMN cyclase) (Glycerone kinase) (Triokinase) (Triokinase/FMN cyclase) (Triose kinase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; FAD-AMP lyase (cyclizing) activity [GO:0034012]; glycerone kinase activity [GO:0004371]; glycerol metabolic process [GO:0006071]	ATP binding [GO:0005524]; FAD-AMP lyase (cyclizing) activity [GO:0034012]; glycerone kinase activity [GO:0004371]	ASGDGDCGNTHAQAAK	9.029999733	1559.375563	0	15.74625	0	0	13.90216	16.18977	15.86213	14.21889	0	15.67276	12.69666	13.5848	0	0	0	0	16.66292	0	14.66878	0	0	14.50713	13.88161	14.60108	14.52331	0	15.79338	16.47113	16.10835	0	16.36138	13.04555	17.02344	13.69874	15.3029	14.19878	14.92838	15.61467	15.52794	0	0	15.54194	14.74096	14.22868	0	0	16.17106	0	16.42273	0	13.55837	0	12.72425	14.72234
A0A669BLF7	A0A669BLF7_ORENI		DNA repair [GO:0006281]	ATP-dependent helicase ATRX (EC 3.6.4.12) (Transcriptional regulator ATRX)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]"	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]; ATP binding [GO:0005524]; DNA helicase activity [GO:0003678]; metal ion binding [GO:0046872]; nucleosome-dependent ATPase activity [GO:0070615]; DNA repair [GO:0006281]"	ATP binding [GO:0005524]; DNA helicase activity [GO:0003678]; metal ion binding [GO:0046872]; nucleosome-dependent ATPase activity [GO:0070615]	IKPIVEDNDTEDSGSDVEVKK	8.180000305	2317.740185	16.36091	14.8027	14.71168	10.90149	13.09675	21.65302	13.09692	15.39083	0	16.34087	0	0	0	15.28304	15.58668	14.52206	0	0	15.2803	14.44336	13.04236	15.24051	11.94865	0	13.06388	10.68246	0	14.38235	14.84532	16.03756	0	16.0468	16.21987	16.72285	16.83177	15.09274	16.25614	0	13.05187	16.24217	15.53548	15.03681	16.2489	16.80614	0	15.61583	0	17.42653	14.49536	14.35563	15.20362	15.87255	13.40057	13.94654
I3J973	I3J973_ORENI	ATP6AP1L	proton transmembrane transport [GO:1902600]	ATPase H+ transporting accessory protein 1 like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"integral component of membrane [GO:0016021]; proton-transporting V-type ATPase, V1 domain [GO:0033180]"	"integral component of membrane [GO:0016021]; proton-transporting V-type ATPase, V1 domain [GO:0033180]; proton transmembrane transport [GO:1902600]"		CLLFQAR	4.75	908.02647	13.28004	0	14.05696	13.81191	14.22023	14.42577	13.06964	10.89035	14.16145	14.90107	0	0	14.71448	13.40284	12.97506	14.26277	12.49757	12.7541	11.74456	14.43178	13.54502	14.22706	16.3992	0	14.81516	9.949758	14.32616	9.793789	0	12.59253	12.90389	13.7622	12.90423	15.2901	11.30636	0	12.95389	10.75564	13.72261	13.97302	0	13.89766	10.21708	13.46763	14.31097	14.73966	13.71618	13.22982	12.10394	15.07148	13.39264	14.69342	13.07037	14.31107
A0A669DHA4	A0A669DHA4_ORENI		proton transmembrane transport [GO:1902600]	ATPase H+ transporting accessory protein 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"integral component of membrane [GO:0016021]; proton-transporting V-type ATPase, V1 domain [GO:0033180]"	"integral component of membrane [GO:0016021]; proton-transporting V-type ATPase, V1 domain [GO:0033180]; proton transmembrane transport [GO:1902600]"		VSPSLIQK	5.159999847	871.1894272	13.84099	14.46443	14.30214	13.90369	12.96094	13.50671	11.34246	13.88704	0	16.40633	0	16.18427	14.75823	16.31791	14.96652	14.26335	16.00937	14.83911	15.03616	14.0902	0	0	14.85269	0	14.95788	15.59462	0	0	11.08796	0	16.56013	14.7502	16.37599	17.58145	10.08614	10.96322	14.07951	14.48294	14.45542	12.97826	0	0	14.34784	15.27808	14.29671	11.48145	13.43135	13.09299	0	15.08732	12.13571	14.13936	14.72894	14.27187
A0A669AY37	A0A669AY37_ORENI		"chromatin organization [GO:0006325]; regulation of transcription, DNA-templated [GO:0006355]"	ATPase family AAA domain containing 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"ATP binding [GO:0005524]; ATPase activity [GO:0016887]; chromatin organization [GO:0006325]; regulation of transcription, DNA-templated [GO:0006355]"	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	EDLLGIHK	30.93000031	923.4472976	0	0	18.23567	17.37754	19.97314	17.79784	20.74862	14.58543	0	19.76789	19.4678	18.89733	19.03545	19.18613	19.10107	20.10077	15.62981	16.24978	18.27559	18.83125	17.17984	17.76455	17.74598	0	16.24478	18.56757	16.24438	19.62353	17.23111	19.55117	19.0105	19.06978	20.96662	19.96821	19.51976	14.49587	20.17693	19.20477	17.59459	19.6123	19.55891	20.22878	18.82838	20.59283	20.23375	19.77353	19.99456	0	19.06872	18.80558	0	17.5814	19.09889	18.74894
A0A669CUA2	A0A669CUA2_ORENI	LOC102079948	"regulation of transcription, DNA-templated [GO:0006355]"	AXH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; RNA binding [GO:0003723]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]; RNA binding [GO:0003723]	MNPSPDR	3.660000086	833.2545936	12.49324	16.59561	13.28513	11.76806	0	13.2303	0	14.90372	15.32054	16.32325	15.51213	16.59619	16.62368	0	14.89394	16.01504	17.26475	12.79799	14.80944	0	15.90935	15.71162	16.65865	0	0	17.0233	16.74604	15.62355	14.17598	15.09211	0	0	14.91451	0	16.3459	0	0	14.54042	0	0	15.69895	12.27982	16.64671	0	17.56193	0	0	0	0	0	14.70902	0	0	15.09664
I3K779	I3K779_ORENI	slc3a2	amino acid transport [GO:0006865]; carbohydrate metabolic process [GO:0005975]	Aamy domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; catalytic activity [GO:0003824]; amino acid transport [GO:0006865]; carbohydrate metabolic process [GO:0005975]	catalytic activity [GO:0003824]	AEDLDNLLK	4.900000095	1031.653506	15.78689	13.91898	12.15504	0	15.036	12.24125	16.30823	0	16.97028	11.23455	0	15.81381	15.35099	15.76587	15.29951	14.86279	0	15.09801	11.98589	16.16636	15.9675	15.49074	15.44777	0	16.97001	15.71835	0	0	0	0	17.78021	14.71967	0	16.38944	0	0	12.25513	0	0	8.461492	12.44698	0	0	14.05527	12.71467	9.974391	13.50761	12.56308	0	0	0	0	15.7033	0
I3JYE7	I3JYE7_ORENI			AarF domain containing kinase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SWKAVNAGISSVPVTR	3.869999886	1672.38026	13.89609	14.97289	0	0	15.6031	15.14163	0	15.67238	14.82668	16.17438	13.70549	15.43851	17.42873	17.06219	0	0	0	0	13.76777	0	13.29342	0	11.95489	0	0	16.49792	0	15.27483	0	16.00248	15.92226	0	0	0	12.12739	14.43204	14.15523	0	0	0	0	14.97679	0	15.00891	10.91384	12.68625	14.05654	0	10.88908	16.20967	12.7349	0	0	0
I3JFT3	I3JFT3_ORENI	lypla1		Abhydrolase_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		hydrolase activity [GO:0016787]	hydrolase activity [GO:0016787]	SFPQAAANSANK	7.449999809	1205.087708	0	12.15406	0	12.02099	11.31225	12.52388	0	13.37701	0	12.88196	0	11.08833	11.51022	13.2005	14.12259	10.22062	12.78776	10.11181	11.57173	11.47497	12.36414	17.83958	0	14.49226	13.6783	10.89611	10.60827	9.95894	0	14.27336	19.01787	11.8633	13.43708	11.64995	12.82508	12.98588	12.04794	0	10.80213	13.53187	0	13.93787	0	13.023	9.806357	0	0	0	14.5107	12.51393	15.34594	14.74562	17.47723	16.95551
I3KVC6	I3KVC6_ORENI			Abi_HHR domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DLVDNCSNLHRVADYCDNNYVK	5.630000114	2683.385506	12.92299	10.60725	9.797807	13.6901	11.20414	11.57871	0	0	0	9.524111	8.396153	11.28207	13.48166	12.77225	12.96028	13.6005	13.37084	13.22585	14.20505	0	12.9991	0	10.35197	0	13.76902	15.34508	0	0	12.449	10.52149	11.99375	0	0	0	0	0	0	0	6.908359	11.6744	9.17516	0	0	0	0	0	0	13.86726	0	0	0	0	11.44586	0
I3KJT9	I3KJT9_ORENI	aacs	fatty acid metabolic process [GO:0006631]	Acetoacetyl-CoA synthetase (EC 6.2.1.16)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]	cytosol [GO:0005829]; acetoacetate-CoA ligase activity [GO:0030729]; ATP binding [GO:0005524]; fatty acid metabolic process [GO:0006631]	acetoacetate-CoA ligase activity [GO:0030729]; ATP binding [GO:0005524]	DVALFAAAMRK	5.019999981	1209.832452	11.96657	12.19046	12.59565	13.65714	12.0116	11.59355	14.21265	0	11.82792	11.9358	0	0	12.47858	0	0	13.91888	0	0	12.26192	13.68901	14.90512	11.69731	11.2878	14.33018	12.99282	13.67709	14.63062	0	12.14847	15.03307	15.56592	16.36116	0	13.3841	0	13.75832	12.55518	13.57258	13.24236	9.76126	15.77246	14.54776	13.28021	14.80131	0	11.97596	13.50117	14.43046	13.80407	11.68185	12.44667	8.49778	12.29087	0
I3J0L9	I3J0L9_ORENI	LOC100702823	fatty acid biosynthetic process [GO:0006633]; malonyl-CoA biosynthetic process [GO:2001295]	Acetyl-CoA carboxylase (EC 6.4.1.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		acetyl-CoA carboxylase activity [GO:0003989]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; fatty acid biosynthetic process [GO:0006633]; malonyl-CoA biosynthetic process [GO:2001295]	acetyl-CoA carboxylase activity [GO:0003989]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	VLQAELKINIR	3.690000057	1291.42512	0	14.45109	15.63787	16.4003	13.2233	13.41633	0	15.59748	0	10.8467	0	17.58018	0	13.51351	0	0	0	0	0	0	0	0	0	17.47481	17.80509	11.46732	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3JZ78	I3JZ78_ORENI	prkaa1	negative regulation of hh target transcription factor activity [GO:1990787]; rhythmic process [GO:0048511]; Wnt signaling pathway [GO:0016055]	Acetyl-CoA carboxylase kinase (EC 2.7.11.27) (EC 2.7.11.31) (Hydroxymethylglutaryl-CoA reductase kinase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		[acetyl-CoA carboxylase] kinase activity [GO:0050405]; [hydroxymethylglutaryl-CoA reductase (NADPH)] kinase activity [GO:0047322]; ATP binding [GO:0005524]; negative regulation of hh target transcription factor activity [GO:1990787]; rhythmic process [GO:0048511]; Wnt signaling pathway [GO:0016055]	[acetyl-CoA carboxylase] kinase activity [GO:0050405]; [hydroxymethylglutaryl-CoA reductase (NADPH)] kinase activity [GO:0047322]; ATP binding [GO:0005524]	NPVTGMLAKMSLQLYTVDSR	5.300000191	2240.208927	0	13.33119	0	0	13.75234	0	15.13417	0	12.69531	13.7013	15.2231	13.96028	0	0	13.04354	12.52043	13.22795	0	13.64199	13.22849	10.96782	10.97718	14.65606	0	13.75887	13.20362	0	0	12.19379	0	0	15.60677	14.20651	15.8635	0	11.87204	12.96738	0	0	0	0	12.86231	12.11056	0	13.95267	0	14.18913	0	0	0	13.4807	13.61281	12.4289	14.04439
A0A669CAN3	A0A669CAN3_ORENI		pyruvate metabolic process [GO:0006090]	Acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial matrix [GO:0005759]; pyruvate dehydrogenase complex [GO:0045254]	mitochondrial matrix [GO:0005759]; pyruvate dehydrogenase complex [GO:0045254]; dihydrolipoyllysine-residue acetyltransferase activity [GO:0004742]; pyruvate metabolic process [GO:0006090]	dihydrolipoyllysine-residue acetyltransferase activity [GO:0004742]	RLMPADNEK	3.710000038	1089.087918	14.24869	16.42086	0	14.22998	14.18845	14.51966	0	0	0	11.00053	0	0	15.26411	16.88782	18.32969	17.22629	16.57282	17.0396	14.64537	15.73573	15.37025	12.62112	0	16.24912	17.82259	0	15.65911	16.67779	16.43226	15.96799	18.13087	19.4004	18.47788	14.87396	14.2393	0	14.21762	14.97731	9.748154	16.02044	16.90618	0	14.2958	13.04491	15.84473	0	21.11108	0	14.88865	0	14.026	15.04747	0	16.65534
I3KH04	I3KH04_ORENI	smpdl3b	sphingomyelin catabolic process [GO:0006685]	Acid sphingomyelinase-like phosphodiesterase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; metal ion binding [GO:0046872]; sphingomyelin phosphodiesterase activity [GO:0004767]; sphingomyelin catabolic process [GO:0006685]	metal ion binding [GO:0046872]; sphingomyelin phosphodiesterase activity [GO:0004767]	GGYYTEK	12.22999954	817.3124812	0	0	0	14.1424	16.48808	14.22836	13.81787	0	10.6305	13.49317	13.60577	15.72677	17.90009	14.59649	14.54291	15.43557	16.97052	15.3667	18.42637	0	17.35984	11.16357	17.92812	0	13.23576	17.71409	0	13.05713	0	0	0	0	0	0	14.23972	13.93265	16.52511	0	0	0	0	0	0	14.30717	17.02368	0	11.45011	0	0	0	0	0	0	0
I3JPM5	I3JPM5_ORENI		"actin cytoskeleton organization [GO:0030036]; transcription, DNA-templated [GO:0006351]"	"Actin binding LIM protein family, member 3"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	"cytoplasm [GO:0005737]; actin binding [GO:0003779]; metal ion binding [GO:0046872]; actin cytoskeleton organization [GO:0030036]; transcription, DNA-templated [GO:0006351]"	actin binding [GO:0003779]; metal ion binding [GO:0046872]	GCAKVPTR	12.55000019	887.3231759	12.147	15.16274	13.95551	13.50211	13.64769	14.48956	14.01923	11.28246	11.90373	12.52242	14.22079	15.08968	14.35995	12.29645	13.3877	8.242116	8.267322	12.50275	15.47631	14.25468	12.16612	12.503	14.2321	12.56856	14.72939	14.66267	12.30779	15.60321	12.57563	13.87267	12.66307	15.59947	15.01445	15.10976	15.2721	14.88684	13.70874	12.42049	13.40254	12.21	14.90665	14.63239	16.5435	16.74451	13.58421	0	16.24029	0	10.49775	12.76969	16.12918	15.58901	13.43399	14.06987
I3K719	I3K719_ORENI		Arp2/3 complex-mediated actin nucleation [GO:0034314]	Actin related protein 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Arp2/3 protein complex [GO:0005885]; cell projection [GO:0042995]	Arp2/3 protein complex [GO:0005885]; cell projection [GO:0042995]; actin binding [GO:0003779]; ATP binding [GO:0005524]; Arp2/3 complex-mediated actin nucleation [GO:0034314]	actin binding [GO:0003779]; ATP binding [GO:0005524]	ISEELSGGK	6.179999828	919.7294371	15.63704	14.98943	14.31373	0	0	15.74149	0	0	0	0	0	0	0	0	0	14.53874	15.29402	0	15.73394	15.60207	15.64324	15.36287	0	13.9869	0	0	0	0	0	0	18.61665	18.07842	16.4309	0	15.77902	14.49403	0	0	0	0	0	0	15.63963	0	0	0	0	15.53501	0	0	0	15.40988	0	0
A0A669AXE1	A0A669AXE1_ORENI	gsn	actin filament severing [GO:0051014]; actin nucleation [GO:0045010]; barbed-end actin filament capping [GO:0051016]; cell projection organization [GO:0030030]	Actin-depolymerizing factor (Brevin) (Gelsolin)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin filament binding [GO:0051015]; calcium ion binding [GO:0005509]; actin filament severing [GO:0051014]; actin nucleation [GO:0045010]; barbed-end actin filament capping [GO:0051016]; cell projection organization [GO:0030030]	actin filament binding [GO:0051015]; calcium ion binding [GO:0005509]	MDAHPPR	17.09000015	823.6332379	14.984	16.43473	14.8817	13.82906	0	0	15.47902	14.81017	13.6992	14.92493	14.39231	15.28731	14.1776	14.72829	14.8272	18.07722	13.77346	16.82381	14.46236	16.12773	16.41603	18.15585	18.51244	18.11376	14.47717	16.06553	15.77514	19.40706	20.14417	19.61811	16.94707	17.03443	16.7645	14.14855	14.12028	15.16874	15.12676	16.75626	17.24151	17.45389	18.26253	17.4626	16.46964	16.85932	15.83872	12.95947	16.51959	16.93121	14.45967	16.4866	16.33153	17.98711	17.06004	16.55399
A0A669CGK9	A0A669CGK9_ORENI	actr2	Arp2/3 complex-mediated actin nucleation [GO:0034314]	Actin-related protein 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Arp2/3 protein complex [GO:0005885]; cytoplasm [GO:0005737]	Arp2/3 protein complex [GO:0005885]; cytoplasm [GO:0005737]; actin binding [GO:0003779]; ATP binding [GO:0005524]; Arp2/3 complex-mediated actin nucleation [GO:0034314]	actin binding [GO:0003779]; ATP binding [GO:0005524]	LGVTVR	7.880000114	643.8936314	14.20019	15.18284	0	15.4171	0	16.12023	0	16.56781	0	0	0	0	15.86395	0	15.65611	11.45982	0	13.93955	0	0	0	14.36783	15.82054	14.73878	0	13.9326	0	0	13.62348	14.99366	17.49151	18.05368	15.59074	15.56142	14.88425	0	13.13653	14.73722	15.02168	13.94541	0	13.3773	0	0	13.64264	0	0	0	13.69133	14.13696	0	13.49187	15.17402	13.81332
A0A669EZ76	A0A669EZ76_ORENI		Arp2/3 complex-mediated actin nucleation [GO:0034314]	Actin-related protein 2/3 complex subunit 5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Arp2/3 protein complex [GO:0005885]; cytoplasm [GO:0005737]	Arp2/3 protein complex [GO:0005885]; cytoplasm [GO:0005737]; Arp2/3 complex-mediated actin nucleation [GO:0034314]		AGVDLLMK	9.319999695	843.9676435	14.28955	0	13.59908	13.91216	14.18972	14.02825	10.20061	12.80363	14.81572	13.38127	13.93811	16.96164	13.6782	0	11.96782	0	0	14.13501	14.25644	13.02884	5.47779	16.40135	14.80684	9.77135	14.28839	0	13.5083	9.492627	0	13.44304	13.53906	15.3453	14.55933	0	9.769347	4.903223	0	14.63327	13.75169	7.936285	14.3902	0	13.02947	14.25292	0	0	13.88669	0	0	11.59484	13.12944	13.4786	0	15.45923
I3K8U8	I3K8U8_ORENI	sub1	"regulation of transcription, DNA-templated [GO:0006355]"	Activated RNA polymerase II transcriptional coactivator p15 (SUB1 homolog)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	SGESSKPGGSSR	9.119999886	1135.555261	0	15.58029	0	0	12.39101	16.88884	0	0	0	13.95544	0	17.80878	16.60191	0	0	0	0	0	14.13717	17.15363	0	0	16.02023	13.66569	10.96356	0	14.18323	0	13.03863	14.21934	11.7477	14.64009	11.94809	14.38822	0	0	0	14.10863	12.6213	13.9413	14.22164	0	0	0	0	0	14.28114	11.31151	17.83383	0	0	10.40856	0	12.86713
I3K4U0	I3K4U0_ORENI		somatic cell DNA recombination [GO:0016444]	Activation-induced cytidine deaminase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cytidine deaminase activity [GO:0004126]; zinc ion binding [GO:0008270]; somatic cell DNA recombination [GO:0016444]	cytidine deaminase activity [GO:0004126]; zinc ion binding [GO:0008270]	MLPCVVCR	17.95000076	1050.223634	15.66744	0	0	14.12314	16.37238	13.58067	14.95021	0	0	15.13917	12.74216	0	14.92329	0	0	0	17.6472	15.15348	0	16.29045	14.48738	15.65979	14.95693	15.26733	15.89215	0	0	15.00016	0	0	0	0	0	0	16.28102	0	0	0	0	0	0	15.53073	0	0	0	16.44474	0	0	0	0	0	0	0	0
I3K8L8	I3K8L8_ORENI			Activator of transcription and developmental regulator AUTS2 a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EREHSDSWK	10.19999981	1173.798598	7.908908	13.37666	16.09697	8.984891	13.85643	12.20414	0	19.24364	0	0	11.30705	10.75153	14.57729	13.16396	9.646766	0	15.56798	16.77384	17.25039	0	0	17.73499	12.24805	13.11915	14.28729	12.37313	15.74807	14.21022	11.18686	0	0	11.01518	0	0	0	13.86071	13.26413	11.59315	16.57481	16.89792	9.988511	13.10126	13.13222	0	0	12.39334	11.16125	16.38691	13.75254	12.16629	0	0	15.20953	13.13734
A0A669F134	A0A669F134_ORENI		lipid metabolic process [GO:0006629]	"Acyl-CoA dehydrogenase family, member 8"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		acyl-CoA dehydrogenase activity [GO:0003995]; flavin adenine dinucleotide binding [GO:0050660]; lipid metabolic process [GO:0006629]	acyl-CoA dehydrogenase activity [GO:0003995]; flavin adenine dinucleotide binding [GO:0050660]	NLLSES	9.159999847	663.4598877	15.59355	14.31519	14.57683	0	0	16.61999	17.48475	16.39025	14.35386	0	14.77433	15.71112	11.99506	15.70748	15.45788	17.40071	15.26704	0	16.00246	15.83838	0	16.89764	0	15.83271	0	0	12.87356	15.68692	0	14.44647	0	19.88409	17.45888	14.31325	0	14.61093	15.34843	0	0	0	0	15.53094	13.45462	0	0	15.97459	0	17.15304	17.40003	16.89607	15.53984	17.09072	13.67906	13.56691
I3KFY7	I3KFY7_ORENI			Acyl-CoA synthetase long chain family member 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VQASLGGCVR	3.839999914	1045.449599	0	0	0	0	15.80934	14.4145	16.10225	15.39933	12.81408	0	14.89144	15.28075	13.12659	15.71016	11.9802	16.24362	0	12.27411	14.16851	0	14.17253	0	0	0	18.2355	14.80532	0	0	15.3012	14.57052	15.10147	15.63879	18.03907	14.05918	14.46683	15.27037	0	16.22816	0	16.24433	14.84446	15.73902	15.91355	16.30118	14.61041	0	14.6339	14.96864	16.07838	14.40047	15.04756	15.40055	0	14.15525
A0A669DXV6	A0A669DXV6_ORENI			Acyl-CoA synthetase long chain family member 4a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VRMMLSGGAPLSPATQR	4.269999981	1802.795763	12.0516	0	0	15.1301	15.06868	10.24463	13.06794	0	14.44658	0	15.79339	15.31969	13.43669	14.63946	0	0	0	15.97501	17.85834	0	0	17.29709	0	11.39091	0	0	0	0	15.53051	0	0	0	0	0	0	0	13.74142	15.71472	0	0	0	0	0	16.08014	0	0	0	0	20.6438	18.20706	18.92812	16.97875	17.39797	18.13958
A0A669BN65	A0A669BN65_ORENI			Acyl-CoA synthetase short chain family member 2 like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TQVYLFR	14	926.4672948	19.43948	10.82394	0	16.13747	10.94971	0	15.76973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.38232	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669CJE9	A0A669CJE9_ORENI	acox1	fatty acid beta-oxidation [GO:0006635]	Acyl-coenzyme A oxidase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	peroxisome [GO:0005777]	peroxisome [GO:0005777]; acyl-CoA oxidase activity [GO:0003997]; FAD binding [GO:0071949]; fatty acid beta-oxidation [GO:0006635]	acyl-CoA oxidase activity [GO:0003997]; FAD binding [GO:0071949]	SMIVAESAR	3.25	979.1928086	0	14.18837	13.69781	13.70974	13.40341	13.8716	14.39948	15.00506	14.85142	13.48179	16.68847	16.38813	0	0	0	0	0	0	7.959419	0	16.68483	16.12198	14.83541	11.44834	17.27925	15.73583	16.41866	0	0	14.44085	16.61731	0	17.75799	13.37351	15.24545	15.97263	0	0	0	0	0	0	18.70596	15.40515	16.29138	16.44952	0	0	18.4202	18.37937	18.23124	0	0	0
A0A669CEG6	A0A669CEG6_ORENI			Adducin 3 (gamma) b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]	cytoskeleton [GO:0005856]		SKNMSPDLR	11.80000019	1048.40598	12.5385	0	12.60101	12.01266	12.26918	12.27933	12.76061	13.7544	0	0	15.69886	14.68357	10.24467	11.26641	12.41641	0	7.937189	11.15129	0	14.4912	0	17.71303	0	13.89379	12.51672	13.39843	11.65168	0	12.14886	10.56806	0	17.85327	13.74194	13.57542	15.1338	0	13.11015	13.42399	8.0305	14.03982	14.00455	12.87204	12.35091	14.81818	14.09382	0	11.17111	15.60671	13.4417	13.49944	12.84681	17.57648	15.309	14.44645
A0A669EZN5	A0A669EZN5_ORENI	MUTYH	base-excision repair [GO:0006284]	Adenine DNA glycosylase (EC 3.2.2.31)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"4 iron, 4 sulfur cluster binding [GO:0051539]; DNA binding [GO:0003677]; hydrolase activity, acting on glycosyl bonds [GO:0016798]; metal ion binding [GO:0046872]; base-excision repair [GO:0006284]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; DNA binding [GO:0003677]; hydrolase activity, acting on glycosyl bonds [GO:0016798]; metal ion binding [GO:0046872]"	VVSELKGQMPR	1.429999948	1242.985382	8.762775	12.56264	13.04421	12.90889	0	13.04859	0	14.82725	13.09839	14.99525	14.86437	11.21042	0	12.14609	10.5777	12.79745	12.07364	14.30041	12.887	14.13942	12.76706	11.71849	9.050263	13.68337	14.17788	0	11.83994	7.739141	13.52849	10.15692	16.42886	20.28736	14.10708	12.87796	0	0	12.76004	14.47621	0	0	0	0	0	13.31385	0	0	10.43789	13.15477	0	13.52819	0	0	0	0
I3K4W0	I3K4W0_ORENI			Adenosine A2b receptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; G protein-coupled adenosine receptor activity [GO:0001609]	G protein-coupled adenosine receptor activity [GO:0001609]	EIRAAK	7.599999905	686.6051573	13.98776	0	14.64168	15.48701	0	14.4317	0	0	14.77174	0	15.99303	0	14.11325	0	0	14.09294	14.0176	13.01197	15.26493	15.80836	16.69184	16.07103	14.90724	0	14.02686	15.04117	15.21152	14.45888	14.79223	7.81046	19.89324	0	16.50994	15.15845	15.19327	14.67534	14.11024	13.81995	13.68881	0	0	12.64419	13.22513	15.30386	13.02187	13.63515	13.77454	15.17194	0	15.29938	12.17134	13.24868	15.15397	15.76051
A0A669C4F4	A0A669C4F4_ORENI	ada	purine ribonucleoside monophosphate biosynthetic process [GO:0009168]	Adenosine deaminase (EC 3.5.4.4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell junction [GO:0030054]; cytoplasmic vesicle lumen [GO:0060205]; plasma membrane [GO:0005886]	cell junction [GO:0030054]; cytoplasmic vesicle lumen [GO:0060205]; plasma membrane [GO:0005886]; deaminase activity [GO:0019239]; purine ribonucleoside monophosphate biosynthetic process [GO:0009168]	deaminase activity [GO:0019239]	VGHGYNTLEDRDLYEK	3.059999943	1908.977651	13.2217	12.01945	14.3925	13.73078	13.70715	13.88687	0	0	12.66815	0	11.77456	0	14.41264	13.97892	0	13.54411	12.31786	0	13.74952	14.44926	0	13.39213	0	15.57289	0	14.39317	0	12.77203	12.11681	0	0	0	13.59967	0	0	0	0	0	0	10.30882	0	11.43588	0	0	14.41789	0	13.79357	0	0	0	14.83269	14.62669	15.78492	0
A0A669DWR3	A0A669DWR3_ORENI	LOC100693415	AMP salvage [GO:0044209]; purine ribonucleoside salvage [GO:0006166]	Adenosine kinase (EC 2.7.1.20)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		adenosine kinase activity [GO:0004001]; AMP salvage [GO:0044209]; purine ribonucleoside salvage [GO:0006166]	adenosine kinase activity [GO:0004001]	LTGVSNHK	5.539999962	854.7941639	10.95486	12.27083	12.43912	13.15633	12.98911	11.17846	15.31125	13.25356	12.75438	15.78492	15.14743	14.79091	13.60484	0	15.59741	14.54161	14.7118	13.72595	13.66523	14.91694	0	0	13.2043	14.37561	0	13.83576	14.64267	0	14.02765	11.55467	13.94645	0	14.36139	12.96528	10.41754	13.3526	11.61273	10.51746	0	13.41058	14.33715	14.40587	0	13.91875	0	12.05179	15.33821	14.6146	15.31843	0	13.19024	12.8088	0	15.40453
A0A669BCH4	A0A669BCH4_ORENI	LOC100698466		Adenosine receptor A1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; G protein-coupled adenosine receptor activity [GO:0001609]	G protein-coupled adenosine receptor activity [GO:0001609]	MTVDAYK	9.199999809	827.9628786	0	0	0	16.15858	15.75319	12.04624	15.63896	15.16797	17.09026	16.27348	16.43385	16.13029	16.34874	15.33683	14.86516	13.52553	16.03066	0	0	15.69742	14.14342	15.99875	0	16.21367	15.66441	0	16.71338	18.4734	13.69532	15.51402	17.64374	18.42878	0	16.82869	15.00022	15.53828	0	10.28253	13.79128	16.72675	12.63422	15.52519	16.43414	15.17655	15.93879	16.33858	15.23983	15.30057	0	0	0	18.78899	20.57113	17.29333
I3JCC9	I3JCC9_ORENI	ADCY9	cyclic nucleotide biosynthetic process [GO:0009190]; intracellular signal transduction [GO:0035556]	Adenylate cyclase 9	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; phosphorus-oxygen lyase activity [GO:0016849]; cyclic nucleotide biosynthetic process [GO:0009190]; intracellular signal transduction [GO:0035556]	phosphorus-oxygen lyase activity [GO:0016849]	GKCDS	6.960000038	566.7195935	16.34283	16.18574	15.38284	0	16.00211	16.297	17.64103	15.90701	15.92992	0	16.37732	15.96444	15.63104	14.85869	16.89884	16.0466	16.89222	14.54114	14.87992	16.68392	0	15.25668	15.61625	0	0	15.31127	19.40784	15.29148	0	15.9918	19.57166	0	16.88479	0	15.28651	14.99763	15.13406	16.31533	16.49095	17.35083	14.9747	15.75658	16.44054	17.9429	16.99892	15.61382	16.34707	17.58226	16.59068	16.00078	0	0	16.88765	18.62031
A0A669F4N8	A0A669F4N8_ORENI	adcy7	cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556]	Adenylate cyclase (EC 4.6.1.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556]	adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	LPLATITTAVIIIMAVFNLVR	6.349999905	2285.875707	15.52306	15.42018	15.68379	0	15.558	14.64644	0	0	0	14.09613	0	12.1705	13.83987	13.90812	0	0	0	0	0	0	0	0	14.62068	0	0	12.04751	15.46052	17.85604	17.80044	0	0	0	0	0	14.69376	0	0	0	0	0	0	11.00739	16.85154	0	0	17.37075	15.70105	16.04343	15.46128	14.38549	0	0	16.34643	0
A0A669CF34	A0A669CF34_ORENI	LOC100702846	cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556]	Adenylate cyclase type 1 (EC 4.6.1.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556]	adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	YLPSVPTAVV	15.47999954	1044.931901	0	0	0	15.46233	0	15.09242	0	13.55636	16.06208	15.38834	0	15.17953	14.68407	12.99555	15.65903	0	15.19284	15.64033	15.26358	15.40448	11.7724	0	0	12.73939	0	11.96054	0	0	0	14.89964	17.7712	17.21914	18.07638	15.53282	0	16.03814	0	0	15.34762	0	0	0	15.83609	15.31994	15.44558	15.61561	15.45425	14.8004	14.88094	11.66988	15.39889	15.45542	13.81666	14.71641
A0A669BBX5	A0A669BBX5_ORENI	adcy2	cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556]	Adenylate cyclase type 2 (EC 4.6.1.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556]	adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	METTGLLGK	10.43000031	965.1728375	16.00464	13.10659	13.03611	15.37931	14.50371	14.26134	0	14.95825	14.61587	15.04026	13.96303	14.97638	14.82347	14.61875	13.39338	0	14.08833	14.58655	0	16.77862	18.45465	17.24062	15.91162	16.27534	0	14.89651	0	0	15.12215	0	0	14.59193	0	0	17.14571	15.55492	0	15.10905	13.46127	16.21114	14.63258	15.22292	14.27384	14.75373	15.01066	0	0	16.89019	15.25616	14.77946	16.00444	14.60477	15.13508	0
A0A669B9W5	A0A669B9W5_ORENI		cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556]	Adenylate cyclase type 3 (EC 4.6.1.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556]	adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	DDHAACSIMMGLAMVEAISYVR	5.769999981	2456.197781	0	0	0	13.82491	9.948813	12.51745	0	0	14.97399	0	0	0	12.92325	10.19809	13.01109	10.77852	12.11302	0	0	12.67292	0	17.05645	0	19.17266	13.72178	11.34531	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.29515	0	18.39647	0	10.69903
A0A669C0R2	A0A669C0R2_ORENI	adcy8	cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556]	Adenylate cyclase type 8 (EC 4.6.1.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556]	adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	IGMTHGSVVAGVIGAK	5.28000021	1511.901704	15.67987	13.9353	0	0	0	16.72683	0	0	18.55234	17.199	18.40968	0	16.42319	0	14.12239	17.47223	0	0	14.82051	19.38356	0	0	0	0	19.31434	16.19379	0	0	0	0	0	0	0	16.64178	0	15.1872	0	14.88831	14.47326	16.48655	15.28102	0	0	0	15.23681	0	0	0	11.37683	0	13.74516	17.49607	0	17.1415
I3K722	I3K722_ORENI		nucleobase-containing compound metabolic process [GO:0006139]	Adenylate kinase 9	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; nucleobase-containing compound kinase activity [GO:0019205]; nucleobase-containing compound metabolic process [GO:0006139]	ATP binding [GO:0005524]; nucleobase-containing compound kinase activity [GO:0019205]	LNRFLGLR	3.549999952	988.7786259	14.1674	13.62912	13.75026	13.91903	11.83928	0	14.37538	10.80753	12.90931	14.53966	9.095414	0	14.68511	14.60652	13.84234	0	15.46169	14.09664	13.36927	15.72386	11.89642	14.52772	14.80782	12.23808	0	15.74224	0	11.29667	15.26326	0	0	0	16.27971	0	0	14.44694	0	0	0	0	14.58888	15.14919	13.79494	14.10643	0	14.54333	0	12.92553	0	0	0	0	0	13.76262
I3JPG7	I3JPG7_ORENI		'de novo' AMP biosynthetic process [GO:0044208]; 'de novo' IMP biosynthetic process [GO:0006189]	Adenylosuccinase (EC 4.3.2.2) (Adenylosuccinate lyase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"(S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate AMP-lyase (fumarate-forming) activity [GO:0070626]; N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity [GO:0004018]; 'de novo' AMP biosynthetic process [GO:0044208]; 'de novo' IMP biosynthetic process [GO:0006189]"	"(S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate AMP-lyase (fumarate-forming) activity [GO:0070626]; N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity [GO:0004018]"	VIETRIHNDLPFMATENIIMVMNK	2.690000057	2861.802906	15.48101	12.89873	0	14.41009	0	11.20762	14.48417	14.31514	9.327261	14.99491	13.84035	13.54561	15.67118	16.79499	0	0	0	19.80515	17.30644	0	16.40731	0	16.86245	0	0	0	0	0	0	16.68424	0	0	16.67681	0	17.05696	16.27096	0	16.19438	0	16.54249	14.95483	0	0	15.85221	0	17.12614	15.99769	15.97	0	16.02484	0	0	0	0
A0A669CEV5	A0A669CEV5_ORENI	LOC109194363	'de novo' AMP biosynthetic process [GO:0044208]; 'de novo' IMP biosynthetic process [GO:0006189]	Adenylosuccinate lyase (ASL) (EC 4.3.2.2) (Adenylosuccinase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"(S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate AMP-lyase (fumarate-forming) activity [GO:0070626]; N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity [GO:0004018]; 'de novo' AMP biosynthetic process [GO:0044208]; 'de novo' IMP biosynthetic process [GO:0006189]"	"(S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate AMP-lyase (fumarate-forming) activity [GO:0070626]; N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity [GO:0004018]"	WGLNSTMAGAEEMNK	14.64000034	1639.601719	0	16.24373	0	17.80053	0	20.21007	0	0	0	0	19.90963	21.60629	15.79521	14.42975	19.80529	9.254245	16.21012	17.94613	16.64224	14.9485	13.31873	15.11094	15.63746	0	14.98324	16.68534	0	16.42684	16.636	0	0	0	0	20.38529	20.58006	0	17.618	0	0	0	17.96034	0	21.18158	0	19.90386	19.67931	18.95325	18.12085	15.59927	15.65868	0	17.38038	0	21.0531
A0A669EW17	A0A669EW17_ORENI	mocs3 MOCS3 UBA4	Mo-molybdopterin cofactor biosynthetic process [GO:0006777]; tRNA wobble position uridine thiolation [GO:0002143]	Adenylyltransferase and sulfurtransferase MOCS3 (Molybdenum cofactor synthesis protein 3) [Includes: Molybdopterin-synthase adenylyltransferase (EC 2.7.7.80) (Adenylyltransferase MOCS3) (Sulfur carrier protein MOCS2A adenylyltransferase); Molybdopterin-synthase sulfurtransferase (EC 2.8.1.11) (Sulfurtransferase MOCS3) (Sulfur carrier protein MOCS2A sulfurtransferase)]	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]	cytosol [GO:0005829]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; molybdopterin-synthase adenylyltransferase activity [GO:0061605]; molybdopterin-synthase sulfurtransferase activity [GO:0061604]; thiosulfate sulfurtransferase activity [GO:0004792]; ubiquitin-like modifier activating enzyme activity [GO:0008641]; Mo-molybdopterin cofactor biosynthetic process [GO:0006777]; tRNA wobble position uridine thiolation [GO:0002143]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; molybdopterin-synthase adenylyltransferase activity [GO:0061605]; molybdopterin-synthase sulfurtransferase activity [GO:0061604]; thiosulfate sulfurtransferase activity [GO:0004792]; ubiquitin-like modifier activating enzyme activity [GO:0008641]	HQMAVSR	8.949999809	828.6252344	14.54689	0	0	0	0	0	0	14.25564	15.78334	0	18.11038	0	17.77869	18.532	19.6834	0	0	17.11567	0	0	0	0	18.68742	0	0	0	19.27799	18.80685	0	18.07226	16.4059	18.87868	0	0	0	0	0	0	0	16.17365	0	0	17.15817	0	15.48376	18.0392	0	0	18.13915	0	0	0	0	0
A0A669CWY8	A0A669CWY8_ORENI		cell surface receptor signaling pathway [GO:0007166]	Adhesion G protein-coupled receptor A3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; G protein-coupled receptor activity [GO:0004930]; cell surface receptor signaling pathway [GO:0007166]	G protein-coupled receptor activity [GO:0004930]	THRASR	11.44999981	727.2542619	0	0	0	14.40141	16.03964	15.15184	14.74932	16.48361	17.22098	16.58977	16.59131	15.76383	15.78612	0	15.37856	15.88117	16.80896	14.96555	15.41303	16.55177	15.52014	16.29655	15.5282	15.98784	16.42972	16.76716	0	15.13663	16.89676	16.92512	18.46142	18.13253	17.11161	0	15.34033	15.25093	15.66117	14.3213	15.09206	14.83459	15.96471	0	15.80124	14.3715	15.28289	16.409	16.57767	0	16.66113	16.45111	0	0	17.57467	15.75555
A0A669DDQ1	A0A669DDQ1_ORENI	ADGRL3	cell surface receptor signaling pathway [GO:0007166]	Adhesion G protein-coupled receptor L3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	axon [GO:0030424]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	axon [GO:0030424]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; carbohydrate binding [GO:0030246]; G protein-coupled receptor activity [GO:0004930]; cell surface receptor signaling pathway [GO:0007166]	carbohydrate binding [GO:0030246]; G protein-coupled receptor activity [GO:0004930]	SSFLIFHLCEIAFVK	21.29000092	1810.331433	20.04156	0	0	0	0	19.60845	18.47433	0	19.43704	18.83285	18.79511	0	0	0	0	19.11617	0	0	0	18.05576	0	0	0	12.9602	14.06468	14.09428	11.3296	0	17.63674	18.09994	13.67394	0	14.28353	0	0	0	0	0	0	0	0	10.87439	13.52102	17.94541	17.39705	0	0	10.69593	17.81267	16.14314	15.84536	0	19.42191	0
A0A669D6G0	A0A669D6G0_ORENI	AHCYL2	one-carbon metabolic process [GO:0006730]	AdoHcyase_NAD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		adenosylhomocysteinase activity [GO:0004013]; one-carbon metabolic process [GO:0006730]	adenosylhomocysteinase activity [GO:0004013]	VNTPASTLLK	9.220000267	1043.094715	0	15.48831	0	0	15.14646	0	13.6547	15.42409	0	15.28976	0	12.70535	0	11.34509	16.03815	0	0	13.67906	15.68708	0	14.63171	0	0	0	0	0	0	0	17.90451	0	0	0	0	0	0	0	0	0	15.18434	0	0	0	17.35256	0	0	0	0	0	15.56851	0	0	14.96818	6.819181	13.43811
A0A669D305	A0A669D305_ORENI		cell adhesion [GO:0007155]; signal transduction [GO:0007165]	"Afadin, adherens junction formation factor a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cell adhesion [GO:0007155]; signal transduction [GO:0007165]		AGSGFNSYTGNSSGVVGTGEVYK	10.21000004	2238.199796	13.2824	14.5066	0	11.71098	9.256359	11.71646	0	0	11.5451	0	0	0	0	11.39191	14.45052	17.91483	13.52309	15.84922	0	14.23682	11.73602	12.05299	11.40442	13.01532	14.6476	13.47343	14.23267	13.39984	7.875952	17.36997	0	13.39213	0	0	0	11.4567	0	9.242158	11.43925	11.74448	12.93624	0	16.65515	0	0	0	12.93624	12.2419	13.7526	0	0	11.77391	0	0
I3KEY5	I3KEY5_ORENI		cell adhesion [GO:0007155]	Aggrecan b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; hyaluronic acid binding [GO:0005540]; cell adhesion [GO:0007155]	hyaluronic acid binding [GO:0005540]	DMQNVFR	11.09000015	908.2618593	13.68334	12.75469	14.12446	13.54088	12.68668	15.26706	14.63452	13.63266	0	13.84397	14.68878	13.96497	0	14.94912	15.34147	11.33283	15.11537	14.48538	14.17757	13.09465	14.31796	14.2451	0	15.08329	14.49139	0	0	15.10428	14.10121	15.91329	15.69567	15.43188	13.97545	14.51423	15.30838	16.23547	14.28216	0	14.65253	15.56655	14.84884	14.01035	13.38814	12.03137	0	14.76126	13.07712	0	15.35064	13.56475	0	14.90813	15.49701	12.86015
A0A669EX68	A0A669EX68_ORENI	agrn	cell differentiation [GO:0030154]; G protein-coupled acetylcholine receptor signaling pathway [GO:0007213]; multicellular organism development [GO:0007275]; receptor clustering [GO:0043113]	Agrin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	plasma membrane [GO:0005886]; synapse [GO:0045202]	plasma membrane [GO:0005886]; synapse [GO:0045202]; calcium ion binding [GO:0005509]; laminin binding [GO:0043236]; cell differentiation [GO:0030154]; G protein-coupled acetylcholine receptor signaling pathway [GO:0007213]; multicellular organism development [GO:0007275]; receptor clustering [GO:0043113]	calcium ion binding [GO:0005509]; laminin binding [GO:0043236]	FTVEDIVGALLK	4.75	1305.338366	0	0	16.01992	17.04554	14.98349	0	16.02769	15.37035	0	15.52354	15.74829	14.40608	0	16.6832	11.73474	0	0	0	18.74239	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DXW6	A0A669DXW6_ORENI			Aha1_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATPase activator activity [GO:0001671]; chaperone binding [GO:0051087]; Hsp90 protein binding [GO:0051879]	ATPase activator activity [GO:0001671]; chaperone binding [GO:0051087]; Hsp90 protein binding [GO:0051879]	RVLGEYVR	7.409999847	990.6263636	12.60896	12.56651	13.60669	15.26966	13.55193	13.22081	15.69156	14.04897	10.17096	10.87829	12.40573	14.69809	13.90446	12.06854	15.90186	13.64729	12.40249	0	14.88396	12.19799	13.46089	14.41046	14.03193	0	0	0	13.64261	0	9.333304	0	18.15826	17.45012	0	14.47698	0	0	0	12.89986	0	0	0	0	0	0	0	0	0	14.51365	0	0	0	0	0	0
A0A669BX96	A0A669BX96_ORENI			Alanine--glyoxylate aminotransferase 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		pyridoxal phosphate binding [GO:0030170]; transaminase activity [GO:0008483]	pyridoxal phosphate binding [GO:0030170]; transaminase activity [GO:0008483]	SKEQMMEIR	2.349999905	1167.493942	10.75173	12.40611	11.9199	10.68704	12.25501	13.12229	16.80116	16.49184	0	0	14.60366	0	0	14.56369	12.93689	13.81022	11.65469	18.12226	16.49863	11.33481	14.12071	15.95061	0	14.81334	9.905069	8.990796	11.27434	12.73693	0	18.24985	15.75144	14.06091	13.63681	13.70043	17.11693	15.07227	12.60416	12.28482	13.15553	12.18792	13.01024	12.76395	17.08492	11.03729	0	13.47323	12.33029	8.66827	13.15117	13.20741	13.82421	14.21525	0	0
A0A669C5X0	A0A669C5X0_ORENI		tRNA 5'-leader removal [GO:0001682]	Alba domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ribonuclease MRP complex [GO:0000172]	ribonuclease MRP complex [GO:0000172]; nucleic acid binding [GO:0003676]; tRNA 5'-leader removal [GO:0001682]	nucleic acid binding [GO:0003676]	VKGGSK	1.919999957	574.5305519	0	15.06033	0	12.7052	15.30955	14.68768	0	14.58028	12.87864	0	14.29942	15.16868	14.27378	0	13.79587	14.82713	15.53868	13.90055	15.5528	15.04167	15.69543	15.35345	16.23067	0	0	15.83288	0	0	15.26559	0	15.90642	16.91099	17.0226	0	14.70208	14.96239	15.29108	15.04354	14.75413	15.41105	0	15.18763	0	0	15.70693	0	0	0	0	0	15.29497	0	0	15.47206
A0A669D5M0	A0A669D5M0_ORENI	akr1a1	aldehyde catabolic process [GO:0046185]	Alcohol dehydrogenase (NADP(+)) (EC 1.1.1.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		alcohol dehydrogenase (NADP+) activity [GO:0008106]; D-threo-aldose 1-dehydrogenase activity [GO:0047834]; aldehyde catabolic process [GO:0046185]	alcohol dehydrogenase (NADP+) activity [GO:0008106]; D-threo-aldose 1-dehydrogenase activity [GO:0047834]	GVVTIPK	5.199999809	714.2296393	0	0	0	0	0	14.63977	12.83956	15.81818	0	15.66521	10.27394	15.87451	16.93328	14.06685	0	13.45426	15.51132	15.07598	16.48625	0	0	16.45336	17.69614	16.69499	13.9157	14.14865	15.63972	16.10526	14.17756	12.99037	0	0	11.75008	15.46512	15.12571	14.92247	0	14.60103	0	13.51121	10.14126	0	0	0	12.85742	0	13.46828	13.20265	0	16.5072	0	0	16.60207	0
A0A669F8H2	A0A669F8H2_ORENI	LOC100707441		Aldedh domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]"	"oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]"	EEIFGPVMSR	7.710000038	1177.20996	0	14.12307	12.3411	0	13.66791	14.63729	10.33585	10.83657	12.87452	13.79623	10.97834	0	10.63735	13.65689	14.02859	11.89945	13.13625	12.78383	10.40136	17.50687	16.73669	0	0	0	16.16185	13.25656	15.57064	0	14.48419	0	11.64237	0	12.50058	10.48839	0	0	0	11.5118	12.6384	0	13.25854	14.53426	10.18169	13.23781	12.81279	0	13.78112	12.95427	17.7468	11.69463	12.2964	11.89836	12.15888	0
A0A669E3A3	A0A669E3A3_ORENI			"Aldehyde dehydrogenase 7 family, member A1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]"	"oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]"	LSTSMSSLLINQPK	15.82999992	1535.396453	11.14422	10.28091	14.77482	13.35848	14.2147	13.59326	10.91023	0	13.16788	9.780334	11.93045	14.85817	13.48629	17.88494	18.13447	0	17.57735	0	0	0	0	0	0	11.18981	0	0	18.23677	0	0	0	15.2308	0	16.113	13.49075	15.94222	0	13.66896	0	0	0	0	0	14.26903	0	0	0	0	0	15.25308	0	14.81066	16.87232	20.09898	0
A0A669BZG9	A0A669BZG9_ORENI	aldh4a1	proline catabolic process to glutamate [GO:0010133]	"Aldehyde dehydrogenase family 4 member A1 (EC 1.2.1.88) (Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial) (L-glutamate gamma-semialdehyde dehydrogenase)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"1-pyrroline-5-carboxylate dehydrogenase activity [GO:0003842]; oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]; proline catabolic process to glutamate [GO:0010133]"	"1-pyrroline-5-carboxylate dehydrogenase activity [GO:0003842]; oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]"	CSACSRMYVPDSLWPQIK	7.409999847	2209.832663	6.216433	0	0	11.30344	12.55105	9.590672	0	0	11.69674	10.08755	14.5098	0	0	0	13.60883	0	8.203648	15.17278	14.92233	0	14.04693	15.52273	12.24618	15.81742	15.24957	0	0	12.85139	14.85494	13.40952	0	0	0	0	0	0	17.29459	0	0	0	0	0	11.8603	0	14.36067	12.19868	0	0	0	19.38652	0	11.91552	0	16.47255
A0A669BNH0	A0A669BNH0_ORENI	LOC109194203	bile acid biosynthetic process [GO:0006699]	Aldo_ket_red domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		D-threo-aldose 1-dehydrogenase activity [GO:0047834]; delta4-3-oxosteroid 5beta-reductase activity [GO:0047787]; bile acid biosynthetic process [GO:0006699]	delta4-3-oxosteroid 5beta-reductase activity [GO:0047787]; D-threo-aldose 1-dehydrogenase activity [GO:0047834]	TTAQVCLR	6.940000057	947.9344456	15.15608	13.84262	0	0	14.94601	14.50474	0	0	12.42435	14.58146	0	12.56577	17.8062	0	12.20909	0	14.1974	10.16602	0	8.479663	0	14.40232	0	15.98266	0	15.47909	15.28935	11.30907	0	0	14.19131	0	0	11.73522	14.48976	15.14888	14.20068	0	0	0	0	13.59947	0	0	0	14.30716	0	0	14.26378	0	12.28591	0	0	0
A0A669BKQ3	A0A669BKQ3_ORENI	add1		Aldolase_II domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]	cytoskeleton [GO:0005856]		GGEGEEQSNMK	4.739999771	1178.694299	13.28699	0	12.93194	15.04814	11.01244	6.648563	13.90588	14.2551	14.22768	14.04648	15.16758	14.32138	13.11643	10.11511	10.84895	0	11.97335	9.523994	11.99486	16.91607	16.78448	0	17.8234	12.6648	12.80728	14.04668	11.36944	12.2621	5.962659	6.938354	17.48835	12.75551	14.38317	11.79819	0	13.11229	0	8.096482	12.258	10.18505	0	0	5.641833	13.07826	10.98146	0	10.72147	10.71332	17.99167	12.14465	0	0	0	10.91317
A0A669EK32	A0A669EK32_ORENI	acer2	ceramide metabolic process [GO:0006672]	Alkaline ceramidase (EC 3.5.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ceramidase activity [GO:0102121]; N-acylsphingosine amidohydrolase activity [GO:0017040]; ceramide metabolic process [GO:0006672]	ceramidase activity [GO:0102121]; N-acylsphingosine amidohydrolase activity [GO:0017040]	AARDSAVGQPGNAATHR	6.789999962	1679.810871	16.07461	0	0	17.85849	0	0	0	0	15.47373	16.73532	0	17.26209	0	16.66812	16.17954	0	16.70341	0	0	15.73343	15.81139	15.83786	14.7695	17.3337	0	15.82012	15.59324	0	16.94144	0	0	17.4298	18.68437	16.10906	13.24623	16.63341	16.21873	15.41939	0	0	0	0	17.33708	13.40976	16.90643	16.77332	0	16.16218	0	15.64849	0	0	16.86105	0
A0A669B9L8	A0A669B9L8_ORENI			Alkaline phosphatase (EC 3.1.3.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	anchored component of membrane [GO:0031225]; plasma membrane [GO:0005886]	anchored component of membrane [GO:0031225]; plasma membrane [GO:0005886]; alkaline phosphatase activity [GO:0004035]	alkaline phosphatase activity [GO:0004035]	MDRYQSALK	10.84000015	1112.193163	13.54441	15.66158	14.13916	16.33589	16.7515	12.86887	12.52532	15.70599	14.07883	0	0	17.00889	14.47926	0	16.35427	0	13.60233	13.37967	12.12666	14.31925	13.32935	15.13443	14.25466	0	17.53369	14.66445	0	15.09393	16.41228	0	0	15.55099	16.06356	14.97731	0	0	0	0	0	16.40384	0	0	0	0	13.22136	0	0	0	13.51701	15.22958	15.8558	14.38853	0	0
I3KT23	I3KT23_ORENI	LOC100690103	allantoin catabolic process [GO:0000256]	Allantoinase (EC 3.5.2.5)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		allantoinase activity [GO:0004038]; cobalt ion binding [GO:0050897]; zinc ion binding [GO:0008270]; allantoin catabolic process [GO:0000256]	allantoinase activity [GO:0004038]; cobalt ion binding [GO:0050897]; zinc ion binding [GO:0008270]	NKLTPYLGLK	4.210000038	1147.121024	14.17956	0	10.80113	17.79671	14.33977	15.17173	13.90167	14.81926	16.17863	15.9796	11.5342	14.58486	6.88232	14.86837	0	0	0	16.71134	13.2616	0	15.99125	19.91549	0	0	15.08293	15.62529	15.02903	12.45658	0	0	0	0	0	14.65424	0	15.4803	0	0	0	15.0074	11.3484	0	0	17.19812	0	16.02106	15.91082	16.26448	12.46758	0	14.09539	14.42992	16.27623	0
A0A669D2Z0	A0A669D2Z0_ORENI		brain morphogenesis [GO:0048854]; cell adhesion [GO:0007155]; cell differentiation [GO:0030154]	Alpha N-catenin (Catenin alpha-2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	actin cytoskeleton [GO:0015629]; adherens junction [GO:0005912]; axon [GO:0030424]; cytoplasm [GO:0005737]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	actin cytoskeleton [GO:0015629]; adherens junction [GO:0005912]; axon [GO:0030424]; cytoplasm [GO:0005737]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; structural molecule activity [GO:0005198]; brain morphogenesis [GO:0048854]; cell adhesion [GO:0007155]; cell differentiation [GO:0030154]	actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; structural molecule activity [GO:0005198]	LNYVAARR	12.35000038	962.9403756	14.37056	14.07029	0	11.96163	10.46607	14.0401	0	0	15.26959	0	0	0	14.90814	0	0	0	0	0	0	0	0	0	16.39219	15.29367	0	0	0	16.02074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.92445	16.57034	0	15.11053	13.65148	0	13.9595	0	0	13.89778	0
I3JKF5	I3JKF5_ORENI	alg8	oligosaccharide-lipid intermediate biosynthetic process [GO:0006490]; protein glycosylation [GO:0006486]	"Alpha-1,3-glucosyltransferase (EC 2.4.1.-)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	"endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase activity [GO:0042283]; oligosaccharide-lipid intermediate biosynthetic process [GO:0006490]; protein glycosylation [GO:0006486]"	"dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase activity [GO:0042283]"	AILIAILPLSILAVESR	4.789999962	1786.1214	13.21778	13.23064	0	13.70312	13.67581	14.04533	15.78149	15.13893	15.19116	15.73282	11.96577	0	0	0	14.90466	13.98241	13.77074	13.63237	13.73081	0	14.97983	0	15.30268	14.06723	14.9067	13.93202	14.12983	12.48922	15.51637	14.8406	15.13197	0	6.526835	12.76084	0	13.24331	0	0	0	14.40923	14.14842	0	14.54084	0	14.99013	14.53014	13.99569	0	13.41071	15.32794	0	0	0	15.06926
A0A669D7S0	A0A669D7S0_ORENI	pygl	glycogen metabolic process [GO:0005977]	"Alpha-1,4 glucan phosphorylase (EC 2.4.1.1)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		glycogen phosphorylase activity [GO:0008184]; linear malto-oligosaccharide phosphorylase activity [GO:0102250]; pyridoxal phosphate binding [GO:0030170]; SHG alpha-glucan phosphorylase activity [GO:0102499]; glycogen metabolic process [GO:0005977]	glycogen phosphorylase activity [GO:0008184]; linear malto-oligosaccharide phosphorylase activity [GO:0102250]; pyridoxal phosphate binding [GO:0030170]; SHG alpha-glucan phosphorylase activity [GO:0102499]	KGVPGR	3.789999962	612.8911926	16.07559	15.87201	13.60304	0	0	16.15333	16.33723	0	12.65522	16.41886	17.10727	15.77601	15.49574	13.20028	14.64799	17.8182	16.318	15.25203	16.9634	0	16.19991	16.44793	0	0	0	16.47345	18.32861	15.50134	15.81806	16.06574	16.3784	17.0575	0	0	0	0	14.67036	0	17.63791	0	0	0	0	0	17.68589	16.41562	15.75059	0	0	17.37757	0	17.29016	16.46415	16.89875
I3KYN0	I3KYN0_ORENI	LOC100711814	oligosaccharide biosynthetic process [GO:0009312]; protein glycosylation [GO:0006486]	"Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase (EC 2.4.1.143) (Beta-1,2-N-acetylglucosaminyltransferase II) (GlcNAc-T II) (Mannoside acetylglucosaminyltransferase 2) (N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi membrane [GO:0000139]; Golgi stack [GO:0005795]; integral component of membrane [GO:0016021]	"Golgi membrane [GO:0000139]; Golgi stack [GO:0005795]; integral component of membrane [GO:0016021]; alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity [GO:0008455]; metal ion binding [GO:0046872]; oligosaccharide biosynthetic process [GO:0009312]; protein glycosylation [GO:0006486]"	"alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity [GO:0008455]; metal ion binding [GO:0046872]"	NGGWGDIR	12.57999992	874.7659544	0	0	10.92353	11.74405	11.78378	13.65218	13.0393	13.39566	14.14448	0	14.31699	0	0	14.37984	0	13.04642	15.16418	0	0	0	11.31049	11.31087	10.44373	0	0	0	0	0	0	0	0	0	0	15.81218	11.13405	0	0	0	0	0	0	0	0	14.77994	0	0	11.89974	0	0	0	0	0	10.47063	0
A0A669AW71	A0A669AW71_ORENI		protein N-linked glycosylation [GO:0006487]	"Alpha-1,6-mannosyl-glycoprotein 6-beta-N-acetylglucosaminyltransferase (EC 2.4.1.155)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	"extracellular region [GO:0005576]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity [GO:0030144]; protein N-linked glycosylation [GO:0006487]"	"alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity [GO:0030144]"	DYMKGQVALCK	4.570000172	1329.030573	14.15058	12.39646	0	12.19887	12.63311	0	14.49453	13.32186	14.11844	16.41189	14.08574	13.9306	0	13.23688	15.55194	13.21628	12.87662	13.73662	11.92594	14.10869	14.72929	14.58986	11.3039	10.78172	0	12.02012	13.13007	13.84418	14.38445	13.45134	17.1848	15.91548	0	14.43237	13.36651	11.15898	13.32759	13.54303	15.07202	14.25127	10.81892	13.21552	15.13605	13.21174	13.64999	0	12.96703	9.629115	0	15.15359	13.36999	13.6088	14.79898	11.93644
A0A669CJ04	A0A669CJ04_ORENI	adra1b	regulation of cardiac muscle contraction [GO:0055117]; regulation of vasoconstriction [GO:0019229]	Alpha-1B adrenergic receptor (Alpha-1B adrenoreceptor)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	caveola [GO:0005901]; cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]	caveola [GO:0005901]; cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; alpha1-adrenergic receptor activity [GO:0004937]; regulation of cardiac muscle contraction [GO:0055117]; regulation of vasoconstriction [GO:0019229]	alpha1-adrenergic receptor activity [GO:0004937]	NLEAGVMR	10.05000019	903.06479	14.9055	14.02929	12.46959	0	10.67601	11.98571	16.56186	14.47673	14.47296	14.26304	15.94695	16.1798	14.13476	0	14.66844	10.42797	15.6986	14.65337	14.44244	0	0	16.38762	14.3502	17.44786	14.34265	15.01865	0	13.87701	15.46296	15.97185	0	17.00816	16.92612	14.45542	14.8209	14.77585	15.50012	0	14.00383	15.89413	0	0	16.07999	15.71038	0	0	15.22494	14.65895	13.24916	0	0	0	0	14.39212
I3KIJ6	I3KIJ6_ORENI	ca8	cerebellum development [GO:0021549]; chordate embryonic development [GO:0043009]; swimming behavior [GO:0036269]	Alpha-carbonic anhydrase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]; cerebellum development [GO:0021549]; chordate embryonic development [GO:0043009]; swimming behavior [GO:0036269]	carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]	IILKSK	26.64999962	701.1888186	16.86405	17.24993	17.17824	16.99679	16.45459	16.70785	16.88782	16.48689	16.76618	0	14.63827	0	16.58752	17.15965	16.65512	16.85895	12.33296	0	14.26517	16.61093	16.64378	16.04716	14.95012	14.92553	14.20274	16.21553	13.07395	14.23703	15.37572	0	16.82297	17.38062	17.51962	16.44662	0	17.14744	16.42517	16.34087	16.68913	17.00437	0	16.48369	16.65078	16.28678	0	16.44411	16.67911	16.68193	15.98564	16.42193	15.74207	0	13.38818	16.79146
I3J2M7	I3J2M7_ORENI	gla	carbohydrate metabolic process [GO:0005975]	Alpha-galactosidase (EC 3.2.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	lysosome [GO:0005764]	"lysosome [GO:0005764]; hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]; carbohydrate metabolic process [GO:0005975]"	"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]"	IIDISQDSMGK	12.5	1204.808952	0	15.54362	15.10368	0	16.5286	15.75112	0	16.99255	15.74551	0	15.72101	0	0	0	15.56568	15.92922	0	15.8774	14.84177	0	0	10.49335	14.02506	0	18.0261	0	12.66916	13.29009	12.65855	13.15747	0	13.8529	0	15.8148	0	0	14.42974	0	11.17441	0	13.86642	0	0	0	13.87692	0	12.52426	0	0	13.91683	0	18.10813	13.91992	0
I3J9D0	I3J9D0_ORENI	cchcr1	cell differentiation [GO:0030154]	Alpha-helical coiled-coil rod protein (Coiled-coil alpha-helical rod protein 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; cell differentiation [GO:0030154]		MFIFSELSITK	8.859999657	1314.922401	15.57428	0	12.61485	0	0	0	16.60324	0	0	12.45567	0	0	15.01589	0	0	0	15.78789	0	13.72176	0	17.26491	0	0	15.56591	16.93979	15.06032	16.85457	16.48096	16.67061	0	14.449	0	16.55618	0	15.54861	12.07955	0	14.70672	15.64693	14.93653	16.50589	16.16875	17.31314	16.40748	14.16057	15.97261	15.53111	0	13.68972	14.60783	15.74216	16.97095	18.11476	18.96717
A0A669E538	A0A669E538_ORENI	man2b1	mannose metabolic process [GO:0006013]	Alpha-mannosidase (EC 3.2.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		alpha-mannosidase activity [GO:0004559]; carbohydrate binding [GO:0030246]; metal ion binding [GO:0046872]; mannose metabolic process [GO:0006013]	alpha-mannosidase activity [GO:0004559]; carbohydrate binding [GO:0030246]; metal ion binding [GO:0046872]	MSDEAATHYSAVIDQMTIGLR	12.19999981	2323.910194	0	0	0	13.29647	14.88911	14.34675	0	0	0	0	0	0	16.42869	17.03176	0	0	15.75891	15.89686	0	16.10847	16.83955	0	16.29088	0	16.41409	15.23759	15.38458	0	13.73606	12.76733	17.03217	15.21896	13.81128	0	15.76607	16.10109	15.7937	14.60102	13.95891	16.86048	16.25699	0	14.64551	14.99937	13.73096	15.53734	14.28814	14.95349	15.23851	12.94555	0	14.18941	12.70105	0
A0A669EJ92	A0A669EJ92_ORENI			Alpha-type protein kinase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	AAGSPR	6.050000191	557.3502758	14.49954	14.67904	12.90515	14.3895	14.28718	12.9499	11.71314	0	0	14.51057	13.72559	14.23068	12.96657	13.91163	0	14.73304	8.906848	14.7696	12.60641	15.03845	14.96742	0	13.31248	13.96039	15.6215	0	15.18989	14.23454	15.60393	11.82894	15.35761	0	0	15.35997	15.9241	13.68104	13.70373	0	8.564176	0	14.6751	14.62232	14.62938	12.29749	14.72239	0	13.18559	0	14.69739	14.8491	14.53522	14.42368	14.47081	14.60999
A0A669EZP3	A0A669EZP3_ORENI			Alsin Rho guanine nucleotide exchange factor ALS2 b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	CNELLYTMTDK	19.37000084	1386.583953	17.56762	0	18.5868	17.95496	17.75701	18.23467	0	0	16.54809	15.32824	17.5022	17.45069	18.22134	18.82757	0	0	18.55475	16.6702	16.67112	17.40071	0	0	18.82478	17.87657	18.57705	0	0	17.1012	0	18.32365	17.995	0	15.84997	18.32792	18.45651	18.40068	18.22778	16.83802	15.79376	0	18.52122	15.52363	16.29044	18.3143	17.73762	0	17.72436	17.5732	0	15.35796	11.92458	0	18.05911	0
A0A669F730	A0A669F730_ORENI	LOC100712443		Amidase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SVLSSPGPMAR	5.630000114	1116.738127	10.8804	13.66819	13.40351	13.60782	13.59367	0	13.59488	14.54434	11.79387	11.64618	14.23599	14.35576	14.07889	13.65519	15.04743	13.77868	0	13.75159	0	14.56964	16.73977	19.25582	19.50107	0	0	0	0	0	13.7865	0	0	0	16.17173	16.36325	0	0	12.96089	0	0	0	0	0	16.49854	0	0	0	0	0	19.45995	0	18.47215	0	0	16.69042
A0A669FAP0	A0A669FAP0_ORENI	LOC100703967	axon guidance [GO:0007411]	Amidohydro-rel domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	"cytoplasm [GO:0005737]; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [GO:0016810]; microtubule binding [GO:0008017]; axon guidance [GO:0007411]"	"hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [GO:0016810]; microtubule binding [GO:0008017]"	AEMEKLVR	8.460000038	990.1850283	11.04231	11.22671	11.83515	0	11.62181	12.2994	13.35594	0	13.50853	0	14.61127	12.14064	0	0	11.94054	14.26422	0	9.710798	0	17.83397	14.45305	13.20946	13.60824	0	14.5802	0	13.27117	0	11.2109	12.20975	15.4607	0	0	0	13.48875	13.14593	13.45243	12.77517	0	0	0	14.14892	0	13.39385	0	0	0	0	14.97123	14.08149	0	13.29298	15.26742	14.13845
A0A669E6Y8	A0A669E6Y8_ORENI	LOC100697201		Amine oxidase (EC 1.4.3.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	NVNSLTL	2.609999895	760.8798326	13.97211	15.01948	12.814	14.25204	14.75529	14.29083	15.06327	0	0	15.31205	14.21158	14.21926	15.28136	0	13.96406	14.66294	14.39377	11.02596	14.71214	0	0	13.12565	14.06236	0	0	15.18681	14.4959	15.62077	12.9698	14.31408	0	18.88938	16.51045	15.53655	0	15.00274	0	0	14.1037	14.99747	0	15.47834	15.32619	14.53327	14.16388	14.65319	15.17647	0	13.71705	13.18535	15.94222	15.89283	0	14.32286
A0A669AZI7	A0A669AZI7_ORENI	LOC100701901		Amino acid transporter	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; symporter activity [GO:0015293]	symporter activity [GO:0015293]	SFNLSTQAKIYFSFPGELLMR	4.179999828	2465.01868	8.839233	12.08139	11.77339	14.80507	12.09484	12.34063	11.33098	0	4.390463	0	0	0	0	0	10.67458	13.77142	9.757043	0	12.70173	12.44965	17.53224	14.40212	8.678291	0	10.48672	17.08171	0	0	13.79275	0	12.49013	6.623581	15.32554	13.7359	12.00164	0	0	0	0	0	10.14769	13.36518	12.68896	0	13.15619	0	0	0	12.20271	0	0	0	0	0
I3JXL4	I3JXL4_ORENI	LOC100702599		Aminopeptidase (EC 3.4.11.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; aminopeptidase activity [GO:0004177]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]	aminopeptidase activity [GO:0004177]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]	AVSLAIEQTQVNIQWVK	3.480000019	1927.018156	14.16958	0	12.8207	0	0	0	11.7753	16.34721	16.1758	16.09248	0	0	0	0	14.32857	13.21787	12.69812	15.12777	12.59682	0	0	13.33141	0	0	0	0	0	0	14.58182	12.74624	0	0	13.78998	0	0	16.85952	0	0	0	0	0	13.16129	14.49959	0	0	0	0	0	0	0	0	0	0	0
A0A669EYK6	A0A669EYK6_ORENI			Aminopeptidase puromycin sensitive	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]	metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]	VLGAISAPDLIQK	5.190000057	1323.672748	13.7424	13.96617	11.19931	14.03579	12.68083	12.03327	1.078151	0	9.557647	0	0	0	0	0	15.47474	0	13.4559	0	15.58405	14.86986	14.31158	14.40164	11.09074	0	13.98827	0	14.12307	0	15.27447	16.76517	15.29857	18.52225	15.9747	0	0	14.0253	0	0	15.27272	0	0	0	0	13.05612	0	0	0	0	0	0	0	0	0	0
A0A669C4A0	A0A669C4A0_ORENI	LOC100690242	biosynthetic process [GO:0009058]	Aminotran_1_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		catalytic activity [GO:0003824]; pyridoxal phosphate binding [GO:0030170]; biosynthetic process [GO:0009058]	catalytic activity [GO:0003824]; pyridoxal phosphate binding [GO:0030170]	GASGQR	2.769999981	575.7981384	15.90555	16.11213	15.3914	15.21726	0	15.20953	15.04266	14.26217	16.13787	15.42941	14.84642	0	0	0	13.96341	15.08823	0	15.74128	0	14.92718	13.88041	0	14.55269	0	14.88145	13.51792	15.12742	14.1742	15.2267	15.57904	16.71143	17.05519	16.91632	0	0	0	0	15.53119	15.63622	0	14.69012	14.76285	14.22037	0	16.33946	0	0	16.00133	0	14.82745	14.7089	0	0	16.2021
A0A669DL44	A0A669DL44_ORENI	scly		Aminotran_5 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	ADVTFVPVSK	4.929999828	1062.011485	0	13.0348	13.56952	0	14.03395	14.175	0	14.28319	12.0678	16.941	12.78355	0	14.05604	12.87865	0	15.53735	15.08735	13.98913	15.69022	13.36876	11.60345	0	0	13.19649	0	0	18.16597	0	13.88785	0	0	0	0	0	13.04664	0	0	10.59135	12.42441	0	15.56359	13.52805	0	0	13.2763	0	0	14.39543	17.50549	13.7149	13.60896	14.31328	0	0
A0A669DT02	A0A669DT02_ORENI		chemical synaptic transmission [GO:0007268]	"Amyloid beta (A4) precursor protein-binding, family A, member 2b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	synaptic vesicle [GO:0008021]	synaptic vesicle [GO:0008021]; amyloid-beta binding [GO:0001540]; chemical synaptic transmission [GO:0007268]	amyloid-beta binding [GO:0001540]	KRPGTSGGNSMAAPGPASCPTAHATESCDLK	2.779999971	3129.643194	12.26338	0	12.74965	12.84531	14.62151	13.2599	13.92331	0	0	14.65135	15.46177	12.03629	14.95635	15.80947	0	0	13.78451	16.14784	14.12629	14.91636	13.25915	0	14.98893	15.41723	12.68724	14.87482	15.31505	0	16.08402	14.96489	14.588	0	0	12.9384	14.4301	12.86728	0	13.39807	13.65087	9.455395	13.90214	0	13.84904	15.0033	15.77506	15.71547	13.39721	16.23014	13.48276	0	14.5697	15.69131	0	0
A0A669BSL2	A0A669BSL2_ORENI	APP	nervous system development [GO:0007399]	Amyloid-beta A4 protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi-associated vesicle [GO:0005798]; integral component of membrane [GO:0016021]	Golgi-associated vesicle [GO:0005798]; integral component of membrane [GO:0016021]; heparin binding [GO:0008201]; serine-type endopeptidase inhibitor activity [GO:0004867]; transition metal ion binding [GO:0046914]; nervous system development [GO:0007399]	heparin binding [GO:0008201]; serine-type endopeptidase inhibitor activity [GO:0004867]; transition metal ion binding [GO:0046914]	AAQIRPQVLTHLRVIEER	6.349999905	2130.406861	10.14425	12.49392	0	0	13.02939	18.56732	17.62948	13.98958	14.04476	0	0	0	12.99599	0	14.76412	0	14.10584	10.12998	11.02891	12.13997	14.90529	13.18416	13.07589	14.12885	0	10.4571	13.08196	17.97825	0	18.31924	11.78268	16.13053	14.41611	11.28148	0	11.92588	10.85067	9.804426	11.24918	0	12.64648	17.78968	0	11.65975	13.04235	14.52856	10.87131	0	14.52356	13.76237	13.22925	10.23201	0	16.6711
A0A669EZQ9	A0A669EZQ9_ORENI	anapc4	anaphase-promoting complex-dependent catabolic process [GO:0031145]; cell cycle [GO:0007049]; cell division [GO:0051301]; protein K11-linked ubiquitination [GO:0070979]; regulation of mitotic metaphase/anaphase transition [GO:0030071]	Anaphase-promoting complex subunit 4 (Cyclosome subunit 4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	anaphase-promoting complex [GO:0005680]	anaphase-promoting complex [GO:0005680]; anaphase-promoting complex-dependent catabolic process [GO:0031145]; cell cycle [GO:0007049]; cell division [GO:0051301]; protein K11-linked ubiquitination [GO:0070979]; regulation of mitotic metaphase/anaphase transition [GO:0030071]		FVLDQQSSSIPSQGLVLGNQWR	8.449999809	2458.135798	12.10429	0	11.39426	0	5.678806	0	0	0	11.79961	14.4344	10.5377	10.61201	10.67718	0	10.68566	0	0	12.81699	0	13.53049	0	0	14.05356	0	0	9.142405	0	0	0	12.92695	0	10.97162	0	0	14.7176	7.928874	0	12.92837	0	0	13.75024	10.41609	10.73215	13.10787	16.99429	0	7.101483	0	9.906517	0	11.31672	9.871235	0	14.26358
A0A669DMN6	A0A669DMN6_ORENI	anapc5	cell cycle [GO:0007049]; cell division [GO:0051301]; protein ubiquitination [GO:0016567]	Anaphase-promoting complex subunit 5 (Cyclosome subunit 5)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	anaphase-promoting complex [GO:0005680]	anaphase-promoting complex [GO:0005680]; cell cycle [GO:0007049]; cell division [GO:0051301]; protein ubiquitination [GO:0016567]		ITLPERR	12.68999958	884.5357289	11.48184	12.28746	12.41232	13.34709	0	14.25601	12.85187	12.96363	14.82336	12.14339	14.40312	8.938082	14.20215	14.42581	0	12.93922	14.72172	15.70895	0	0	13.50147	13.59487	14.23108	12.43063	16.22771	14.78137	14.31508	14.55649	11.83363	0	0	0	14.08253	13.91279	9.921441	12.49778	13.34069	13.4989	13.68557	12.1736	13.8458	12.40239	0	14.85629	0	13.27784	14.39056	13.00262	14.06212	0	14.31103	13.08039	6.5409	13.58413
Q8UWB7	Q8UWB7_ORENI	ARb	androgen receptor signaling pathway [GO:0030521]	Androgen receptor (Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; nuclear receptor activity [GO:0004879]; sequence-specific DNA binding [GO:0043565]; steroid binding [GO:0005496]; zinc ion binding [GO:0008270]; androgen receptor signaling pathway [GO:0030521]	nuclear receptor activity [GO:0004879]; sequence-specific DNA binding [GO:0043565]; steroid binding [GO:0005496]; zinc ion binding [GO:0008270]	CFEAGMTLGAR	9.050000191	1213.023307	11.93056	0	9.71433	14.13088	13.52005	13.00245	11.79791	15.27876	11.68029	13.43472	10.88871	11.14709	13.70938	15.42293	14.23939	8.052037	13.17426	12.8052	13.34435	0	12.57106	13.45332	13.83996	12.24556	0	0	13.49302	14.32505	0	0	16.25582	0	0	13.539	0	11.61403	13.49692	13.20848	11.90342	11.7756	14.31895	13.06232	0	14.08066	13.25256	13.79953	10.00065	0	13.08931	12.52861	11.40892	14.08584	0	8.232111
Q8UWB8	Q8UWB8_ORENI	ARa		Androgen receptor alpha	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	AIPGFR	11.80000019	660.7017677	14.47628	13.55671	15.23542	14.5046	14.4777	0	12.6517	0	0	14.7572	0	15.91695	14.70769	13.02614	14.59655	0	0	15.40404	15.10996	12.87712	15.18867	14.14155	14.06896	14.78482	0	14.81448	0	15.8387	14.01622	14.59503	15.81324	17.05092	16.2349	13.53335	14.45887	15.03493	11.85733	14.0624	13.84835	14.08348	0	0	15.24402	0	0	0	0	0	0	0	14.62492	12.62153	14.7962	14.57813
A0A669F7M4	A0A669F7M4_ORENI			"Angio-associated, migratory cell protein"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ILPDGK	1.99000001	641.1300176	13.40196	13.55094	14.99419	14.54102	13.76595	15.03954	0	0	0	16.51646	16.38147	16.1937	16.10072	15.2667	13.8254	13.9723	14.92502	14.59204	13.69102	15.65503	0	12.85162	10.78219	14.14092	8.165118	12.76642	15.52432	13.82513	14.12329	14.55136	16.01596	16.22435	17.77805	15.48358	15.20619	16.16317	13.44561	13.15805	15.4009	14.36018	15.48149	13.65019	0	16.12085	15.68215	14.74601	15.38125	15.209	16.35436	0	0	14.86725	0	0
A0A669EIC8	A0A669EIC8_ORENI			Angiomotin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				HTASCILPSK	6.420000076	1114.215861	0	14.74771	0	0	0	11.83662	11.9048	17.31965	16.52872	13.35108	13.46835	0	0	0	0	0	13.45642	17.5541	0	0	0	17.12118	0	11.52801	0	0	0	0	12.01711	0	0	12.47193	0	0	0	0	0	11.64484	13.70567	12.20127	12.28678	0	12.47619	0	0	0	0	0	0	0	0	17.61446	12.97124	14.46409
I3K0Z5	I3K0Z5_ORENI	rassf8	signal transduction [GO:0007165]	Ras-associating domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signal transduction [GO:0007165]		LGSSR	2.950000048	517.9104526	16.4198	16.69671	16.2027	16.17629	0	0	0	16.9051	0	0	0	0	0	16.12155	0	0	15.81078	15.24789	15.00072	15.18261	15.44336	16.97631	15.03314	15.8757	14.73146	0	15.53734	0	16.08752	15.82644	17.35023	17.65626	0	0	0	15.05539	15.42126	16.44244	15.43758	15.35665	15.89695	0	16.12706	15.75102	15.55369	16.21654	15.63246	15.53966	0	15.4284	0	0	16.58035	14.6787
A0A669EDQ7	A0A669EDQ7_ORENI	amotl2		Angiomotin_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ALHAQLLEK	14.51000023	1022.238963	16.54104	17.14184	18.14584	17.32399	16.89475	15.65293	0	17.9232	19.05833	14.25682	19.86816	15.83916	17.9492	18.58923	17.12385	19.61334	19.98631	17.21201	0	18.30536	16.54121	18.61695	14.80824	19.2534	19.91849	15.50451	21.78288	17.39792	17.97279	18.06055	17.07218	17.55578	13.83544	15.19119	15.11635	16.87842	15.64287	16.25057	11.30357	16.2876	0	17.78422	17.77478	0	0	0	16.62809	0	16.6365	17.39277	9.505052	0	19.72398	0
A0A669D5R6	A0A669D5R6_ORENI	ace		Angiotensin-converting enzyme (EC 3.4.-.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; carboxypeptidase activity [GO:0004180]; metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237]; peptidyl-dipeptidase activity [GO:0008241]	carboxypeptidase activity [GO:0004180]; metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237]; peptidyl-dipeptidase activity [GO:0008241]	EWWNLRLK	1.980000019	1144.645147	12.02766	13.98131	12.40328	10.52088	13.67192	13.28501	0	0	0	15.64679	13.65438	0	0	14.73159	0	0	14.19457	17.71226	14.83364	14.16946	0	0	0	14.05485	10.69818	14.15054	14.57631	0	14.45603	0	13.18219	8.413384	0	0	0	0	0	14.76738	0	15.14564	0	0	0	0	0	0	0	0	0	0	17.53056	0	0	0
I3J0V5	I3J0V5_ORENI	LOC100708185		Anion exchange protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; inorganic anion exchanger activity [GO:0005452]	inorganic anion exchanger activity [GO:0005452]	LESECAAPGEQPK	2.390000105	1416.485255	0	13.72036	0	14.00533	11.64089	12.66421	12.43836	12.33744	15.18513	14.56995	13.70339	11.28037	15.53465	14.28579	9.233093	0	12.97794	12.36629	12.38747	0	12.17329	14.77295	12.6461	14.91053	13.23008	11.1785	13.36184	11.64953	14.18523	11.48368	16.89596	16.04069	16.44027	14.79561	12.45511	12.42134	12.39889	12.06293	13.00109	15.94718	0	9.397592	9.645431	12.78686	14.68502	14.47451	14.32964	14.06962	0	13.384	13.61754	14.82193	14.25316	0
A0A669BBC6	A0A669BBC6_ORENI		signal transduction [GO:0007165]	"Ankyrin 1, erythrocytic b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]; membrane [GO:0016020]	cytoskeleton [GO:0005856]; membrane [GO:0016020]; signal transduction [GO:0007165]		DIELMEGMPLYLECSGNLVPIRK	8.409999847	2692.210199	0	12.41803	7.773694	11.8082	4.72524	12.33473	0	14.58826	12.8147	8.34843	17.55509	0	0	0	8.335236	0	12.3783	0	13.42862	0	8.969091	0	16.88843	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669BEK6	A0A669BEK6_ORENI	ANK2	signal transduction [GO:0007165]	Ankyrin 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]; membrane [GO:0016020]	cytoskeleton [GO:0005856]; membrane [GO:0016020]; signal transduction [GO:0007165]		EAISTSESKSR	9.529999733	1193.739838	12.79006	12.31458	10.83219	10.74547	14.82467	0	0	13.25221	13.36947	10.90372	15.33298	0	17.87388	12.12546	11.41502	0	17.0606	14.62735	15.29933	12.93148	13.43478	14.70219	13.36743	0	15.17771	0	14.98521	13.78588	18.61254	14.4525	0	11.78821	12.51101	13.46912	0	0	13.2	10.5624	0	0	0	14.59507	13.70939	0	11.94409	0	0	10.52659	0	0	0	0	14.82561	17.16067
A0A669B350	A0A669B350_ORENI		signal transduction [GO:0007165]	"Ankyrin 2a, neuronal"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]; membrane [GO:0016020]	cytoskeleton [GO:0005856]; membrane [GO:0016020]; signal transduction [GO:0007165]		MSSEESLDGDAILK	6.269999981	1510.73329	14.02065	13.00428	14.42957	14.76334	13.8043	12.96655	14.99115	12.76834	12.79382	0	0	13.91107	12.88198	11.25318	0	13.84024	0	0	13.71069	13.58542	0	13.69684	14.50684	13.59726	0	0	12.50253	12.03436	0	14.45742	18.69861	18.73112	18.33697	0	14.35808	13.57926	13.19137	0	14.18464	0	0	0	14.23997	0	13.05887	14.52099	13.11921	0	0	14.57684	11.19187	0	13.7352	14.52953
A0A669EB01	A0A669EB01_ORENI	ANK3	signal transduction [GO:0007165]	Ankyrin 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]; membrane [GO:0016020]	cytoskeleton [GO:0005856]; membrane [GO:0016020]; signal transduction [GO:0007165]		TALGSTVVTDAGAHTLSSVK	5.400000095	1914.599228	0	14.20421	13.17914	13.65685	15.16833	0	14.90135	0	13.24529	14.81548	15.03341	12.96112	0	13.0566	13.91989	13.00256	13.8798	12.86633	14.11509	0	14.69907	11.65595	0	17.18332	13.6026	12.61733	15.07911	0	11.64669	9.766262	0	16.03365	0	15.07464	0	9.311437	0	0	13.29198	0	0	0	0	11.85373	0	0	0	0	0	0	0	0	0	0
A0A669BCX8	A0A669BCX8_ORENI		signal transduction [GO:0007165]	Ankyrin 3a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]; membrane [GO:0016020]	cytoskeleton [GO:0005856]; membrane [GO:0016020]; signal transduction [GO:0007165]		CEETMSVHDIMKAFQSGK	5.570000172	2114.021088	12.75963	11.96435	13.55618	13.39069	13.14889	0	12.16369	14.39372	11.2631	14.99033	14.32402	10.57567	0	12.00739	0	10.34013	0	11.94127	0	12.63477	14.20082	12.95935	17.855	0	14.63915	0	18.30871	0	14.89283	12.35518	0	12.52893	0	15.19434	0	11.60028	0	12.26507	0	0	12.58379	0	0	0	13.94097	0	12.75787	10.96774	13.59508	0	15.81316	10.88235	0	14.82055
I3IYC9	I3IYC9_ORENI			Ankyrin repeat and EF-hand domain containing 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LLQLVHEVDK	11.06000042	1193.502534	13.01706	14.29757	10.32241	16.73284	12.68607	11.43617	5.594653	13.78139	12.70807	14.36491	13.85342	15.17299	10.47849	13.71772	0	14.10699	9.626659	0	0	11.53972	13.32289	14.78348	13.61146	16.31402	12.40111	13.63233	0	0	0	0	14.47198	14.33644	0	0	14.78749	0	10.22305	11.66859	13.08576	13.46844	0	10.29782	0	11.5123	12.53052	0	10.82518	11.60238	0	13.82638	0	0	0	13.38987
A0A669D0Q8	A0A669D0Q8_ORENI		intracellular signal transduction [GO:0035556]; protein ubiquitination [GO:0016567]	Ankyrin repeat and SOCS box containing 11	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		intracellular signal transduction [GO:0035556]; protein ubiquitination [GO:0016567]		LYRASSLFVPHSIK	6.53000021	1618.539081	15.65204	0	0	0	0	0	0	0	0	0	15.07419	0	0	0	0	0	14.46875	15.00442	16.32845	0	16.28847	16.24175	12.30689	0	15.17852	0	14.67644	0	0	0	16.8707	0	16.83343	0	15.34938	0	0	0	0	0	0	0	0	16.23262	0	15.47017	16.48635	0	0	0	0	0	12.15177	0
A0A669E0K8	A0A669E0K8_ORENI	ANKS1A	regulation of ephrin receptor signaling pathway [GO:1901187]	Ankyrin repeat and sterile alpha motif domain containing 1A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ephrin receptor binding [GO:0046875]; regulation of ephrin receptor signaling pathway [GO:1901187]	ephrin receptor binding [GO:0046875]	LLLEELTDPTMR	5.949999809	1447.885308	13.57067	0	0	0	12.64023	13.85045	0	14.59521	0	14.26315	14.27406	0	0	13.47779	0	11.21124	13.17567	12.33911	11.80484	0	13.84239	0	12.02824	10.15792	11.76129	0	0	0	13.62208	12.59115	16.64761	16.3932	0	0	14.65199	14.61831	13.25479	12.12532	14.52692	0	11.99195	11.43467	14.35972	13.65976	14.45826	13.55355	13.73045	0	13.47972	0	12.52235	14.06965	0	13.95558
I3KNE5	I3KNE5_ORENI	ANKS6		Ankyrin repeat and sterile alpha motif domain containing 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MNFGVPANSR	6.409999847	1092.83974	14.9796	15.52362	0	0	15.30006	17.37855	16.24656	18.19858	15.82351	14.2406	0	17.97307	0	15.74285	0	12.54265	13.66815	0	17.43632	0	0	15.35026	15.29285	14.86048	0	17.1865	0	0	13.46083	0	16.58431	15.48981	0	15.92506	16.08952	0	14.65468	0	0	0	0	0	0	0	0	0	15.66937	0	0	0	16.03871	0	0	0
A0A669D046	A0A669D046_ORENI			Ankyrin repeat domain 24	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ELQAALAQK	3.349999905	972.0563237	16.94852	15.14673	0	0	0	15.8011	0	12.11395	13.85812	0	16.30376	15.48795	18.50527	0	15.49246	13.92359	0	15.37356	13.9311	14.645	14.6451	15.91218	0	15.75115	15.14876	16.9387	16.66052	16.40621	11.09102	15.6709	16.43609	16.66963	0	16.13359	11.58278	12.97291	14.54267	15.28421	0	15.25204	16.3122	13.60414	16.95974	0	16.67513	0	16.69153	17.07628	15.41425	14.41285	14.0142	14.38929	15.55004	16.31629
A0A669D5S8	A0A669D5S8_ORENI			Ankyrin repeat domain 6b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LLLEAGADSR	8.140000343	1044.871467	0	0	0	14.92863	14.98347	15.02577	0	0	12.78582	0	14.92205	0	0	14.80782	0	0	0	0	0	14.98844	13.24626	0	0	0	12.95108	0	0	0	13.99235	14.61042	17.59758	16.42858	18.27378	15.62932	15.33427	0	0	0	0	15.74656	0	13.52567	14.71939	0	0	15.19666	0	0	10.79554	0	15.90593	0	0	14.95274
A0A669BJU3	A0A669BJU3_ORENI	LOC100702381		Annexin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]; calcium-dependent phospholipid binding [GO:0005544]	calcium-dependent phospholipid binding [GO:0005544]; calcium ion binding [GO:0005509]	MLWDDNISK	3.390000105	1137.727427	0	0	13.50119	14.89685	14.94546	14.43416	16.84315	13.8746	12.63184	0	0	11.15868	15.46679	15.71659	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.15232	0	0	0	0	0	0	0	0
A0A669D2V2	A0A669D2V2_ORENI	ANO1	cellular response to heat [GO:0034605]; chloride transmembrane transport [GO:1902476]; positive regulation of insulin secretion involved in cellular response to glucose stimulus [GO:0035774]	Anoctamin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; protein dimerization activity [GO:0046983]; cellular response to heat [GO:0034605]; chloride transmembrane transport [GO:1902476]; positive regulation of insulin secretion involved in cellular response to glucose stimulus [GO:0035774]	protein dimerization activity [GO:0046983]	YNIRATVK	3.480000019	965.1641693	14.63034	12.98306	13.81902	13.85474	12.18208	0	0	13.22287	10.91051	16.13387	12.2038	0	14.40634	13.30298	13.83653	14.21809	10.73498	0	14.05353	13.54178	12.09058	13.27754	0	0	12.49357	0	15.25935	10.31512	0	13.88782	0	0	15.27365	12.31267	14.71439	12.83163	14.18171	0	12.60285	12.59174	0	0	12.40979	13.94193	12.48052	13.92793	13.22748	12.61147	10.10501	13.70862	0	0	13.00519	11.2402
A0PDK0	A0PDK0_ORENI	AMH	gonad development [GO:0008406]	Anti-mullerian hormone (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		growth factor activity [GO:0008083]; gonad development [GO:0008406]	growth factor activity [GO:0008083]	ELSAFQEK	8.319999695	948.7206633	14.66488	17.07342	14.76015	15.8575	0	0	0	0	15.71875	0	0	0	0	17.23627	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.11585	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3K8K6	I3K8K6_ORENI	btg3		Anti_prolifrtn domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GQAYRCIR	3.859999895	1022.408988	0	14.93921	13.73849	14.68459	14.87547	16.31512	15.76294	14.29506	13.61313	16.97979	11.78799	0	14.24227	15.12824	0	16.10855	0	0	13.33928	0	14.08623	15.02334	0	0	17.33648	18.31776	16.72055	13.30929	14.52803	0	13.52836	16.5063	0	0	16.7137	14.59266	0	15.18285	15.87037	0	0	0	0	15.95011	0	0	15.77692	0	15.29671	15.06909	0	0	18.05404	16.89316
I3IV50	I3IV50_ORENI	LOC102083126	apoptotic process [GO:0006915]; immune response [GO:0006955]; signal transduction [GO:0007165]	Apo-1 antigen (Apoptosis-mediating surface antigen FAS) (FASLG receptor) (Tumor necrosis factor receptor superfamily member 6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; membrane raft [GO:0045121]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; membrane raft [GO:0045121]; plasma membrane [GO:0005886]; calmodulin binding [GO:0005516]; transmembrane signaling receptor activity [GO:0004888]; apoptotic process [GO:0006915]; immune response [GO:0006955]; signal transduction [GO:0007165]	calmodulin binding [GO:0005516]; transmembrane signaling receptor activity [GO:0004888]	LIENLVDMKQK	4.21999979	1346.187161	11.79441	0	8.847419	0	11.81144	16.55439	0	10.66766	13.29235	0	0	0	14.83311	0	0	0	12.88106	0	13.9307	13.54655	12.99942	0	17.93881	11.12375	13.61977	0	0	0	0	0	0	13.28042	0	0	0	0	0	0	0	0	0	0	0	0	0	11.16336	0	11.95626	0	13.57994	10.12976	0	0	12.94321
I3KQQ9	I3KQQ9_ORENI	LOC100698589	aging [GO:0007568]; lipid transport [GO:0006869]	Apolipoprotein D	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		lipid binding [GO:0008289]; aging [GO:0007568]; lipid transport [GO:0006869]	lipid binding [GO:0008289]	VVSSEILK	2.390000105	874.4148666	11.77618	14.06995	12.81742	14.42377	16.16566	13.78976	17.43534	9.927994	14.60404	0	14.79485	15.1727	14.85053	14.28641	14.50708	13.49029	15.0993	14.03001	0	14.95049	12.43147	14.90862	0	16.13706	0	0	15.21612	15.29415	0	14.30998	0	15.75031	12.21689	14.35358	15.33837	14.70961	11.92976	14.35296	14.96868	13.70149	13.65076	14.261	14.37363	15.85937	13.4844	14.87611	13.31534	14.06219	15.62349	16.05434	14.71454	13.25927	14.84202	14.34679
I3JJ73	I3JJ73_ORENI			Apoptosis inducing factor mitochondria associated 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	GFSFTLIDMR	12.31999969	1201.737271	8.287045	11.69191	0	0	14.33175	11.80444	0	13.96424	13.86184	6.272657	0	11.52485	11.46286	16.84681	0	9.7638	0	0	0	13.86593	0	0	0	18.62256	13.38342	14.17879	0	13.70527	18.76039	13.19002	0	16.18692	13.94391	13.53467	0	0	8.85961	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3JQ09	I3JQ09_ORENI			Apoptosis inducing factor mitochondria associated 5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"2 iron, 2 sulfur cluster binding [GO:0051537]; flavin adenine dinucleotide binding [GO:0050660]; metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]"	"2 iron, 2 sulfur cluster binding [GO:0051537]; flavin adenine dinucleotide binding [GO:0050660]; metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]"	VKEVVLK	3.230000019	812.7463713	0	15.50115	14.1089	0	0	13.99437	15.46126	15.80268	16.47882	0	14.59423	15.57264	15.87782	0	16.10493	16.45584	16.47014	15.84473	14.79725	0	0	0	0	15.52691	15.38059	0	0	18.74064	0	15.66184	0	0	16.54827	0	0	16.26652	15.59449	0	15.00403	0	14.79238	0	15.46444	0	0	0	0	14.71012	0	16.31765	0	0	0	0
I3KES5	I3KES5_ORENI			Apoptosis inhibitor 5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AVTIEDLYR	3.809999943	1078.873156	0	13.72177	9.837668	13.17569	6.708654	14.07354	12.32056	11.29314	12.37903	0	12.27878	15.57044	0	12.19986	0	18.99098	0	17.86187	14.99315	13.90656	13.12437	13.48439	13.18634	11.26352	14.97423	11.60796	15.29824	12.76645	0	9.970701	18.40179	11.75132	0	0	17.38866	0	14.6562	13.45057	0	13.15958	13.84526	17.48688	13.22401	0	0	0	0	13.1629	0	0	18.71295	0	14.02635	16.11206
I3KLB3	I3KLB3_ORENI		apoptotic process [GO:0006915]; negative regulation of apoptotic process [GO:0043066]	Apoptosis regulator Bcl-2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; mitochondrial outer membrane [GO:0005741]; nuclear membrane [GO:0031965]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; mitochondrial outer membrane [GO:0005741]; nuclear membrane [GO:0031965]; apoptotic process [GO:0006915]; negative regulation of apoptotic process [GO:0043066]		LRGNGGGAAR	18.70999908	927.5064855	16.21469	16.09191	16.64829	0	16.42655	16.31547	17.13549	16.1317	17.5088	14.25933	16.99925	18.83472	19.21635	0	16.03517	17.06644	18.90398	17.31221	19.96562	18.69856	0	0	19.26176	0	0	0	0	0	0	0	0	0	16.03021	0	0	0	0	16.467	16.71377	0	0	14.37878	17.33593	16.57892	15.82995	0	17.43199	0	15.94632	16.97634	0	0	0	0
A0A669DR66	A0A669DR66_ORENI			Apoptotic chromatin condensation inducer 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	AAETRHLSK	5.690000057	1012.563225	18.37102	11.73866	11.58315	15.75996	16.17661	15.86617	16.48901	0	0	0	15.47583	14.82699	14.91695	14.70492	11.38051	14.91423	13.20621	14.17326	14.2238	16.12838	12.1522	14.33847	15.42709	14.74215	17.6275	15.35147	14.62266	14.26255	11.19875	17.12249	10.42105	14.22271	15.57339	14.79531	14.56384	0	0	0	0	15.81758	16.38599	0	0	0	0	0	0	0	15.87786	15.96804	0	0	0	0
A0A669BVX8	A0A669BVX8_ORENI	ARAP3	signal transduction [GO:0007165]	"ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"GTPase activator activity [GO:0005096]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547]; signal transduction [GO:0007165]"	"GTPase activator activity [GO:0005096]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547]"	GGTESPR	1.370000005	703.8534317	14.64304	14.42196	13.87373	14.6474	14.06791	0	15.8742	14.2115	15.12154	15.94164	14.19346	15.73979	0	15.38022	0	0	15.33947	13.05592	0	16.06549	0	17.63798	18.35379	15.43838	15.5295	0	0	0	14.343	14.05278	0	0	0	0	0	0	0	13.88613	15.80149	15.70782	15.51557	0	0	0	0	15.13819	0	0	0	0	18.41493	0	0	0
I3KRE7	I3KRE7_ORENI			"ArfGAP with SH3 domain, ankyrin repeat and PH domain 2b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; GTPase activator activity [GO:0005096]; metal ion binding [GO:0046872]	GTPase activator activity [GO:0005096]; metal ion binding [GO:0046872]	AALQSDQK	2.789999962	861.2298434	4.81348	0	11.88813	11.11686	0	13.92848	0	13.63095	0	15.66363	15.14685	17.11481	11.05413	12.34284	0	15.43951	0	14.77588	14.51487	14.73216	15.37348	14.01476	15.12402	0	0	17.61587	0	14.17142	12.94282	0	16.26066	15.48472	17.34449	0	16.71039	0	0	0	0	14.71142	0	14.58878	0	11.74373	0	15.67618	0	0	16.08929	16.71117	17.18476	0	0	0
I3KNW6	I3KNW6_ORENI			ArfGAP with dual PH domains 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]; phosphatidylinositol bisphosphate binding [GO:1902936]	GTPase activator activity [GO:0005096]; phosphatidylinositol bisphosphate binding [GO:1902936]	KNPTLQEK	6.389999866	957.2480404	14.5524	0	14.86713	16.90931	13.15507	15.5092	15.34613	15.86538	14.42263	0	16.43778	15.6121	16.45325	16.47459	14.38499	13.89243	16.63142	14.48979	15.75797	0	16.11313	16.29922	14.89081	16.14089	16.31524	15.71987	15.38917	14.49873	14.14862	15.87272	18.88573	19.30154	15.74306	15.02196	14.35461	14.63151	14.09018	16.04733	0	15.80707	15.02703	15.38355	15.80233	15.39014	15.63025	16.21669	16.08894	15.47105	16.9117	16.51911	0	17.78156	16.64616	18.00093
A0A669CJ71	A0A669CJ71_ORENI		cell cycle [GO:0007049]	Arginine vasopressin-induced protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cell cycle [GO:0007049]		MDSGPASPSSSMLAGR	13.07999992	1566.097863	0	0	14.93272	0	14.18338	13.46562	13.96015	0	15.8434	15.17443	15.35113	14.49475	0	15.17857	14.71976	0	15.24628	0	0	14.60673	14.88704	15.67388	0	11.09856	13.73242	14.9061	14.41174	11.35185	12.23116	14.61042	0	16.97283	17.24467	14.96694	15.21456	13.38508	13.52203	0	0	16.32006	14.56479	15.44577	14.87532	15.92743	14.62022	14.55327	14.74956	15.31618	7.662242	0	14.69323	14.22509	0	14.15712
A0A669D802	A0A669D802_ORENI		arginine biosynthetic process via ornithine [GO:0042450]	Argininosuccinate lyase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		argininosuccinate lyase activity [GO:0004056]; arginine biosynthetic process via ornithine [GO:0042450]	argininosuccinate lyase activity [GO:0004056]	VVTDMRLWLR	4.03000021	1288.286392	13.96206	12.31409	13.31333	13.11053	16.53652	14.58072	15.07565	14.70307	0	13.24554	12.08808	14.74664	12.76055	0	13.47392	13.94002	14.93248	0	0	0	0	14.86567	0	14.85068	13.67143	15.17162	13.43689	0	0	0	19.09812	20.2489	20.30022	0	0	0	0	0	15.34821	0	14.35048	0	0	0	14.91081	0	0	14.26716	16.81189	0	0	13.52211	0	15.02235
A0A669E3V7	A0A669E3V7_ORENI		gene silencing by RNA [GO:0031047]; regulation of translation [GO:0006417]	Argonaute RISC component 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	P-body [GO:0000932]	P-body [GO:0000932]; RNA binding [GO:0003723]; gene silencing by RNA [GO:0031047]; regulation of translation [GO:0006417]	RNA binding [GO:0003723]	QVILLIAIRK	1.620000005	1167.153686	0	14.14592	14.17969	14.11864	0	0	13.96468	14.96618	13.3355	14.07183	15.53061	14.32728	14.5069	14.92576	14.92828	13.50809	12.74546	12.81816	0	16.36888	10.97362	14.1316	15.92826	15.01998	15.9734	15.35806	15.11342	0	13.35604	0	17.01037	17.14952	15.25902	0	15.5669	0	16.1555	0	13.52444	15.71755	15.80165	14.7379	15.45002	0	0	0	14.86215	15.97153	13.86637	0	14.07261	13.9363	0	15.36375
I3JU11	I3JU11_ORENI			Armadillo repeat containing 5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AANQTPTEANAEK	7.170000076	1345.238381	15.01221	0	0	13.2493	11.50337	12.26783	13.30888	0	0	0	0	13.03995	0	0	14.79438	10.11794	12.61738	0	14.41283	13.57171	0	0	0	15.64449	0	0	0	14.90772	13.07829	13.32178	18.50816	0	17.31139	12.44293	0	0	0	13.81696	13.73401	0	0	0	13.20075	0	0	13.04158	0	0	0	0	0	14.98754	15.13129	13.48973
I3K977	I3K977_ORENI	LOC100711618		Armadillo repeat-containing protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial outer membrane [GO:0005741]	mitochondrial outer membrane [GO:0005741]; metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	DLAADPMNR	10.65999985	1001.387694	13.72785	13.97807	10.65447	12.14256	13.2107	14.35895	13.54174	15.16809	12.19113	13.5435	13.27944	15.27227	14.06872	0	14.74581	13.52599	0	0	12.85926	13.25002	12.25716	13.39296	13.12309	0	9.022167	14.18703	0	14.10046	0	11.29648	17.46747	17.16211	17.8958	13.85575	0	11.67879	14.85583	15.19119	10.72961	0	0	14.10154	14.5605	12.09538	0	14.47978	13.84745	14.90672	13.78411	14.27005	0	13.46943	14.40117	13.12069
A0A669B8B6	A0A669B8B6_ORENI	LOC100700585	signal transduction [GO:0007165]	Arrestin_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signal transduction [GO:0007165]		VMVKLIVGGMMGSSEVGLEVPFK	7.25	2422.644776	0	12.50845	0	11.68778	12.23275	0	7.589412	13.3828	11.60253	0	0	0	12.73463	0	0	10.61611	14.44106	11.16497	12.92911	12.79094	9.856468	11.11621	14.21836	13.75911	13.82498	12.48654	0	0	0	0	12.6278	0	0	12.4864	0	0	10.41891	11.82892	0	13.81722	0	0	0	8.666359	0	0	0	11.46601	0	0	13.86386	0	18.15645	14.14473
A0A669CHP4	A0A669CHP4_ORENI			Aryl hydrocarbon receptor interacting protein like 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	ESWMMEKDEK	1.120000005	1326.004159	10.76918	11.9224	12.71547	12.91696	14.24126	0	12.597	12.73796	16.13525	0	0	12.99853	13.5464	13.64351	11.23014	0	12.56108	8.52874	14.16881	12.9434	0	0	13.60296	13.31832	0	0	9.976117	0	13.92983	10.314	0	0	0	0	7.298395	8.642319	9.836148	11.17081	15.07683	0	13.62758	0	0	0	12.9954	0	0	9.20435	0	0	14.46738	0	0	13.4681
A0A669B9A5	A0A669B9A5_ORENI			Aryl hydrocarbon receptor nuclear translocator-like 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]	SLMTPPSAAGMSLSMELTR	5.260000229	2012.22662	12.17737	12.97902	12.09294	10.63713	14.45273	9.320239	12.26823	14.29346	0	13.76748	13.64837	0	12.74501	12.08406	11.85415	13.25097	13.80024	12.20816	0	10.53272	14.51617	15.98684	13.68635	13.86865	14.20348	14.77901	14.12643	14.20372	14.28539	13.9954	14.35742	8.487409	0	13.73393	9.573401	10.97003	11.93703	14.33748	17.78337	12.58713	0	8.300743	0	0	14.09111	10.43746	14.07724	13.16949	0	14.64419	0	0	14.21428	0
I3JNJ6	I3JNJ6_ORENI			Arylalkylamine N-acetyltransferase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		N-acetyltransferase activity [GO:0008080]	N-acetyltransferase activity [GO:0008080]	MSVVGAQPFIKPMQSPPSVSPGIQR	5.809999943	2638.635277	13.61921	0	0	0	11.62206	0	0	10.74637	0	0	7.672662	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.68426	13.50762	0	0	13.67911	17.8901	11.13527	10.75884	10.32494	9.940466	10.89352	11.0977	11.8323	10.8993	0	11.71945	7.79923	0	0	0	0	0	11.10537	0	0	0	17.25946	0
A0A669DEL7	A0A669DEL7_ORENI	nrip2		Asp_protease domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		aspartic-type endopeptidase activity [GO:0004190]	aspartic-type endopeptidase activity [GO:0004190]	DLQPHSIVQR	11.05000019	1192.850873	13.34628	0	10.93153	12.51504	14.00696	0	10.68743	11.34128	12.11395	10.80392	13.12248	14.39238	0	0	13.6873	11.9011	0	12.21061	13.64204	12.34941	14.61067	11.36477	17.73178	0	0	16.85493	16.91644	12.12283	9.012961	11.4358	12.67672	14.94809	14.98147	14.21082	13.04381	10.07202	0	11.79464	10.23184	13.42682	0	10.66187	0	0	13.35091	15.13796	12.46325	0	13.60302	14.41442	0	9.857417	15.49893	17.831
A0A669ENU3	A0A669ENU3_ORENI	cad	'de novo' pyrimidine nucleobase biosynthetic process [GO:0006207]; 'de novo' UMP biosynthetic process [GO:0044205]; glutamine metabolic process [GO:0006541]	Aspartate carbamoyltransferase (EC 2.1.3.2) (EC 3.5.2.3) (CAD protein) (Dihydroorotase) (Glutamine-dependent carbamoyl-phosphate synthase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		amino acid binding [GO:0016597]; aspartate carbamoyltransferase activity [GO:0004070]; ATP binding [GO:0005524]; carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity [GO:0004088]; dihydroorotase activity [GO:0004151]; metal ion binding [GO:0046872]; 'de novo' pyrimidine nucleobase biosynthetic process [GO:0006207]; 'de novo' UMP biosynthetic process [GO:0044205]; glutamine metabolic process [GO:0006541]	amino acid binding [GO:0016597]; aspartate carbamoyltransferase activity [GO:0004070]; ATP binding [GO:0005524]; carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity [GO:0004088]; dihydroorotase activity [GO:0004151]; metal ion binding [GO:0046872]	GTMLGK	3.829999924	621.9563487	16.64686	0	16.68894	16.78922	15.59673	15.63686	15.56003	15.8516	16.25845	15.26408	15.22766	15.01627	15.82232	15.27222	16.10698	17.7102	0	16.61187	16.29915	0	15.87744	16.87522	17.38384	17.26641	18.15328	18.04995	16.80379	17.46519	17.02567	17.15748	16.51467	0	0	16.0977	16.36516	16.19363	17.79386	18.54179	0	0	17.10333	16.42532	16.56297	0	0	0	18.76878	15.94777	19.02727	19.05926	18.52141	16.70341	16.75743	0
A0A669BBP2	A0A669BBP2_ORENI	dnpep		Aspartyl aminopeptidase (EC 3.4.11.21)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		aminopeptidase activity [GO:0004177]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]	aminopeptidase activity [GO:0004177]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]	MITLYDNEEVGSESAQGAQSNLTELILSR	2.220000029	3183.933832	13.53091	0	13.05428	9.655168	0	0	0	12.71704	11.98324	0	13.60617	0	12.54689	8.176861	0	0	15.18908	11.87365	14.03722	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.29164	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669B267	A0A669B267_ORENI			Ataxin 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MSMKAGGNR	17.75	966.3904837	16.27415	14.79773	16.60343	16.37382	17.98219	17.21364	16.36974	16.83451	15.99347	16.57604	0	0	15.78961	16.15071	16.37644	17.30476	17.3382	16.73315	15.80945	0	0	17.24504	17.53239	16.4073	16.72378	16.2406	16.90676	17.26223	15.57982	0	16.91197	12.80166	14.35953	18.43105	15.97	0	16.50973	17.06771	17.27522	15.71995	16.4674	16.02803	17.09151	16.94267	17.51705	16.69003	16.16168	16.70582	16.17861	16.92008	0	14.68041	15.77905	16.65734
I3K013	I3K013_ORENI	LOC100694808	mitotic cell cycle [GO:0000278]	Aurora kinase (EC 2.7.11.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; mitotic cell cycle [GO:0000278]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	AVVTPTPHQR	13.35999966	1105.395209	12.18479	0	14.84184	0	0	0	14.91217	0	0	15.77517	15.2638	12.71893	18.05301	9.231699	13.53529	0	0	0	12.7771	0	12.25908	13.26279	14.91171	19.86172	13.39793	0	14.11316	0	0	15.24763	0	19.7544	14.78737	15.80452	13.6295	0	12.74053	12.89445	13.42981	14.59047	14.44608	14.11459	15.52336	18.42526	13.90572	0	18.21556	13.66035	14.73174	13.58569	15.30018	11.37301	0	14.58779
A0A669BCM4	A0A669BCM4_ORENI	atg5	autophagy [GO:0006914]	Autophagy protein 5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	phagophore assembly site membrane [GO:0034045]	phagophore assembly site membrane [GO:0034045]; autophagy [GO:0006914]		SQVVNDMQK	2.950000048	1062.045067	13.88993	0	13.0123	13.56273	12.71657	13.42396	0	0	17.62983	13.3358	10.89911	13.92919	14.69631	0	0	12.67918	0	11.00073	13.7195	0	0	14.43185	0	0	0	0	18.40695	11.23062	0	0	0	0	0	0	0	0	0	0	13.97898	12.24604	13.39358	0	13.14268	13.02879	14.48048	0	16.07459	13.86883	0	0	0	0	0	0
A0A669BZE3	A0A669BZE3_ORENI			Autophagy_act_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MFAATPLGAMTESGR	3.140000105	1556.429431	12.67318	13.6527	13.65454	14.95	8.342339	13.99484	12.11045	15.55571	14.81012	13.54176	12.60407	0	0	14.81565	0	14.55458	11.35276	13.16149	0	0	0	0	0	15.66677	13.45018	7.083526	0	14.2628	0	12.61517	0	15.76434	14.11472	13.16953	0	12.91751	14.98076	14.45094	13.86831	0	11.55939	13.55579	12.25188	7.983041	10.95502	13.79639	0	13.0789	0	13.25212	11.7369	13.38594	14.46275	0
I3IU91	I3IU91_ORENI	LOC100695880	negative regulation of canonical Wnt signaling pathway [GO:0090090]; Wnt signaling pathway [GO:0016055]	Axin-1 (Axis inhibition protein 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	beta-catenin destruction complex [GO:0030877]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	beta-catenin destruction complex [GO:0030877]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; beta-catenin binding [GO:0008013]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; Wnt signaling pathway [GO:0016055]	beta-catenin binding [GO:0008013]	EMHESAKANGR	1.700000048	1245.474615	11.96483	11.60379	0	12.10679	14.57043	0	0	11.8261	0	20.05394	0	14.98513	0	18.87428	13.93872	13.09122	11.65532	12.86157	0	12.38896	15.44908	13.39233	12.84308	0	13.89063	0	12.91073	0	10.11409	14.59736	14.8078	0	0	16.65907	10.76351	0	9.654196	11.07445	13.96828	13.51846	14.49749	0	11.41958	10.50225	0	0	13.16958	0	10.83162	9.326609	0	0	19.06125	18.68164
A0A669DHF8	A0A669DHF8_ORENI			B box-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	DYYWDGNR	6.960000038	1088.960636	9.296097	16.62657	11.49264	0	0	0	12.85234	12.09549	0	7.220024	11.60726	15.66072	0	9.468519	0	13.43883	0	0	15.2564	13.31601	15.26302	13.33335	15.03249	15.8405	13.27765	0	0	11.82848	0	0	13.58163	0	14.48746	0	18.39107	11.89971	0	0	12.21054	13.62206	0	0	12.97565	16.96534	10.33984	9.138272	0	0	14.68039	0	0	13.75388	16.67109	0
I3JYB8	I3JYB8_ORENI	BRF1	transcription preinitiation complex assembly [GO:0070897]	B-related factor 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]; transcription factor TFIIIB complex [GO:0000126]	nucleus [GO:0005634]; transcription factor TFIIIB complex [GO:0000126]; metal ion binding [GO:0046872]; RNA polymerase III general transcription initiation factor activity [GO:0000995]; TBP-class protein binding [GO:0017025]; transcription preinitiation complex assembly [GO:0070897]	metal ion binding [GO:0046872]; RNA polymerase III general transcription initiation factor activity [GO:0000995]; TBP-class protein binding [GO:0017025]	EEGTYK	2.220000029	725.9045935	0	16.32599	0	15.64073	0	0	0	16.36816	0	13.83367	14.63467	0	0	14.06642	13.88624	0	14.99044	0	0	0	0	0	0	0	15.80589	13.43147	15.28412	0	13.64972	0	0	14.6868	0	14.67791	14.94987	14.40561	15.6938	15.24214	14.83057	0	15.04943	16.16262	0	0	0	18.51628	0	0	16.63545	0	15.5174	15.37253	16.7342	0
I3KU87	I3KU87_ORENI	LOC100691323		B30.2/SPRY domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TPAASMMK	12.14999962	868.5475134	15.87795	0	0	10.73023	0	16.16278	15.8108	16.4778	0	17.213	15.00985	16.29022	14.82688	15.85411	15.67023	0	16.52074	14.3423	0	16.07679	15.9773	0	15.16202	13.90811	11.79241	15.87022	0	0	0	0	17.42517	0	18.16912	0	17.32695	14.54411	14.50214	13.69079	0	0	16.16453	14.8902	17.363	16.00897	15.68657	0	18.28683	0	0	0	0	16.24545	0	0
A0A669ET64	A0A669ET64_ORENI	bag1		BAG family molecular chaperone regulator 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		chaperone binding [GO:0051087]	chaperone binding [GO:0051087]	TVQVSVFVFPSDKTIMLYLK	8.989999771	2331.865038	22.88013	19.6224	0	0	17.07549	0	0	0	0	20.87896	0	21.82972	0	21.36478	0	0	0	21.56598	19.16161	17.14575	16.90652	0	17.88838	0	0	0	18.54902	16.56745	16.51052	16.03474	0	19.51027	19.00161	0	0	22.09065	15.86675	0	0	0	16.55861	17.68573	16.90859	16.51449	16.87617	0	16.44666	19.10377	15.99079	0	0	17.04295	0	21.30208
I3KV57	I3KV57_ORENI	bahcc1		BAH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		chromatin binding [GO:0003682]	chromatin binding [GO:0003682]	GSQSADMLHGSEKDASK	1.950000048	1763.804959	13.28661	11.87342	13.65335	12.52421	12.55451	12.13615	10.46165	11.19269	13.76923	8.405299	0	15.97024	14.34329	0	0	2.534425	0	0	12.9756	13.64433	11.12904	15.80037	15.51986	0	13.90285	11.5166	14.64738	0	10.35817	12.933	15.79285	0	15.92935	0	12.60382	14.90915	11.8467	15.29232	12.63545	13.87264	14.00248	14.49749	12.71264	14.88817	0	15.3966	0	14.74314	14.05904	0	15.4062	0	0	0
A0A669BEH7	A0A669BEH7_ORENI		plasma membrane organization [GO:0007009]	BAR/IMD domain containing adaptor protein 2 like 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		plasma membrane organization [GO:0007009]		MSGMNSDQLHR	2.029999971	1292.817177	10.49047	8.991361	12.207	12.56569	11.67169	13.10075	0	0	0	0	0	13.39997	11.26982	12.8664	0	0	14.83919	7.085032	0	0	11.89506	14.73476	0	13.88964	15.52604	12.29796	0	14.50937	14.30346	0	0	0	0	14.20788	0	0	13.92774	0	12.7419	0	0	0	0	0	0	0	13.69003	11.94898	0	0	0	0	13.43168	0
I3J1S2	I3J1S2_ORENI	bag6	apoptotic process [GO:0006915]; chromatin organization [GO:0006325]	BCL2-associated athanogene 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]; extracellular region [GO:0005576]; nucleus [GO:0005634]	cytosol [GO:0005829]; extracellular region [GO:0005576]; nucleus [GO:0005634]; apoptotic process [GO:0006915]; chromatin organization [GO:0006325]		MENTSFCYR	6.639999866	1223.287297	0	11.82746	13.49446	0	0	14.21985	0	15.84642	14.31582	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.18361	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DZQ9	A0A669DZQ9_ORENI	bcl9	canonical Wnt signaling pathway [GO:0060070]	BCL9 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; beta-catenin binding [GO:0008013]; transcription coactivator activity [GO:0003713]; canonical Wnt signaling pathway [GO:0060070]	beta-catenin binding [GO:0008013]; transcription coactivator activity [GO:0003713]	SGMEPGNGMGMFPR	3.25	1484.66372	0	14.93927	14.72966	14.25827	14.12579	0	15.07677	0	14.89985	13.34313	15.70998	15.25047	16.06996	0	0	0	15.11782	0	0	15.673	15.52517	15.27515	0	16.13039	14.7458	13.81788	0	0	0	15.4812	0	15.29356	15.88112	14.73877	13.75881	15.28393	14.97971	0	0	14.28784	0	0	13.61848	16.38995	0	0	0	0	15.48393	16.11729	13.73716	15.01771	15.79151	0
I3J1U0	I3J1U0_ORENI	LOC100704716		BED-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		DNA binding [GO:0003677]; metal ion binding [GO:0046872]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	CHHLQVGMDAAEEIGKMALVVPTVIR	8.239999771	2891.354748	0	17.22235	16.81609	0	0	18.11645	21.20651	0	0	0	0	16.6885	18.42163	0	0	0	18.31031	19.51897	16.78733	15.91818	12.98123	16.44506	15.96773	0	0	0	0	0	20.71745	22.35376	16.20443	0	16.84105	21.71506	14.88767	21.97771	14.42215	15.01714	15.68697	15.84238	14.23228	14.46376	14.10645	0	20.66087	14.31843	15.23868	15.72249	0	0	18.70407	0	0	0
I3L025	I3L025_ORENI	LOC100696102		BHLH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein dimerization activity [GO:0046983]	protein dimerization activity [GO:0046983]	MEGAWSTMSAGH	6.159999847	1263.49963	0	14.46368	16.82524	13.74249	9.644422	14.55931	0	15.31309	0	0	14.76168	16.30372	13.57066	0	0	0	0	0	15.99088	0	0	0	16.12174	0	0	14.57475	0	15.20085	0	0	0	0	17.02257	14.01937	15.9348	15.49527	16.5259	0	0	0	0	0	0	18.04138	0	0	0	0	17.95635	0	0	0	0	0
A0A669EWE9	A0A669EWE9_ORENI	BICD2		BICD cargo adaptor 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cytoskeletal anchor activity [GO:0008093]; dynein complex binding [GO:0070840]	cytoskeletal anchor activity [GO:0008093]; dynein complex binding [GO:0070840]	AMVTETMMK	6.460000038	1058.055804	13.03673	11.95052	12.0567	12.54428	14.16852	13.40685	13.68206	16.80799	14.97634	13.65791	15.061	10.40699	14.71153	0	0	15.49584	0	0	14.10464	13.7898	16.04893	0	0	0	0	0	0	0	13.00962	18.69805	0	0	0	16.97414	0	0	0	14.95901	14.72794	0	0	0	0	0	14.89944	13.62097	0	13.64116	14.71948	0	13.67849	0	0	0
A0A669CH91	A0A669CH91_ORENI	LOC102079774		BPI2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		lipid binding [GO:0008289]	lipid binding [GO:0008289]	INADSIRTK	8.489999771	1018.367897	0	13.19205	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21.1069	20.70991	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KR60	I3KR60_ORENI	lipt1	protein lipoylation [GO:0009249]	BPL/LPL catalytic domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein lipoylation [GO:0009249]		AAAAFSALMR	11.35000038	1024.51781	0	0	10.59294	0	0	0	0	0	0	18.20187	16.4657	0	11.82486	11.80087	0	13.98634	0	14.67891	11.86143	0	15.2909	0	0	14.69962	10.36645	0	5.682453	10.39591	12.50519	18.12397	12.58842	9.4381	14.51432	14.95189	12.6857	0	12.22237	12.19917	0	14.45008	14.97489	0	14.00053	12.45216	13.90678	12.58321	11.03106	13.29481	15.34573	14.60331	0	0	14.65757	0
A0A669C1V6	A0A669C1V6_ORENI		chromatin organization [GO:0006325]; double-strand break repair [GO:0006302]	BRCA1-A complex subunit RAP80 (Receptor-associated protein 80) (Ubiquitin interaction motif-containing protein 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	BRCA1-A complex [GO:0070531]	BRCA1-A complex [GO:0070531]; K63-linked polyubiquitin modification-dependent protein binding [GO:0070530]; chromatin organization [GO:0006325]; double-strand break repair [GO:0006302]	K63-linked polyubiquitin modification-dependent protein binding [GO:0070530]	IEMHAAYCDGEVAVVEER	3.25999999	2094.411713	12.94413	12.68299	13.79127	9.922347	0	11.96622	11.4852	7.686678	0	13.39527	10.22979	17.56621	12.74193	13.76521	15.18043	15.27746	0	11.44356	0	12.47861	0	13.51604	15.45477	0	10.18875	14.83637	0	13.35759	0	0	0	0	15.46371	11.33742	12.92188	0	0	0	0	0	12.82275	0	13.58099	15.50909	0	14.03677	13.06749	14.3035	0	0	8.108818	0	0	15.39201
A0A669DST4	A0A669DST4_ORENI	tnmd		BRICHOS domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		DVGIELDNR	3.25	1027.666329	17.50605	14.04234	0	0	0	15.91215	14.17416	15.68149	14.18076	16.90208	15.97012	15.05966	16.52477	13.97476	13.48677	13.52191	15.07751	13.97254	13.21348	15.617	14.10611	13.85906	0	0	16.42224	14.00737	12.40758	15.53816	15.2385	0	16.92937	15.56023	14.97361	15.03153	0	0	0	14.86096	14.98621	0	15.07351	0	17.05407	0	0	0	17.59532	16.0376	0	0	0	15.66953	0	0
A0A669BTT2	A0A669BTT2_ORENI	bsdc1		BSD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DFDLDMTEEEVQMALSK	1.169999957	2017.80697	13.1724	13.67814	0	10.89811	13.32941	12.32418	13.5716	0	0	15.63321	14.38854	12.91378	0	10.14667	14.59565	12.08098	12.05545	11.50031	11.8868	14.30571	0	0	13.66871	13.3049	12.69366	16.08355	12.84346	0	0	12.82952	0	0	15.34854	0	14.18459	12.80122	0	0	13.44952	9.436689	0	0	11.15416	13.31673	12.55417	0	0	9.864487	0	14.92295	11.43821	12.80699	0	13.80927
I3JE01	I3JE01_ORENI			"BTB and CNC homology 1, basic leucine zipper transcription factor 1 a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	MAFSFAQAELVK	10.55000019	1341.296911	0	14.16032	12.85234	12.38333	14.05059	12.51468	0	14.46486	0	12.24307	11.13276	0	0	12.64318	13.97745	12.77575	15.19618	0	12.46154	0	0	15.3394	0	15.04388	13.84151	0	7.006307	0	13.11124	13.49961	16.09146	0	15.66571	14.36144	0	0	0	0	0	10.69533	10.55709	11.56518	13.54157	15.72466	0	12.78887	15.07217	13.90283	14.38089	0	0	14.63828	11.85973	15.08633
A0A669EJF2	A0A669EJF2_ORENI	IPP		BTB domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]	actin binding [GO:0003779]	LILAQMNK	2.480000019	946.5385295	0	0	0	13.18217	0	0	12.50603	0	12.06761	0	15.79387	12.02188	12.60592	15.31169	0	15.21067	14.27264	14.86453	12.22049	13.55432	0	12.11791	10.41578	0	17.33718	12.08369	14.5638	15.6841	0	15.77651	15.17712	0	0	0	0	0	15.52861	13.99362	0	15.98431	0	0	15.67502	14.098	14.91069	15.00532	0	16.17453	0	15.394	0	16.95743	0	16.06173
I3KZ25	I3KZ25_ORENI	LOC100707270	circadian regulation of gene expression [GO:0032922]	BZIP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		DNA-binding transcription factor activity [GO:0003700]; circadian regulation of gene expression [GO:0032922]	DNA-binding transcription factor activity [GO:0003700]	MDHAEAMKNLPHK	8.890000343	1553.034632	0	0	15.05163	0	0	0	0	0	0	0	0	0	21.12827	0	0	0	0	16.58436	16.72905	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.76209	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669ENC1	A0A669ENC1_ORENI	LOC100695019	defense response to Gram-negative bacterium [GO:0050829]; immune response [GO:0006955]	Bactericidal permeability-increasing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]; membrane [GO:0016020]	extracellular space [GO:0005615]; membrane [GO:0016020]; lipopolysaccharide binding [GO:0001530]; defense response to Gram-negative bacterium [GO:0050829]; immune response [GO:0006955]	lipopolysaccharide binding [GO:0001530]	GYPLPTIGKMK	3.230000019	1220.928604	0	15.45493	14.69266	0	0	11.76053	0	0	0	0	14.55936	0	0	0	0	0	0	13.37769	12.17173	0	0	14.33838	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.2845	14.08959	0
I3JMK3	I3JMK3_ORENI		apoptotic process [GO:0006915]; regulation of cytokinesis [GO:0032465]	Baculoviral IAP repeat containing 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ubiquitin-protein transferase activity [GO:0004842]; apoptotic process [GO:0006915]; regulation of cytokinesis [GO:0032465]	ubiquitin-protein transferase activity [GO:0004842]	AIVNTARSMVSTIMK	4.210000038	1654.354896	14.50725	0	0	15.37367	15.15777	12.77744	16.50513	0	0	0	19.8186	0	14.37106	15.31649	15.44953	17.13473	16.48518	0	16.71208	0	0	0	0	17.25326	0	18.00624	0	0	0	13.514	0	0	0	0	0	0	0	0	0	0	20.53277	13.65207	0	0	13.78343	0	0	0	0	0	0	0	0	0
A0A669F1Z4	A0A669F1Z4_ORENI		cell cycle [GO:0007049]; cell division [GO:0051301]; cortical actin cytoskeleton organization [GO:0030866]	Band 4.1 (Erythrocyte membrane protein band 4.1) (Protein 4.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell cortex [GO:0005938]; cytoskeleton [GO:0005856]; nucleus [GO:0005634]	cell cortex [GO:0005938]; cytoskeleton [GO:0005856]; nucleus [GO:0005634]; calmodulin binding [GO:0005516]; cytoskeletal protein binding [GO:0008092]; cell cycle [GO:0007049]; cell division [GO:0051301]; cortical actin cytoskeleton organization [GO:0030866]	calmodulin binding [GO:0005516]; cytoskeletal protein binding [GO:0008092]	GPLLDFYSK	6.119999886	1039.012715	11.82239	0	0	13.73971	0	0	0	14.2158	9.920032	14.45333	16.34991	14.54772	0	5.928565	13.99261	10.63476	0	12.94496	17.56555	18.20693	13.12301	11.17529	0	0	14.44779	12.23065	14.65454	0	12.9492	0	16.626	15.62914	12.28582	12.47548	14.98123	14.10034	12.19899	14.14313	12.72448	14.18527	0	0	0	14.59017	13.9208	14.88727	16.3638	12.3163	17.85344	0	15.89859	12.67784	15.23313	0
I3KYQ8	I3KYQ8_ORENI		chaperone-mediated protein complex assembly [GO:0051131]; convergent extension involved in gastrulation [GO:0060027]	Bardet-Biedl syndrome 12	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATPase activity [GO:0016887]; chaperone-mediated protein complex assembly [GO:0051131]; convergent extension involved in gastrulation [GO:0060027]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	DHVDFSSSSK	5.039999962	1107.723212	9.098984	13.39853	15.69475	12.27705	10.82939	14.60362	10.92702	13.68813	14.82683	13.79656	12.74243	0	0	9.278131	18.11344	15.36591	15.40094	12.29602	13.08666	17.16984	14.88804	0	13.43303	0	13.59712	12.46168	17.19291	10.6527	0	0	0	14.76065	12.91479	11.90531	14.10881	13.44384	14.28431	7.912983	13.90635	12.4601	11.91028	0	10.85665	0	13.53829	12.37276	12.03344	11.48203	10.05693	13.37879	0	11.97921	14.75347	0
I3J622	I3J622_ORENI	BNC1		Basonuclin 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MGLVFPMSK	1.879999995	1022.277954	14.43272	12.59585	14.87205	13.069	12.67268	14.1976	0	0	15.14712	16.42021	15.2287	12.39579	14.27746	13.45841	14.21932	14.89549	12.00401	15.65481	15.57561	14.4496	12.42907	14.18521	16.81798	0	13.81554	12.85252	13.9573	13.45708	16.41528	15.56015	14.83684	14.65898	15.49407	11.40873	14.88023	13.90012	16.08782	15.58316	15.09222	14.19757	13.65271	15.16422	14.90202	15.76836	16.34126	13.94412	15.06715	15.52168	15.78075	0	12.24179	15.97193	15.94789	14.74171
A0A669C5S9	A0A669C5S9_ORENI		synapse assembly [GO:0007416]	Bassoon (presynaptic cytomatrix protein) b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	presynaptic active zone [GO:0048786]	presynaptic active zone [GO:0048786]; synapse assembly [GO:0007416]		HSSSRHTTEDSR	9.869999886	1399.829779	18.41263	17.0903	17.05807	18.6924	15.87699	13.83063	16.39387	16.49638	17.95214	16.60922	18.18801	18.42817	17.01008	17.64825	14.49986	0	15.96821	16.51848	0	14.82691	16.12428	15.9092	15.89566	16.77922	17.37745	0	0	0	17.66491	18.4861	16.79825	17.04039	0	18.70096	17.05564	18.97719	16.36143	16.55209	16.80513	0	0	0	18.34147	18.42459	14.13035	16.43681	16.45118	17.47687	0	0	0	16.66271	19.10931	0
A0A669BRJ2	A0A669BRJ2_ORENI	BEST3		Bestrophin homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chloride channel complex [GO:0034707]; plasma membrane [GO:0005886]	chloride channel complex [GO:0034707]; plasma membrane [GO:0005886]; chloride channel activity [GO:0005254]	chloride channel activity [GO:0005254]	TLVRYVNLTSLLIFR	9.920000076	1808.120625	0	17.44911	16.50231	16.86718	16.79554	0	15.83643	17.18035	0	16.21616	17.22839	0	17.17139	0	16.25801	0	16.86627	16.49936	16.72946	0	0	16.88749	17.26039	16.19657	15.10561	16.6929	0	0	0	0	16.02897	17.02457	0	0	0	16.21813	16.70218	0	0	16.25095	15.31734	16.64207	0	0	0	16.20177	0	16.13305	16.85325	0	17.0692	0	0	17.27997
I3KAY9	I3KAY9_ORENI	b4galnt4		"Beta-1,4-N-acetylgalactosaminyltransferase (EC 2.4.1.244)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi cisterna membrane [GO:0032580]; integral component of membrane [GO:0016021]	Golgi cisterna membrane [GO:0032580]; integral component of membrane [GO:0016021]; N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase activity [GO:0033842]	N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase activity [GO:0033842]	SDFDKIGGMNTEEFK	1.610000014	1733.747131	0	14.21083	13.92142	12.5737	12.21543	0	0	14.334	13.63702	0	14.17566	0	0	12.10452	14.2281	16.4416	12.51524	0	0	13.93772	13.71936	14.65831	12.43775	14.42847	13.11981	14.84103	16.02764	12.54737	18.75649	0	0	16.30324	14.37791	0	7.960145	0	14.37798	15.97435	0	17.59737	0	0	0	16.00448	0	9.505319	15.14181	0	0	0	0	0	0	0
A0A669DZQ5	A0A669DZQ5_ORENI	LOC100711747	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; blood vessel diameter maintenance [GO:0097746]; regulation of smooth muscle contraction [GO:0006940]	Beta-2 adrenergic receptor (Beta-2 adrenoreceptor)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; beta2-adrenergic receptor activity [GO:0004941]; adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; blood vessel diameter maintenance [GO:0097746]; regulation of smooth muscle contraction [GO:0006940]	beta2-adrenergic receptor activity [GO:0004941]	EHKAVK	5.880000114	709.6499516	0	10.67212	14.3492	14.36884	14.69171	16.2323	13.98779	0	13.83109	13.99022	0	13.45616	15.35161	14.50437	11.97151	0	0	14.39717	14.4249	14.57945	0	15.15786	14.71554	0	0	14.47899	0	0	13.73221	12.62982	0	19.5076	18.91418	0	0	16.52689	15.14239	0	15.17406	0	14.26178	13.10277	14.29542	14.55554	0	0	13.63571	13.45558	15.82102	14.50166	0	14.55007	15.5547	14.82773
A0A669CW91	A0A669CW91_ORENI	pmpcb	protein processing involved in protein targeting to mitochondrion [GO:0006627]	Beta-MPP (EC 3.4.24.64) (Mitochondrial-processing peptidase subunit beta)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial processing peptidase complex [GO:0017087]	mitochondrial processing peptidase complex [GO:0017087]; metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]; protein processing involved in protein targeting to mitochondrion [GO:0006627]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	NAPILKR	12.21000004	812.0594032	0	13.51874	16.45214	0	19.99262	21.32036	16.21316	13.70593	15.71714	15.43548	14.56784	15.15841	15.35217	15.80195	15.024	0	16.8816	16.9234	14.05566	16.96678	0	17.31942	16.92036	15.60535	16.31206	0	15.58401	0	0	0	16.66134	0	0	0	16.48201	0	0	15.4197	14.89818	0	17.13288	0	16.67547	0	16.33093	0	16.27556	15.66713	20.33214	20.26356	19.02673	0	0	0
A0A669D3R8	A0A669D3R8_ORENI	hexa	carbohydrate metabolic process [GO:0005975]	Beta-hexosaminidase (EC 3.2.1.52)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	lysosome [GO:0005764]	lysosome [GO:0005764]; beta-N-acetylhexosaminidase activity [GO:0004563]; N-acetyl-beta-D-galactosaminidase activity [GO:0102148]; carbohydrate metabolic process [GO:0005975]	beta-N-acetylhexosaminidase activity [GO:0004563]; N-acetyl-beta-D-galactosaminidase activity [GO:0102148]	EGCYLCEVR	1.950000048	1184.912731	7.443321	11.97707	0	12.23351	13.37481	12.94026	15.61452	12.14661	13.36172	11.63033	11.92172	14.15999	0	10.11716	15.40893	0	13.83032	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.29692	0	0	0	0	17.52061	0	0	0	0	0	7.788219	13.29714	12.8942	18.77321	0	0	0	0	13.59822
I3JVV1	I3JVV1_ORENI		fatty acid biosynthetic process [GO:0006633]	Beta-ketoacyl-[acyl-carrier-protein] synthase I (EC 2.3.1.41)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		2-oxoglutarate-dependent dioxygenase activity [GO:0016706]; 3-oxoacyl-[acyl-carrier-protein] synthase activity [GO:0004315]; methyltransferase activity [GO:0008168]; fatty acid biosynthetic process [GO:0006633]	2-oxoglutarate-dependent dioxygenase activity [GO:0016706]; 3-oxoacyl-[acyl-carrier-protein] synthase activity [GO:0004315]; methyltransferase activity [GO:0008168]	DFSSILP	8.5	778.7202264	15.82718	0	0	0	15.91353	0	15.02847	16.86818	15.86542	0	16.44925	16.58623	13.46405	11.02621	17.38834	16.41101	0	7.471368	0	13.6047	0	15.59284	15.67123	15.8517	0	0	0	0	0	15.15643	16.74872	18.07543	16.53349	0	12.96803	10.4718	15.1059	17.90188	14.73313	0	0	0	14.93606	0	14.79312	16.24261	15.58441	14.40274	16.99091	17.10786	18.63431	15.89321	16.75166	15.02076
I3KDM6	I3KDM6_ORENI	lactb		Beta-lactamase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				CSMLAAR	5.659999847	823.2838473	14.2654	13.39508	11.56422	13.7455	12.35054	13.26677	14.37878	0	13.26031	15.15211	15.07951	15.23395	14.29432	14.70599	12.35053	11.39656	0	13.83736	0	0	11.98196	12.52264	8.534303	15.62883	0	0	0	12.66428	12.05222	0	15.93421	16.13148	0	15.027	14.8003	15.73858	0	14.73132	0	0	13.85562	12.75125	15.27979	15.11692	13.95496	13.69769	0	0	0	0	0	14.20931	12.27686	14.0455
I3KX39	I3KX39_ORENI	nudt2		"Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] (EC 3.6.1.17) (Diadenosine 5',5'''-P1,P4-tetraphosphate asymmetrical hydrolase) (Nucleoside diphosphate-linked moiety X motif 2)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity [GO:0004081]; nucleotide binding [GO:0000166]	bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity [GO:0004081]; nucleotide binding [GO:0000166]	VLRACGFIIFR	10.56000042	1352.372055	0	13.39181	13.16107	13.57296	0	13.88914	12.74588	0	13.3356	9.718943	13.999	12.49289	9.594278	12.49421	0	0	15.76491	14.54207	11.55583	14.90559	14.06585	15.19347	0	16.31831	10.75005	12.60508	14.51982	12.85164	13.56218	14.18564	19.5863	19.63708	18.92834	13.14747	13.27006	11.13523	14.6537	0	0	14.82127	0	14.779	13.64961	10.95769	11.16492	14.17285	14.20078	14.83257	12.32942	17.26369	15.7204	14.92692	14.72658	14.32092
I3JLZ5	I3JLZ5_ORENI			"Bloodthirsty-related gene family, member 12"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	GTASQGSR	8.869999886	763.0064229	0	0	15.52646	13.29814	14.5899	14.85474	16.66098	15.72102	0	15.24469	16.50523	16.40346	15.79679	16.58023	16.30849	16.31614	15.59193	15.81928	17.57934	16.56398	17.01573	18.17392	15.13681	17.06835	15.74019	14.11413	16.14677	15.44909	14.83545	0	21.67981	21.6097	16.742	13.29488	15.27345	16.074	16.46333	13.71241	14.05983	14.9605	15.57719	14.55239	14.70947	14.86743	14.83963	15.74172	15.66145	17.34265	16.55038	17.67166	16.25256	16.51701	0	15.07522
A0A669D5X0	A0A669D5X0_ORENI			Bone morphogenetic protein 16	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]; SMN-Sm protein complex [GO:0034719]	extracellular region [GO:0005576]; SMN-Sm protein complex [GO:0034719]; growth factor activity [GO:0008083]	growth factor activity [GO:0008083]	CLLSMTNKK	2.24000001	1111.541113	0	13.61911	0	0	0	0	14.73634	0	13.54381	0	14.76531	0	0	0	0	0	12.14243	12.73691	9.916736	0	0	14.86442	13.85231	0	0	0	13.94829	0	15.37773	0	0	0	0	0	14.71506	0	0	16.80383	13.95857	14.26091	10.32595	0	0	14.29339	0	12.19887	13.54984	0	14.48707	18.69938	6.398927	13.35426	15.30626	13.78209
Q8AX81	Q8AX81_ORENI			Bone morphogenetic protein 4 (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				HVRXSR	7.889999866	768.2728723	0	15.08069	14.44279	13.82888	11.14536	15.01247	0	0	15.36536	17.30467	15.19425	0	16.62351	16.50912	16.1313	17.03694	16.57651	0	12.90986	13.94304	14.10428	0	13.30858	14.40219	12.29662	16.49842	13.34204	15.25618	16.47642	15.61841	0	0	12.96905	14.54278	16.05469	0	14.27305	0	0	14.87327	14.33919	14.8899	16.05578	0	0	0	14.50531	0	14.61911	0	15.27293	0	0	14.65387
I3KNN7	I3KNN7_ORENI	LOC100711936	plasma membrane organization [GO:0007009]; regulation of actin cytoskeleton organization [GO:0032956]	Brain-specific angiogenesis inhibitor 1-associated protein 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; filopodium [GO:0030175]; membrane [GO:0016020]; ruffle [GO:0001726]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; filopodium [GO:0030175]; membrane [GO:0016020]; ruffle [GO:0001726]; cytoskeletal anchor activity [GO:0008093]; plasma membrane organization [GO:0007009]; regulation of actin cytoskeleton organization [GO:0032956]	cytoskeletal anchor activity [GO:0008093]	GWFPFSYTRVITDGEGDSMR	6.980000019	2321.746067	16.95263	0	13.15648	12.38164	12.09973	14.52401	13.98654	12.99535	14.10004	0	0	11.53446	10.82543	14.11626	11.7356	12.42171	8.347358	13.85991	0	0	9.560349	0	11.60168	0	0	12.40378	0	12.7368	0	0	11.92867	0	11.83773	14.30532	8.862888	0	12.12771	13.03132	12.70222	8.231862	9.807789	14.45628	0	12.06141	0	11.13333	0	0	17.32157	0	0	11.17778	0	0
A0A669DDW4	A0A669DDW4_ORENI			Bridging integrator 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]		DEAKIAK	11.77000046	773.330691	0	16.38281	16.63786	16.4991	0	0	0	0	15.0871	17.71054	20.00772	0	15.59892	13.5706	0	0	0	16.47642	14.39599	15.27191	0	16.24691	17.09979	0	0	15.04827	0	14.88155	15.60955	14.85244	14.34984	17.08892	18.66808	0	0	15.64399	15.05168	16.38	0	0	0	0	15.35115	16.27032	15.97924	13.89538	0	16.14288	14.37375	0	14.94368	17.52567	0	0
A0A669C8Q4	A0A669C8Q4_ORENI		rRNA processing [GO:0006364]	Brix domain-containing protein 2 (Ribosome biogenesis protein BRX1 homolog)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]; rRNA binding [GO:0019843]; rRNA processing [GO:0006364]	rRNA binding [GO:0019843]	QRMQMAR	3.180000067	935.5756584	12.63211	14.27766	17.96404	16.18693	0	0	15.60362	14.76159	0	0	13.91768	17.49198	15.63762	16.2371	0	0	0	0	0	0	0	0	0	0	0	0	16.64066	0	0	15.43861	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669ESS5	A0A669ESS5_ORENI	atad2b		Bromo domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATPase activity [GO:0016887]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	QTASEPSSSDTSPSPQTK	8.359999657	1834.034898	14.88834	13.30136	12.36668	14.163	12.84435	13.12176	10.08097	13.81784	14.14511	15.60141	11.9095	13.24051	12.35595	11.87973	0	10.70625	0	12.30334	0	12.59023	7.280683	13.36798	10.55703	13.17062	12.72863	13.39507	15.88852	0	0	12.58444	5.544165	0	0	12.92746	13.38544	14.67016	10.90025	11.23909	11.53055	13.44549	11.53031	0	0	0	14.70041	0	0	15.3108	0	0	0	0	14.26711	14.56531
A0A669E3K6	A0A669E3K6_ORENI		regulation of transcription by RNA polymerase II [GO:0006357]	Bromodomain PHD finger transcription factor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	NURF complex [GO:0016589]	NURF complex [GO:0016589]; DNA binding [GO:0003677]; zinc ion binding [GO:0008270]; regulation of transcription by RNA polymerase II [GO:0006357]	DNA binding [GO:0003677]; zinc ion binding [GO:0008270]	DEEDDNLSYR	3.160000086	1256.075101	10.95253	12.274	0	0	12.29432	16.54132	14.92638	0	10.27269	10.06452	12.53116	13.55131	12.77136	12.33198	0	18.99317	0	0	13.93892	0	12.33531	0	13.48797	0	13.96762	12.80187	0	0	14.24827	0	14.41041	0	0	15.17342	0	11.9115	0	14.33818	0	0	0	0	13.516	0	11.9504	12.99128	9.501169	0	12.92119	0	13.97206	14.39779	0	12.73876
I3JZN7	I3JZN7_ORENI	BAZ1A		Bromodomain adjacent to zinc finger domain 1A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	NTSSLPLLLVETAAPRK	9.779999733	1809.554708	15.56042	0	15.476	0	15.79982	14.68418	0	12.18603	14.7232	0	14.57619	0	15.3814	0	0	0	0	12.26032	14.46841	12.50789	13.56837	0	14.21107	12.04185	0	11.25517	15.00247	0	14.78035	13.48036	0	0	0	0	0	0	0	0	15.17289	0	0	0	15.37776	15.74326	0	15.90643	0	15.23225	15.15815	16.35678	0	0	0	0
I3KK70	I3KK70_ORENI			"Bromodomain adjacent to zinc finger domain, 2A"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	GAAAK	15.22999954	416.056208	12.58375	12.51051	0	0	11.65017	0	12.44538	18.11743	14.13747	11.43011	13.11753	11.67854	12.18553	13.90989	13.8746	13.67592	12.41372	0	0	14.95144	0	0	15.15388	8.753688	13.74179	13.95157	0	19.88772	14.72299	0	14.65338	13.37496	0	0	13.52302	13.59956	14.78336	15.59593	15.71245	14.58904	0	0	18.61009	14.41554	15.16993	19.05194	17.40961	18.93771	0	16.80085	0	0	16.74676	0
I3JDB3	I3JDB3_ORENI			Bromodomain and WD repeat domain containing 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VVVPELPPSSYRDQEDVR	11.07999992	2085.733199	0	15.06483	14.05106	0	16.11763	16.05609	14.38515	16.27679	0	14.29574	0	16.0585	15.66662	0	0	11.50235	12.88923	0	12.65055	12.27292	0	0	12.90589	0	14.89185	16.04246	14.17119	12.48755	16.59534	0	13.85615	14.62707	15.07884	0	13.25324	15.17486	13.88298	14.71635	0	0	14.22585	0	15.6524	15.66894	17.03686	12.17232	15.54751	0	15.04027	0	16.15768	0	0	0
I3J800	I3J800_ORENI		chromatin organization [GO:0006325]	Bromodomain containing 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; metal ion binding [GO:0046872]; chromatin organization [GO:0006325]	metal ion binding [GO:0046872]	AGLCMKMEPVK	13.09000015	1294.781592	15.77481	0	0	14.67426	0	14.7348	16.31785	14.98713	0	16.19889	16.2273	13.45361	0	0	0	15.55232	0	14.31274	0	15.34208	14.45757	16.68951	15.19905	15.76871	16.75285	14.80886	14.5011	0	16.75893	0	11.92269	0	0	15.98832	0	0	15.92354	0	0	0	0	0	14.41275	0	0	0	0	0	15.90535	13.70886	14.48861	15.51794	0	0
A0A669E670	A0A669E670_ORENI	ivd	leucine catabolic process [GO:0006552]	"Butyryl-CoA dehydrogenase (EC 1.3.8.1) (EC 1.3.8.4) (Isovaleryl-CoA dehydrogenase, mitochondrial)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		butyryl-CoA dehydrogenase activity [GO:0004085]; flavin adenine dinucleotide binding [GO:0050660]; isovaleryl-CoA dehydrogenase activity [GO:0008470]; leucine catabolic process [GO:0006552]	butyryl-CoA dehydrogenase activity [GO:0004085]; flavin adenine dinucleotide binding [GO:0050660]; isovaleryl-CoA dehydrogenase activity [GO:0008470]	TDPEAYQK	5.550000191	950.4986224	11.37979	15.23298	14.82481	0	0	17.65076	15.68653	0	12.60189	14.20395	0	12.4815	17.21803	14.89822	15.08743	9.957994	14.42573	16.28034	17.26351	15.66762	17.01953	0	15.38211	13.73464	0	16.62704	0	0	15.50899	16.39248	16.8494	17.95279	0	15.48239	15.39599	0	0	0	15.04925	15.73345	14.57488	0	18.44734	13.41604	15.36384	15.8111	0	11.1441	16.82284	16.45585	15.60663	14.61482	15.19895	13.82058
I3JT96	I3JT96_ORENI	LOC100692110		C-type lectin domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				CWDDKGCHEHRPSVCVK	3.75999999	2165.705399	14.70373	0	0	0	12.99306	0	0	15.79014	0	0	0	14.54268	17.11651	17.13165	0	0	0	15.80958	16.24014	16.41668	13.55382	16.9723	12.91416	15.18752	15.22799	9.784673	14.87355	15.40318	14.70416	13.78841	16.16932	0	0	12.28563	14.87672	13.98032	15.38241	16.98246	14.3391	15.52751	13.03364	13.52203	0	14.87332	0	14.00377	0	17.2582	0	0	16.28653	0	0	0
I3JHV5	I3JHV5_ORENI	COL8A1		C1q domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]		GDKGMSGPPGSPGPK	9.390000343	1384.876299	0	0	14.61822	14.17409	16.21126	0	0	11.48597	0	0	8.73174	0	17.37263	0	0	16.0515	0	16.72899	0	15.51043	13.82135	0	0	0	0	14.61942	0	0	16.69387	0	0	17.29328	0	13.05308	0	0	15.02159	15.32162	13.80935	14.99658	0	0	13.00813	0	15.71756	0	0	0	15.97405	0	0	16.84822	14.90084	15.48455
A0A669EX48	A0A669EX48_ORENI	CC2D1A		C2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]"	"DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]"	NILSKK	26.51000023	702.0544619	0	18.59434	15.04317	15.61809	0	0	18.28726	0	12.1452	0	17.98839	16.94719	0	18.84418	0	0	16.72445	15.22477	15.66425	15.70526	0	15.95591	0	13.39025	16.43413	18.79597	15.5215	17.80194	0	0	0	0	0	17.98897	19.63264	15.96395	0	0	0	0	0	18.46692	0	17.47741	0	0	0	16.31525	0	16.06359	0	0	0	16.46405
A0A669E1S3	A0A669E1S3_ORENI	LOC100691227		C2H2-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GGEHER	3.119999886	684.3685577	12.72556	14.33918	13.46717	11.91546	17.20346	0	14.62035	13.27375	15.03901	15.45725	14.11898	16.82562	14.25058	12.37732	13.94023	12.84132	0	15.60307	15.10086	0	12.18889	13.68844	0	10.51104	14.24278	0	13.66371	13.19943	12.57387	0	0	16.97136	17.1028	15.1775	14.43951	0	14.88046	9.944702	13.91852	14.21588	0	0	15.7698	12.48127	14.07654	13.70243	0	0	0	15.75891	10.80021	12.29569	0	15.11557
A0A669CKZ8	A0A669CKZ8_ORENI	LOC100698093		C3H1-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		endonuclease activity [GO:0004519]; metal ion binding [GO:0046872]	endonuclease activity [GO:0004519]; metal ion binding [GO:0046872]	RPVIPEHR	10.07999992	1004.052963	14.66418	15.12459	12.0108	14.58613	13.12679	13.99816	0	17.11899	16.35091	12.19909	15.46843	14.38921	14.02384	15.36805	14.67946	11.19777	13.90461	14.06189	14.56614	14.26201	12.50403	14.41095	14.59283	0	13.62436	11.59119	15.39035	12.89945	12.32217	13.03957	12.02873	15.60501	13.9786	12.81511	15.21558	14.85817	15.52605	0	12.31839	0	0	16.50893	0	18.6315	19.54332	10.53372	0	15.39124	13.80204	15.60779	15.40681	0	16.21445	17.98224
A0A669BXF4	A0A669BXF4_ORENI	C9orf72		C9orf72-SMCR8 complex subunit	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	DVLTSF	2.839999914	681.2516075	0	15.4964	0	16.15666	17.9868	12.01081	16.83174	0	0	14.7281	16.97497	17.11366	16.73203	0	15.50961	0	15.74796	14.32876	0	15.33924	15.35019	15.84014	13.43071	15.21209	16.77386	15.71704	0	16.83428	0	0	15.0565	0	14.27505	0	0	0	0	16.00005	0	0	0	16.83693	16.05132	0	0	0	17.77637	0	0	0	16.51567	0	16.18649	0
I3JBC1	I3JBC1_ORENI	garem1		CABIT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LPQIVK	10.63000011	698.166638	15.2479	16.11879	14.86251	14.64566	0	15.25641	0	16.46708	0	19.46465	11.44646	16.27822	16.70582	16.13004	13.54508	15.69668	0	17.26451	0	0	13.83795	0	0	0	15.24197	0	0	8.558238	16.52213	14.9979	15.69377	0	0	0	17.4627	14.66244	0	0	15.72889	0	17.30101	0	15.2368	15.33726	0	0	15.98284	16.50257	0	0	0	16.17273	0	0
A0A669DXC6	A0A669DXC6_ORENI	LOC100697803		CAP-ZIP_m domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NSPSKPSVAELAGK	4.389999866	1385.60567	10.60781	11.87323	10.65254	0	0	0	11.03194	0	11.49484	0	0	9.699115	10.92514	0	11.04165	12.858	17.3763	7.243607	0	0	0	0	12.98281	12.20485	14.64806	14.10158	0	0	11.48409	12.98106	12.37003	0	15.07543	0	0	0	0	0	0	12.50485	0	13.31431	0	8.814913	0	0	0	0	9.299603	0	15.0249	0	13.10938	9.575519
I3KS50	I3KS50_ORENI		regulation of apoptotic process [GO:0042981]	CARD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		regulation of apoptotic process [GO:0042981]		EEMDSAR	3.769999981	853.0463561	15.11139	15.34315	0	0	16.98162	0	0	0	12.73878	13.25359	16.13931	15.06533	15.8978	12.34581	13.54788	16.77433	17.20583	13.46847	16.05313	0	0	13.36022	14.3847	0	0	15.87186	16.12661	0	0	0	0	0	0	0	0	0	15.64816	0	0	0	0	0	0	14.81694	0	16.84629	13.79997	0	0	0	0	16.75135	0	0
A0A669E0T9	A0A669E0T9_ORENI	LOC100695417		CASPASE_P20 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cysteine-type endopeptidase activity [GO:0004197]	cysteine-type endopeptidase activity [GO:0004197]	GNHCKGLVGKPK	11.43000031	1294.77832	0	12.35364	0	0	13.73011	12.15756	18.35961	14.96169	12.02933	0	0	11.96013	0	0	10.26067	6.045818	0	0	13.31549	15.03909	14.49865	0	12.32857	15.5374	14.29655	13.61194	14.28499	17.20276	8.789553	13.67013	12.96186	0	12.14062	0	0	0	7.536885	15.09949	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.07264	0
I3J7D9	I3J7D9_ORENI	noc4l	ribosome biogenesis [GO:0042254]	CBF domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; nuclear membrane [GO:0031965]	integral component of membrane [GO:0016021]; nuclear membrane [GO:0031965]; ribosome biogenesis [GO:0042254]		LPNSMYKK	5.940000057	981.2976122	15.45974	10.04861	12.18859	14.54757	12.45897	0	12.9871	0	11.71562	15.29277	15.6606	0	13.52373	17.2439	0	15.81073	14.65538	0	13.92049	13.6166	16.48369	0	12.1055	15.58123	16.66544	16.24814	16.28189	0	0	12.36258	0	0	14.23213	13.4408	0	14.9584	0	13.49261	13.43624	13.53109	0	11.4869	0	16.6077	14.55945	0	13.65496	0	0	0	0	0	16.10344	16.71344
A0A669E3J5	A0A669E3J5_ORENI	pole3		CBFD_NFYB_HMF domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein heterodimerization activity [GO:0046982]	protein heterodimerization activity [GO:0046982]	KTLNAGDVLAAMEEMEFER	11.13000011	2152.834311	13.27162	0	14.63041	0	0	13.9216	13.5323	0	0	11.64584	11.90697	13.23494	18.33186	11.92775	14.19604	13.36494	12.51437	0	0	14.11164	14.11522	0	13.18634	0	0	11.48574	14.64247	12.76645	0	0	0	13.26031	13.40922	13.0047	17.43229	0	13.27659	0	0	13.21757	12.56394	11.56774	0	17.42683	0	0	0	12.01364	0	12.53373	18.81125	0	0	0
A0A669F1E8	A0A669F1E8_ORENI	stbd1		CBM20 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; starch binding [GO:2001070]	starch binding [GO:2001070]	GEGSLDVEDTALK	21.70000076	1333.615838	18.17055	21.19756	16.52195	19.20021	0	21.84805	21.69949	17.92898	21.31747	20.71411	16.04198	21.31665	0	21.07765	21.30122	20.57582	20.12391	20.23423	21.13638	20.76132	20.51996	21.12707	21.06313	0	21.9065	0	0	0	20.73032	19.8931	20.77269	0	19.80312	20.19188	17.36687	0	18.07297	13.90193	17.31789	0	0	0	17.01482	21.0129	0	16.55418	18.84197	18.09798	0	16.42493	17.16483	22.04012	21.41448	0
I3JED9	I3JED9_ORENI			CCCTC-binding factor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KPPKPTKIK	3.339999914	1034.273622	10.60301	14.61395	0	14.44629	0	0	14.43419	0	14.44239	16.08915	11.95483	13.8196	17.03648	13.17925	14.20837	11.59234	18.10408	12.82531	15.23932	18.12844	15.77615	14.97474	0	0	0	14.426	0	0	14.12205	15.65479	0	0	0	15.69168	0	14.5605	13.10626	0	14.28287	17.66954	15.94665	0	13.52732	14.14606	17.75401	15.27992	14.09015	14.88416	15.27552	14.60889	19.87612	0	0	13.89488
A0A669EJJ6	A0A669EJJ6_ORENI	LOC102079932		CCDC92 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SLREEER	8.729999542	917.6896095	14.49505	11.26953	13.55705	14.37779	11.87475	12.74728	14.49457	0	0	13.32185	14.68813	13.9843	14.90546	7.217113	0	14.93721	17.3756	13.43439	14.45851	14.88421	0	12.88735	15.80495	0	13.74256	0	13.60868	0	0	13.01322	14.8621	0	12.51742	14.05144	11.05438	13.7975	15.14273	0	10.86776	16.62229	15.40957	12.82286	0	15.19055	15.10564	14.12991	14.62612	14.51413	15.61704	15.42204	15.41605	0	0	0
I3IVM4	I3IVM4_ORENI	ikbkg		CCHC NOA-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; K63-linked polyubiquitin modification-dependent protein binding [GO:0070530]; metal ion binding [GO:0046872]	K63-linked polyubiquitin modification-dependent protein binding [GO:0070530]; metal ion binding [GO:0046872]	MEQMKMR	7.300000191	969.6721763	13.87192	13.30616	14.78259	14.67933	13.76088	12.6962	0	13.53573	0	14.4367	14.29652	15.36236	13.73175	15.57238	12.29362	14.69089	14.46418	14.82998	14.24583	14.74535	0	13.62978	14.25669	14.14313	0	12.98471	0	14.35307	14.55129	14.50226	0	13.4331	14.02709	13.62398	0	14.29863	12.01873	15.11189	13.8857	14.36697	11.3296	13.12768	14.59325	0	14.66542	13.12812	0	0	14.47694	0	15.54809	0	0	13.49057
A0A669FAU6	A0A669FAU6_ORENI	srek1ip1		CCHC-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	MAVPGPNK	6.269999981	825.7184338	13.40903	0	0	15.22938	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19.17479	0	0	0	0	0
A0A669BKE4	A0A669BKE4_ORENI	ccm2l		CCM2_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DDALHLLVLK	7.809999943	1134.444644	0	0	13.159	0	0	13.87822	13.81181	8.367089	12.04714	11.52617	11.39343	13.44361	13.82778	11.29417	12.61944	12.51547	12.44056	0	0	8.509996	0	16.75827	0	0	0	0	14.7664	14.73657	12.21679	16.84898	12.39565	16.39157	0	0	0	0	13.64159	0	14.04042	15.6532	0	0	0	17.40204	0	13.29673	17.67238	12.50445	12.27723	15.77765	15.78676	0	13.50239	14.91059
A0A669AYB9	A0A669AYB9_ORENI		gene silencing by RNA [GO:0031047]; regulation of translation [GO:0006417]	CCR4-NOT transcription complex subunit 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	CCR4-NOT complex [GO:0030014]; cytoplasm [GO:0005737]; nucleus [GO:0005634]	CCR4-NOT complex [GO:0030014]; cytoplasm [GO:0005737]; nucleus [GO:0005634]; gene silencing by RNA [GO:0031047]; regulation of translation [GO:0006417]		ALHLLTVLDK	5.300000191	1122.349976	0	0	9.53644	10.98879	13.7448	13.62186	13.79099	0	13.95775	13.0449	14.89356	11.82882	17.61461	18.02092	11.50959	12.58787	13.96798	12.00039	12.20636	10.07997	10.2765	11.81284	11.69308	17.49886	12.71281	0	13.45474	14.37953	13.38061	14.29994	0	13.49134	14.16462	0	0	12.9933	13.17768	12.32743	16.91702	12.37368	11.89022	13.45693	0	0	0	0	6.398481	14.06353	0	0	14.6054	0	13.40025	17.58483
A0A669BEZ3	A0A669BEZ3_ORENI	cnot9	mRNA catabolic process [GO:0006402]	CCR4-NOT transcription complex subunit 9 (Cell differentiation protein RQCD1 homolog)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	CCR4-NOT complex [GO:0030014]; P-body [GO:0000932]	CCR4-NOT complex [GO:0030014]; P-body [GO:0000932]; mRNA catabolic process [GO:0006402]		IMSYAPLAQVDR	13.76000023	1364.521935	11.39358	9.483065	11.95321	10.31224	0	11.46327	0	0	12.92616	0	0	0	0	13.51388	11.41849	10.89056	0	0	0	13.10289	8.520389	0	18.24494	0	12.34817	0	0	0	12.5363	0	0	0	0	0	0	0	0	11.81408	0	13.02081	0	0	0	0	0	0	0	0	0	0	0	0	12.33783	12.89584
I3JB45	I3JB45_ORENI	cct8	protein folding [GO:0006457]	CCT-theta (T-complex protein 1 subunit theta)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; unfolded protein binding [GO:0051082]; protein folding [GO:0006457]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]; unfolded protein binding [GO:0051082]	KDFDEDD	4.659999847	883.6907811	12.23056	12.86567	0	14.21524	14.94038	12.37204	15.90943	0	0	14.40232	14.86342	0	13.79829	14.59899	13.36185	12.53766	13.84782	13.35856	15.46824	0	14.02372	0	15.20724	0	12.5915	0	0	0	0	13.53853	15.5019	0	0	0	0	15.10391	14.18811	0	14.22437	14.93523	0	13.26661	14.39117	13.2501	14.44943	16.61258	14.47178	13.91208	14.3519	15.37776	0	16.42644	14.18021	13.3691
A0A2D1WBF3	A0A2D1WBF3_ORENI	CD80 86		CD80/86	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		NTSSVFMDNLK	5.300000191	1255.172415	14.46286	14.32506	0	13.71316	0	0	12.52554	12.09019	13.14908	13.45996	14.59073	13.85822	12.8848	15.52268	0	0	0	0	14.93872	16.74518	0	0	0	0	0	0	17.80363	16.73687	0	0	15.30604	0	0	14.72243	14.90523	14.21962	0	15.1846	0	16.79864	0	0	14.91582	0	15.49214	0	0	0	0	0	0	0	16.49663	17.65234
A0A669BZ46	A0A669BZ46_ORENI	C15orf41	erythrocyte differentiation [GO:0030218]	CDAN1-interacting nuclease 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		erythrocyte differentiation [GO:0030218]		FLQGQDGGMPSK	3.799999952	1281.399132	0	0	14.76794	0	0	13.0391	0	0	15.56237	0	0	16.55783	15.32561	0	14.79456	0	0	7.126892	0	14.9491	0	13.11741	0	0	16.90284	15.4914	0	0	0	0	0	0	15.30206	0	0	0	0	0	16.01792	0	0	0	0	0	0	15.50992	0	0	0	16.43787	0	13.17407	0	0
A0A669E293	A0A669E293_ORENI			CDC-like kinase 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	NVEKYK	6.800000191	781.3798878	0	0	0	0	0	0	13.06005	15.88879	14.41218	16.57893	0	14.91308	14.85272	14.84879	14.83031	15.48382	15.53881	14.61118	10.62975	14.80733	14.66294	16.18525	12.68052	15.78533	11.87356	14.765	15.46795	12.13232	14.00079	10.59719	17.46504	16.92532	14.89617	15.81482	13.77981	16.53603	14.60421	15.08173	12.33135	16.14661	16.09566	12.17921	17.86553	12.56881	9.491055	13.64471	12.73307	12.99655	17.91842	0	18.72633	0	0	0
A0A669D7C2	A0A669D7C2_ORENI		cell cycle [GO:0007049]; cell division [GO:0051301]; regulation of mitotic metaphase/anaphase transition [GO:0030071]	"CDC23 (cell division cycle 23, yeast, homolog)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	anaphase-promoting complex [GO:0005680]	anaphase-promoting complex [GO:0005680]; cell cycle [GO:0007049]; cell division [GO:0051301]; regulation of mitotic metaphase/anaphase transition [GO:0030071]		IDNMDTFSNLLYVK	3.559999943	1689.507042	14.9636	14.71593	14.92766	13.00484	14.38119	14.81597	0	0	14.01894	16.03702	16.24784	0	15.37346	15.26687	14.42002	0	16.82628	0	13.99978	0	0	15.06948	15.26357	14.57789	0	0	14.86365	15.68743	15.65502	0	16.0176	16.26985	14.77161	15.40339	14.76095	14.01011	0	15.33047	15.16142	16.14394	14.70499	15.72554	15.02391	15.38084	11.2057	16.75146	16.09293	16.74749	0	15.56184	15.45856	15.93372	12.43457	0
I3KS57	I3KS57_ORENI		actin cytoskeleton organization [GO:0030036]; cell migration [GO:0016477]	CDC42 binding protein kinase beta (DMPK-like)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; lamellipodium [GO:0030027]	cytoplasm [GO:0005737]; lamellipodium [GO:0030027]; ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; actin cytoskeleton organization [GO:0030036]; cell migration [GO:0016477]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	FEDRLPEDMAK	11.21000004	1350.105538	0	14.39858	0	14.25121	0	0	0	0	0	15.36606	16.07431	0	0	12.63032	0	0	0	15.43099	15.3487	18.33584	14.09842	0	9.176771	13.98537	0	0	13.61989	14.29804	10.54265	15.07544	18.59278	18.66454	17.69676	13.78278	14.59855	0	13.68035	13.10948	14.42999	13.81812	0	12.4791	0	0	7.044442	13.29807	0	14.9742	0	17.40582	17.80984	14.70477	0	16.00669
A0A669CR29	A0A669CR29_ORENI		mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	CDC5 cell division cycle 5-like (S. pombe)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	spliceosomal complex [GO:0005681]	spliceosomal complex [GO:0005681]; mRNA processing [GO:0006397]; RNA splicing [GO:0008380]		STLFGGAMTPR	2.25999999	1154.025911	0	12.9078	0	12.73272	9.741505	0	9.58894	14.35779	14.37741	13.43548	14.07831	15.62609	0	13.84934	15.17331	17.49951	15.95435	14.17257	0	0	0	0	0	14.86832	13.90987	13.96409	12.19779	14.10427	0	14.42883	0	14.29616	0	0	9.609501	0	10.73296	14.76043	0	0	14.26631	14.31618	14.02365	0	0	12.72379	0	0	15.59769	13.68	11.10925	0	0	0
I3JVM5	I3JVM5_ORENI		ubiquitin-dependent protein catabolic process [GO:0006511]	CDK2 associated cullin domain 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ubiquitin protein ligase binding [GO:0031625]; ubiquitin-dependent protein catabolic process [GO:0006511]	ubiquitin protein ligase binding [GO:0031625]	HVNTLMPLLIK	6.659999847	1279.203914	0	0	0	0	0	0	0	0	16.92466	9.230169	10.72183	0	11.163	0	14.42196	0	0	0	0	12.08056	0	0	0	12.79866	19.43974	0	0	0	0	0	0	13.36866	11.70464	13.81031	11.77562	12.5471	12.72784	11.81984	9.683524	12.83763	7.308437	0	12.20624	14.39218	13.43437	9.979305	13.35192	13.71685	0	0	0	9.354924	0	13.94547
I3KKZ2	I3KKZ2_ORENI			CDKN2A interacting protein N-terminal like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EMAEGIVVEDAPVFKTR	4.289999962	1907.424688	13.1673	14.02722	0	5.829066	13.99899	14.08036	15.35917	13.88764	15.48856	0	14.68003	0	10.3515	18.12561	11.08585	13.24783	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669EC25	A0A669EC25_ORENI	CEP170B		CEP170_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TPRTLTQQVLTR	6.800000191	1414.43044	16.36769	15.32468	0	0	10.37051	14.49002	15.14192	13.59939	16.17788	14.80605	13.91421	0	0	15.40579	0	14.1647	14.96845	14.20283	14.2491	14.43427	13.98169	15.31877	15.03369	15.91098	15.58013	13.21951	15.23955	0	0	0	16.26174	0	18.08093	0	11.66306	0	15.1141	0	15.10411	15.58579	0	9.95383	15.17955	16.58253	13.33652	20.74107	0	17.16778	14.90865	14.85255	0	15.00987	16.25136	15.38966
A0A669CYD6	A0A669CYD6_ORENI	cep290	cilium assembly [GO:0060271]	CEP209_CC5 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell projection [GO:0042995]; centrosome [GO:0005813]; cytoplasm [GO:0005737]	cell projection [GO:0042995]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; cilium assembly [GO:0060271]		VTSFMTR	5.019999981	841.0402518	0	14.49504	15.09758	15.06525	0	15.17319	0	15.23246	12.57726	15.87311	8.805846	13.68115	13.41034	11.68215	0	15.23191	14.49872	11.89551	14.08016	13.26382	15.03117	16.1688	0	0	15.05676	14.45146	0	13.50956	16.14996	0	13.39552	15.52419	0	15.33278	13.9485	15.65256	0	0	0	14.83914	13.64526	0	10.68598	15.71264	0	14.29346	0	0	16.09744	0	14.95649	14.81932	13.61277	14.19733
A0A669E5Z5	A0A669E5Z5_ORENI	LOC100695844		CHCH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ALDAFYKEQLAQLEK	5.139999866	1765.922448	13.2559	0	13.15498	14.27321	13.22394	10.94821	0	7.235778	0	12.32138	0	14.75992	0	0	13.14095	0	13.63625	13.91111	13.42676	9.773327	10.92129	14.00696	0	0	13.64349	12.53446	0	0	12.78913	0	18.2057	0	0	13.53666	13.13284	13.0865	12.37627	15.2049	0	13.43967	12.4682	14.09228	14.11777	0	14.56255	0	14.46133	14.99874	14.75611	0	14.52	14.81311	0	0
I3JBE8	I3JBE8_ORENI	chek1	intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; mitotic G2 DNA damage checkpoint [GO:0007095]	CHK1 checkpoint homolog (EC 2.7.11.1) (Checkpoint kinase-1) (Serine/threonine-protein kinase Chk1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; mitotic G2 DNA damage checkpoint [GO:0007095]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	IHLLDMNQR	7.630000114	1154.810993	12.87983	11.30802	12.80585	7.253697	0	13.69695	18.40268	13.73503	12.25492	14.38704	14.02006	14.17015	14.17041	0	12.38321	10.3554	0	12.67872	14.60816	12.73723	0	15.31837	14.58601	13.97724	0	0	0	18.61025	0	0	0	13.83678	18.46253	13.21179	0	0	12.19259	12.41261	13.66276	14.07194	0	10.47905	12.6459	10.98918	14.38398	10.97378	15.00024	12.89171	12.46773	0	0	0	11.45763	0
I3KTC6	I3KTC6_ORENI			CHZ domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		MSEWANLQGIISDDADSD	3.50999999	1981.708122	0	0	0	16.00603	11.57165	0	14.24626	0	13.15012	13.14808	16.34556	0	0	0	0	0	14.64731	0	0	15.86794	15.20564	15.7357	14.96623	0	12.47182	0	13.18839	0	0	0	0	0	15.96197	0	0	13.54387	0	12.58253	0	15.40382	0	0	15.80169	13.45363	14.65068	0	0	0	0	0	13.49984	13.28162	0	12.41005
I3JHL3	I3JHL3_ORENI	dffb	apoptotic DNA fragmentation [GO:0006309]	CIDE-N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; deoxyribonuclease activity [GO:0004536]; apoptotic DNA fragmentation [GO:0006309]	deoxyribonuclease activity [GO:0004536]	HADSLIEAAK	11.76000023	1054.415465	15.95999	12.26293	9.660741	13.14532	10.29752	11.59559	14.57622	12.8452	13.46014	12.84101	13.13259	15.39639	14.16042	12.79453	14.13007	12.47413	13.95103	12.36399	7.974665	11.05349	9.895873	15.00753	10.67219	0	12.86423	13.7136	0	15.47835	11.30711	13.84064	14.85234	13.74804	14.21827	14.11317	12.99487	12.02678	14.45925	0	15.38308	0	13.18613	0	0	0	14.9623	0	14.8934	0	18.13214	0	14.07597	0	0	0
A0A669B0N1	A0A669B0N1_ORENI	btd	nitrogen compound metabolic process [GO:0006807]	CN hydrolase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [GO:0016811]; nitrogen compound metabolic process [GO:0006807]"	"hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [GO:0016811]"	GDPEGR	8.319999695	630.9559637	11.51962	11.53391	13.06819	16.09232	14.33623	0	12.83287	0	0	16.71044	0	16.02775	16.30309	16.63794	15.21857	15.83767	15.50004	17.26335	16.44888	17.42443	16.33969	13.67173	16.15225	0	0	16.62304	0	15.57446	15.69207	14.99432	0	16.84675	17.04013	0	0	18.39111	15.08888	0	0	0	0	17.00405	0	16.2441	16.2719	16.99509	16.75269	14.94909	0	15.14371	16.31857	0	0	15.77581
A0A669CUU9	A0A669CUU9_ORENI	tgfbrap1	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	CNH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]		DPIIGVRVFTK	14.27000046	1244.788073	11.7616	0	12.58017	0	0	13.76425	11.65847	14.77891	0	13.7907	0	0	0	17.82848	13.49118	9.865568	0	0	13.07038	13.79078	0	0	0	14.76562	11.02256	0	12.62488	12.83187	10.49804	0	19.81793	19.29876	19.14064	14.5366	0	0	12.38094	0	0	0	13.09668	0	0	0	0	0	0	0	0	0	0	12.16742	0	9.635858
A0A669BGB8	A0A669BGB8_ORENI			COP9 signalosome complex subunit 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	COP9 signalosome [GO:0008180]; cytoplasm [GO:0005737]	COP9 signalosome [GO:0008180]; cytoplasm [GO:0005737]		GEWGFK	6.340000153	723.5870928	0	15.1406	14.33923	14.81629	15.1515	14.07418	15.20745	14.60724	15.03428	14.35402	0	16.90601	14.76355	16.05828	15.16605	15.21831	15.04627	13.22641	14.99615	14.42317	11.60314	11.90722	15.54107	14.74989	11.24231	15.47361	15.40871	15.73073	14.50918	0	16.61269	0	16.88478	15.38455	14.28522	14.75132	14.92634	13.89674	15.38212	15.23639	15.56044	14.93649	11.53895	15.80748	14.06291	14.23399	14.83258	13.95307	15.41258	16.02344	15.08637	15.18425	15.111	15.23796
A0A669B3D0	A0A669B3D0_ORENI	cops4		COP9 signalosome complex subunit 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	COP9 signalosome [GO:0008180]; synaptic vesicle [GO:0008021]	COP9 signalosome [GO:0008180]; synaptic vesicle [GO:0008021]		QAAPEWAAQAMETQMTQ	1.230000019	1908.040967	15.03675	0	0	0	13.6222	0	0	14.65497	16.38948	15.05077	16.16446	0	0	16.62615	15.52116	0	0	0	0	18.41845	16.54234	0	17.57811	0	15.99389	16.6455	15.84989	15.85822	0	16.56005	16.06546	0	15.23711	14.63082	13.60489	15.29948	0	17.26552	15.42822	16.40561	15.19513	12.65492	15.77485	17.50347	0	15.41042	0	0	0	0	0	15.65004	16.57678	0
A0A669DJ29	A0A669DJ29_ORENI	COPS6	protein deneddylation [GO:0000338]	COP9 signalosome complex subunit 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	COP9 signalosome [GO:0008180]; cytoplasm [GO:0005737]	COP9 signalosome [GO:0008180]; cytoplasm [GO:0005737]; isopeptidase activity [GO:0070122]; metallopeptidase activity [GO:0008237]; protein deneddylation [GO:0000338]	isopeptidase activity [GO:0070122]; metallopeptidase activity [GO:0008237]	LPVLSTIK	3.690000057	871.6935485	13.15358	12.12723	13.96698	12.76388	12.73872	11.43059	0	12.38307	12.22	13.07528	14.72563	14.16383	14.40072	12.49562	10.74974	10.81826	0	0	14.71811	12.81915	12.45376	14.365	14.20075	14.19055	14.07296	13.42599	8.56167	13.12262	12.948	0	14.64522	16.34764	10.95317	15.62422	12.37747	14.89531	12.06521	14.35786	14.08768	11.7913	13.854	10.59577	14.89285	13.04296	14.57776	14.67181	11.29404	13.88909	13.58343	13.52189	13.96286	13.96935	0	15.05034
A0A669BXY2	A0A669BXY2_ORENI	LOC102080527		COesterase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cholinesterase activity [GO:0004104]	cholinesterase activity [GO:0004104]	AGTAVGSKPLWPTSPCHR	9.359999657	1922.54646	12.93596	0	12.30322	14.11283	0	10.4353	8.922752	13.28421	13.2177	14.43454	10.82935	0	13.18845	15.04289	12.08287	14.98963	14.35589	14.75021	13.48796	10.05518	0	13.72408	14.59771	14.7604	13.6036	12.6467	13.50324	14.66051	13.17411	17.87214	18.45533	16.27483	17.18902	15.10517	9.039022	0	14.3471	14.41712	15.27452	11.78672	12.50973	0	0	0	0	16.23171	20.19922	0	0	13.76561	15.66026	14.25171	14.60866	15.11141
A0A669BC27	A0A669BC27_ORENI	gnl1		CP-type G domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	MPGSISTK	4.539999962	837.3047341	12.98216	13.26613	13.03638	13.28167	0	14.00861	10.65093	16.00382	14.14832	13.96167	14.74994	14.62696	13.47536	13.97932	0	7.17774	14.41189	15.25597	15.09182	14.06194	14.35076	13.16538	13.47831	16.21724	14.82496	13.45636	15.94159	9.435667	12.04857	0	15.61721	14.78824	14.76066	11.6677	14.45401	13.41726	14.14948	12.53803	11.62039	13.76166	14.67999	0	10.35178	0	0	0	13.22084	0	16.24578	16.17446	0	14.71572	11.88275	0
I3IZK9	I3IZK9_ORENI	LOC100698705		CRAL-TRIO domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				HQSWVAFIK	9.520000458	1113.528096	18.7261	17.11307	0	0	17.21808	15.47015	19.85489	18.1919	0	0	0	19.42232	16.46772	0	0	0	0	15.76557	15.52816	0	0	0	0	0	18.22888	16.50488	0	0	0	0	0	0	0	14.79938	16.5468	0	0	0	0	0	0	16.27809	0	0	0	0	0	0	14.62374	0	0	13.93372	19.12996	0
A0A669E2B4	A0A669E2B4_ORENI	LOC100710529		CRC domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		DVGMFCESK	1.539999962	1073.366962	11.44232	13.46824	12.91471	14.61389	11.46851	13.33629	15.55954	8.056854	0	13.38412	0	15.97843	12.08616	13.98835	13.55149	14.45099	15.10962	0	15.62839	0	14.98885	20.11899	0	15.26526	5.492573	0	15.42373	0	10.82327	12.82692	0	12.37445	11.90672	0	0	13.30705	9.755219	0	0	14.07891	14.53316	13.56744	11.43313	14.78282	18.23	8.916372	13.69892	12.95269	21.18835	16.65657	12.50765	13.68308	12.7359	0
I3KZQ2	I3KZQ2_ORENI	ucn		CRF domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; hormone activity [GO:0005179]	hormone activity [GO:0005179]	NMIQMAKMESQR	6.420000076	1482.774735	0	0	13.74244	16.12785	10.46581	11.59616	15.63524	12.7983	15.60639	13.70411	0	0	13.40338	13.92894	0	0	16.21901	0	16.31878	0	0	0	14.10889	15.94549	14.62592	0	0	0	14.62918	14.48623	12.17996	0	0	16.05177	13.81887	15.54579	0	15.13607	13.61164	0	10.84774	0	14.88152	18.03531	0	0	0	15.19313	0	16.08659	0	15.36429	14.34257	15.01057
I3KY92	I3KY92_ORENI	cdc42ep4		CRIB domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endomembrane system [GO:0012505]	endomembrane system [GO:0012505]		DFGEPTDLPPSMPKGGGMK	14.21000004	1959.925917	0	0	15.06375	0	15.23534	11.49929	0	0	13.73021	14.3769	15.95905	12.51001	13.77553	0	15.56196	15.51853	15.07034	0	0	0	0	0	0	0	0	15.72088	0	0	0	0	0	0	15.78753	0	0	0	14.35557	0	0	0	15.56964	0	0	14.79603	0	0	15.02637	0	0	0	0	0	0	0
I3K010	I3K010_ORENI	nudcd3		CS domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MGFPPGVAEK	12.10000038	1031.718343	7.602587	12.76795	0	11.50136	10.8865	11.64881	12.20004	17.94977	14.26111	14.01052	0	12.56425	13.20834	13.02876	13.2326	0	0	0	13.87957	15.19852	0	0	15.87361	0	0	0	0	0	0	14.46107	0	0	12.84729	14.38922	9.138177	9.31548	14.86585	0	0	14.36246	0	0	12.74384	0	0	13.6251	11.78612	12.88991	18.44753	14.03112	0	15.19218	17.63703	12.8132
I3KEW6	I3KEW6_ORENI	LOC100698898	primitive hemopoiesis [GO:0060215]	CSRNP_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; primitive hemopoiesis [GO:0060215]		LASRPCSVR	2.269999981	1042.388494	13.98486	14.19178	0	0	13.67838	0	12.79484	13.62139	14.0279	0	17.13619	15.99251	0	14.91993	0	0	0	14.6226	14.98371	0	15.47332	0	0	0	0	16.70222	0	14.43958	12.98199	15.14592	0	14.13294	0	14.99905	15.01437	16.16524	0	14.9126	0	14.46512	0	14.6566	15.94459	13.27698	16.43704	15.37463	0	17.19933	16.94102	15.5204	15.49878	16.30465	0	0
A0A669CRK1	A0A669CRK1_ORENI	LOC102083268		CST complex subunit CTC1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]"	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]; single-stranded DNA binding [GO:0003697]"	single-stranded DNA binding [GO:0003697]	HKGEEPGGDVTVR	12.23999977	1379.813726	14.89919	0	15.20456	0	14.00491	0	0	0	0	11.95004	15.39832	16.53399	0	0	0	12.73877	13.45191	0	0	0	0	15.52375	16.03357	0	16.2084	0	12.26354	16.60051	0	0	0	12.78014	14.66883	0	15.11155	0	0	0	0	13.35178	0	13.26323	0	0	0	15.97855	0	0	0	0	0	0	0	0
I3KNT3	I3KNT3_ORENI	LOC100691100	determination of left/right asymmetry in diencephalon [GO:0035462]; determination of left/right asymmetry in lateral mesoderm [GO:0003140]; endoderm formation [GO:0001706]; heart jogging [GO:0003146]; heart looping [GO:0001947]; mesoderm formation [GO:0001707]; negative regulation of activin receptor signaling pathway [GO:0032926]; specification of animal organ axis polarity [GO:0010084]	CTCK domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; determination of left/right asymmetry in diencephalon [GO:0035462]; determination of left/right asymmetry in lateral mesoderm [GO:0003140]; endoderm formation [GO:0001706]; heart jogging [GO:0003146]; heart looping [GO:0001947]; mesoderm formation [GO:0001707]; negative regulation of activin receptor signaling pathway [GO:0032926]; specification of animal organ axis polarity [GO:0010084]		GSKMSLPVNLK	10.06999969	1189.345218	0	12.10834	9.675989	0	0	11.8971	0	0	0	0	0	16.47732	0	14.69931	0	14.21794	16.33908	11.42829	14.35916	9.065872	14.56467	10.00054	12.54008	12.36381	13.34386	0	8.897025	14.49214	13.51786	12.09193	15.50607	0	0	12.17519	13.65851	12.53134	12.07457	13.87797	12.17575	10.75172	10.82763	14.5251	0	13.38943	10.99136	0	13.01214	16.3505	0	0	0	0	10.2663	13.70105
A0A669DTZ3	A0A669DTZ3_ORENI	LOC100690751	'de novo' CTP biosynthetic process [GO:0044210]; glutamine metabolic process [GO:0006541]	CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; CTP synthase activity [GO:0003883]; 'de novo' CTP biosynthetic process [GO:0044210]; glutamine metabolic process [GO:0006541]	ATP binding [GO:0005524]; CTP synthase activity [GO:0003883]	MKYILVTGGVISGIGK	5.769999981	1651.120834	0	5.565414	13.90515	0	0	16.01781	0	11.48105	13.14613	16.15661	0	14.08625	11.70494	0	0	11.88747	0	16.74843	0	0	12.58081	0	0	15.0873	16.20906	14.01585	14.99116	0	0	0	0	0	0	13.41189	0	0	0	0	0	0	0	13.05821	0	13.53747	0	0	0	0	18.70441	0	15.68235	0	16.70159	0
A0A669E9Z5	A0A669E9Z5_ORENI	CSMD1		CUB and Sushi multiple domains 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MMPSKDSSHK	1.970000029	1162.913942	13.02216	12.48913	12.46038	0	13.06022	0	0	0	0	0	0	13.18504	11.01129	0	0	14.51765	0	13.33264	0	13.94532	12.94569	0	14.10147	0	17.46601	0	12.15417	12.19084	12.08645	12.47318	14.30553	12.28465	0	11.51534	13.38762	13.92339	0	11.43461	11.93991	14.10797	13.18242	0	11.82037	0	13.52762	0	13.13795	11.59258	0	0	9.327255	0	11.82313	11.4361
A0A669EYE9	A0A669EYE9_ORENI			CUB and Sushi multiple domains 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		EDAQLVLQVHQIR	7.739999771	1549.186463	0	0	14.7377	17.78958	16.07224	0	17.76694	17.19953	13.49673	0	0	0	0	0	16.70989	0	16.84212	0	0	0	0	0	0	16.69232	0	17.03778	14.46384	0	0	0	16.25352	0	13.69289	14.30645	0	0	0	0	0	0	15.58603	12.30285	12.65254	15.29104	12.42382	15.19204	0	0	14.87912	15.11668	13.29838	0	17.05924	0
A0A669EX28	A0A669EX28_ORENI			CUB and Sushi multiple domains 3a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GRPAQNKSDR	10.96000004	1129.526049	0	9.608413	12.07149	14.16661	13.43733	0	21.44116	10.92575	15.42779	14.04523	18.961	0	18.52176	18.36293	20.15453	11.62828	11.61186	11.70792	14.41846	13.25708	0	20.26861	14.05772	11.81176	18.81065	14.26835	0	0	12.35098	11.57753	16.44469	0	0	19.31865	14.61975	10.39808	14.2501	12.54822	13.86417	9.974251	12.16177	0	0	19.88313	13.0432	16.03749	15.2226	14.84596	13.56622	0	15.62499	19.60349	14.49597	0
A0A669EKW0	A0A669EKW0_ORENI	ascc2		CUE domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ubiquitin binding [GO:0043130]	ubiquitin binding [GO:0043130]	RAAMQQR	1.549999952	875.5333524	0	15.08543	0	14.74916	17.65423	14.15699	14.09025	14.48505	0	14.99328	15.77887	0	16.61013	14.50017	0	15.38272	0	13.43827	14.64681	14.90475	14.34266	16.55691	0	15.90219	15.24276	14.03883	0	14.16008	15.48051	0	16.86289	15.12054	0	15.07296	13.86698	15.17583	12.04616	14.13156	11.80514	0	14.17885	13.31006	8.9308	13.65956	0	0	0	15.4972	0	15.47371	0	0	0	14.66392
A0A669D5S1	A0A669D5S1_ORENI	CUL5	ubiquitin-dependent protein catabolic process [GO:0006511]	CULLIN_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ubiquitin protein ligase binding [GO:0031625]; ubiquitin-dependent protein catabolic process [GO:0006511]	ubiquitin protein ligase binding [GO:0031625]	LALPGKVR	20.64999962	853.8410636	17.7829	17.51081	17.62116	17.78116	0	0	0	12.11663	19.43073	18.43448	0	17.35612	16.11902	19.61569	16.95221	20.52032	20.4818	17.92115	0	0	18.28652	17.27177	17.69172	20.63399	18.77368	0	0	0	20.10604	14.51972	17.43319	0	0	15.70601	17.33384	0	17.50104	16.46506	14.69546	16.41793	0	10.57489	13.19446	0	0	0	0	0	0	15.45381	13.33231	11.07687	0	0
A0A669FCR1	A0A669FCR1_ORENI	morc2		CW-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	ADARAK	2.339999914	631.9699857	16.28718	14.81428	13.94239	0	0	14.7196	0	0	15.48032	17.28779	15.29143	0	15.93014	0	0	15.68001	15.00139	0	15.33105	0	0	0	0	0	13.78767	0	16.33347	0	0	0	0	0	17.06971	0	16.40466	0	0	0	0	0	0	0	0	18.09043	16.09454	0	0	0	0	0	0	18.16202	0	16.55371
I3IWR3	I3IWR3_ORENI	LOC100705541	hematopoietic progenitor cell differentiation [GO:0002244]	CXXC-type zinc finger protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Set1C/COMPASS complex [GO:0048188]	Set1C/COMPASS complex [GO:0048188]; DNA binding [GO:0003677]; zinc ion binding [GO:0008270]; hematopoietic progenitor cell differentiation [GO:0002244]	DNA binding [GO:0003677]; zinc ion binding [GO:0008270]	MCGECDACLR	7.239999771	1285.841043	19.46309	20.68567	0	21.02111	19.62848	17.67216	21.58808	16.62791	17.02281	16.78338	16.44379	18.59632	20.32572	18.98492	0	0	0	20.29139	20.33029	20.15762	19.81789	18.98757	19.80342	16.62612	16.07622	22.46272	17.45462	17.89532	15.28703	17.21631	18.30383	20.95777	21.22123	15.23662	16.50927	0	16.79279	21.07611	21.25673	0	19.56649	18.17789	22.08054	18.19849	16.75711	15.64256	16.48664	18.37604	20.24672	19.17309	19.8267	21.40125	18.16636	21.70819
A0A669DS68	A0A669DS68_ORENI	LOC100695798	regulation of cell cycle [GO:0051726]	CYCLIN domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		regulation of cell cycle [GO:0051726]		ISSDLR	4.699999809	690.6081468	0	14.97583	15.3574	0	0	16.01114	16.40383	15.71096	15.71495	17.94221	17.86195	15.5219	16.5663	15.07057	0	17.43054	0	15.7336	17.17455	15.78996	0	13.90791	0	17.73138	0	0	17.3957	20.07074	16.92455	16.63754	17.39045	0	18.72359	0	0	16.02665	15.4655	15.21719	16.08427	0	0	16.07981	0	16.60023	16.94489	17.34768	17.1029	17.00405	0	0	17.97654	16.47185	0	17.20868
A0A669C2L8	A0A669C2L8_ORENI			CYPIA1 (EC 1.14.14.1) (Cytochrome P450 1A1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; aromatase activity [GO:0070330]; heme binding [GO:0020037]; iron ion binding [GO:0005506]	aromatase activity [GO:0070330]; heme binding [GO:0020037]; iron ion binding [GO:0005506]	KFVSLNAR	5.96999979	934.8709429	12.96989	0	12.54678	12.25082	11.21622	11.06129	13.92756	13.12012	14.91869	15.60503	0	13.01367	10.13885	10.84822	13.34182	0	0	11.83162	13.72877	14.1828	13.63396	12.59629	14.3708	13.85894	0	6.030042	15.31319	10.68874	0	11.5855	11.94106	11.56647	13.62797	12.10712	14.50601	10.65375	12.63939	14.18374	10.79952	12.70878	13.69803	12.61523	12.61887	14.25153	0	12.05235	13.38317	12.89984	14.37372	13.45094	13.49973	12.50896	8.743617	10.49256
A0A669EYE4	A0A669EYE4_ORENI	npepl1		CYTOSOL_AP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; manganese ion binding [GO:0030145]; metalloaminopeptidase activity [GO:0070006]	manganese ion binding [GO:0030145]; metalloaminopeptidase activity [GO:0070006]	TTMPGMKR	3.25	919.6379117	15.46005	0	14.51028	0	0	14.49422	10.48286	16.41583	15.25888	15.92817	15.99322	15.45473	15.2538	12.34794	14.94894	13.91622	14.2748	14.66359	12.567	15.8201	0	0	0	14.17553	0	0	0	0	0	16.04208	16.26441	16.44557	0	0	14.77201	15.93502	14.9684	0	13.83498	16.27556	14.45104	14.19013	14.47487	0	0	0	0	15.46169	17.68757	0	16.1083	0	16.34454	14.99864
A0A669CXK4	A0A669CXK4_ORENI			CaM kinase-like vesicle-associated a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	AAKNEIK	6.46999979	773.3853339	14.41985	14.69359	15.32899	12.05886	0	0	17.25407	14.49632	0	15.67989	15.45204	16.72755	15.99836	15.09661	15.08861	14.05102	15.39341	0	0	14.60573	14.79629	0	17.46919	15.09706	15.73293	15.72372	0	15.44547	0	0	17.50847	17.45168	18.64981	0	14.16179	0	14.07361	12.45279	14.85994	15.20753	0	0	14.53903	15.30914	14.92199	19.00448	18.33553	14.61276	14.63516	14.96047	16.52488	0	15.16627	0
A0A669EV55	A0A669EV55_ORENI	KCNN1		CaMBD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calmodulin binding [GO:0005516]; small conductance calcium-activated potassium channel activity [GO:0016286]	calmodulin binding [GO:0005516]; small conductance calcium-activated potassium channel activity [GO:0016286]	LDSILQCVQSLPVVLSQAIAK	7.25	2281.653038	13.00642	16.359	10.76989	0	9.945024	13.32713	10.89794	14.55829	0	0	14.66378	14.46451	12.92814	0	14.18577	13.94302	14.64705	0	14.16568	13.35886	13.79752	12.78846	0	8.48355	12.64523	11.24941	12.18422	12.23214	15.53911	14.24996	0	11.76145	11.95913	9.352641	11.1089	13.72191	12.62846	8.981879	10.66393	12.48251	13.65265	0	0	10.798	11.91244	12.32201	0	13.46172	0	0	12.19964	0	15.04926	0
I3JVH4	I3JVH4_ORENI		"anterior/posterior axis specification, embryo [GO:0008595]; neural retina development [GO:0003407]; positive regulation of embryonic development [GO:0040019]"	Cactin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"anterior/posterior axis specification, embryo [GO:0008595]; neural retina development [GO:0003407]; positive regulation of embryonic development [GO:0040019]"		SGSSSGSESDR	3.420000076	1053.74364	0	0	14.35422	0	14.28809	0	12.17057	13.64598	0	14.43588	0	0	11.97028	0	14.47846	12.45158	14.69391	13.90368	0	13.87038	14.49527	14.83579	14.99929	16.78055	0	13.46283	0	15.10343	13.71051	14.60408	20.23548	21.23496	11.24112	0	12.89179	14.43389	12.86788	12.53227	0	0	0	0	0	0	0	14.16518	13.53421	0	0	0	14.87077	0	0	0
A0A669B4P9	A0A669B4P9_ORENI	CDH10	homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	Cadherin 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	calcium ion binding [GO:0005509]	LGLADMMCK	10.92000008	1071.226055	0	12.25836	0	14.04601	10.90845	11.50288	0	12.35744	13.20493	14.64818	0	0	0	0	13.97568	0	0	0	11.97374	9.201328	0	0	0	0	0	14.21453	0	12.37835	13.62941	0	17.22327	0	0	13.49308	0	0	0	0	0	0	0	0	0	0	0	0	12.82866	0	15.66306	0	0	0	0	0
A0A669DQ52	A0A669DQ52_ORENI	CDH6	homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	Cadherin 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	calcium ion binding [GO:0005509]	TALPGMDR	6.090000153	875.2367139	18.35476	17.98093	18.46333	0	17.69575	0	18.63874	0	20.28949	19.03075	17.77044	0	0	0	0	15.22123	0	23.11214	0	0	0	0	0	0	0	0	0	0	0	0	17.38771	0	0	17.23909	0	17.84348	0	0	0	0	0	0	0	17.43084	0	17.43162	0	15.97378	19.51945	18.79649	0	17.68917	17.83446	0
A0A669EZN4	A0A669EZN4_ORENI		cell surface receptor signaling pathway [GO:0007166]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; multicellular organism development [GO:0007275]	"Cadherin, EGF LAG seven-pass G-type receptor 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; G protein-coupled receptor activity [GO:0004930]; cell surface receptor signaling pathway [GO:0007166]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; multicellular organism development [GO:0007275]	calcium ion binding [GO:0005509]; G protein-coupled receptor activity [GO:0004930]	RSQPLSQGAHLK	4.71999979	1320.289054	17.88773	0	0	0	0	16.85714	16.37976	0	0	0	0	0	18.14799	14.80343	14.8918	16.35993	17.92819	15.58116	0	0	0	0	17.6682	0	0	0	0	0	0	16.25177	0	0	0	0	0	0	0	15.45566	14.42267	14.97625	17.98978	15.93481	14.0805	13.62775	0	0	17.90274	16.27526	0	14.13261	16.09584	0	0	0
A0A669CPT7	A0A669CPT7_ORENI		cell surface receptor signaling pathway [GO:0007166]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; multicellular organism development [GO:0007275]	"Cadherin, EGF LAG seven-pass G-type receptor 3"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; G protein-coupled receptor activity [GO:0004930]; cell surface receptor signaling pathway [GO:0007166]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; multicellular organism development [GO:0007275]	calcium ion binding [GO:0005509]; G protein-coupled receptor activity [GO:0004930]	IFMPWSRSK	6.429999828	1166.163043	13.36903	12.62072	14.36174	10.8169	13.08869	14.27991	8.301961	13.58145	10.07482	15.89524	13.36847	14.41524	12.52317	0	12.26849	13.96899	13.97924	12.88099	0	12.39694	0	14.90204	14.92011	18.10514	0	13.00669	0	12.83857	0	0	0	0	0	0	0	13.48428	0	11.38508	0	14.02664	0	13.52996	0	0	7.467772	15.80868	0	0	18.5397	0	0	0	0	0
A0A669ECW7	A0A669ECW7_ORENI		homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	Cadherin-13	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	anchored component of membrane [GO:0031225]; plasma membrane [GO:0005886]	anchored component of membrane [GO:0031225]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; protein homodimerization activity [GO:0042803]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	calcium ion binding [GO:0005509]; protein homodimerization activity [GO:0042803]	SAATLGDIVGQKLPYR	5.260000229	1688.464487	14.45721	0	10.69956	14.56305	14.19892	0	12.54109	14.27309	13.25795	12.90267	0	13.55172	0	11.27106	13.88956	12.58784	0	15.41638	0	15.95871	14.69985	10.25676	15.32729	14.84293	16.01638	13.40966	14.81074	0	13.3207	13.80614	0	0	0	0	0	0	13.03653	14.04822	0	12.60641	13.9684	0	0	0	0	0	0	0	0	0	0	0	14.54468	0
A0A669DMZ1	A0A669DMZ1_ORENI		homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	Cadherin-related 23	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	calcium ion binding [GO:0005509]	SQGPTI	6.610000134	603.386525	16.95536	17.14966	15.2498	16.58303	14.04443	16.23871	15.54143	17.08305	14.84994	17.69262	16.87849	16.31838	17.70694	17.22541	16.57224	19.57257	19.10852	18.81391	18.29801	19.0523	17.70572	20.31542	20.49681	19.90288	15.84048	18.11164	17.13832	21.73855	21.49607	21.90059	17.59486	19.26645	18.0746	17.07648	17.86041	16.76532	17.85764	17.98924	17.60256	18.28988	18.23204	18.55833	17.82114	17.73351	17.17004	17.13165	17.22897	17.69569	17.86693	17.60313	17.11514	20.02585	18.19489	18.39721
A0A669CXX9	A0A669CXX9_ORENI			Cadherin_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; calcium ion binding [GO:0005509]	calcium ion binding [GO:0005509]	YFEVNLKTGFSQMPTGGHCR	10.10000038	2328.409253	10.47462	12.87227	13.30376	0	0	0	13.54439	15.10201	0	0	0	16.95452	0	11.30959	11.41068	0	0	0	9.761102	0	13.80989	0	0	14.03299	0	0	0	12.65829	14.25356	11.9091	17.93968	18.1925	13.87464	0	0	0	18.19226	12.49061	12.96596	11.33693	0	0	10.59467	13.49676	13.63036	0	0	0	11.02043	0	0	15.82269	17.98383	0
I3JYD7	I3JYD7_ORENI		DNA replication-independent nucleosome assembly [GO:0006336]	Calcineurin binding protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA replication-independent nucleosome assembly [GO:0006336]		EPFFFSVLPWIILYR	1.299999952	1927.300561	15.62244	0	13.35012	15.2426	0	12.24416	0	14.12308	14.13948	15.44747	14.14552	15.71892	15.01723	13.70663	12.92043	13.62805	14.4962	0	14.55335	13.12079	11.75657	14.05831	14.47859	13.75908	12.85183	15.398	0	13.76553	13.39948	11.60084	15.18398	17.49817	0	0	12.46562	12.96642	13.09209	0	13.50768	14.10976	13.27645	0	13.8524	11.45059	14.22658	14.1656	15.33232	14.37321	0	13.57746	15.38227	0	0	14.71691
I3KUS8	I3KUS8_ORENI	cpped1		Calcineurin-like phosphoesterase domain-containing protein 1 (EC 3.1.3.16) (Serine/threonine-protein phosphatase CPPED1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]	protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]	QNLLDRFK	17.93000031	1032.83126	16.3287	14.9887	14.84357	15.11719	15.61889	15.66851	17.19818	15.42029	15.0283	0	0	15.34914	16.83541	0	17.23101	17.44995	0	0	16.59064	0	14.92421	0	0	0	16.78948	0	0	0	0	0	0	0	17.12178	15.98553	0	0	0	0	16.68741	0	0	0	0	0	0	0	0	16.7311	0	19.04784	0	0	0	17.27934
I3KSN1	I3KSN1_ORENI			Calcium binding and coiled-coil domain 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DYNKVLLSEAK	4.639999866	1279.635086	16.49428	12.73899	0	0	15.09269	0	14.0576	0	15.29837	0	0	15.09265	15.50601	16.77528	0	16.96772	0	0	15.04536	0	17.0601	0	0	0	0	14.53439	0	13.69009	17.55525	0	0	0	0	15.36778	15.21747	0	15.03647	14.77419	0	0	0	0	14.10917	0	14.1653	16.88189	15.10729	0	0	15.74276	16.62873	0	0	0
A0A669EPR6	A0A669EPR6_ORENI		regulation of ion transmembrane transport [GO:0034765]	"Calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel complex [GO:0005891]; metal ion binding [GO:0046872]; voltage-gated calcium channel activity [GO:0005245]; regulation of ion transmembrane transport [GO:0034765]	metal ion binding [GO:0046872]; voltage-gated calcium channel activity [GO:0005245]	TFVEALMLLFR	23.17000008	1353.834608	11.15204	16.04265	16.12687	0	13.25936	15.42792	16.11993	13.69678	13.97213	13.89079	0	12.82762	15.21657	15.77023	0	14.3559	14.58866	13.60675	14.45013	0	14.77976	15.98675	14.22855	16.56743	12.26069	0	15.01809	12.91272	15.1086	15.91408	17.78062	17.34721	18.39025	14.73861	14.48409	0	15.22581	0	0	0	14.96105	0	16.33602	0	0	0	15.42305	0	12.60539	0	14.21915	0	15.34523	14.58982
A0A669E9C0	A0A669E9C0_ORENI		regulation of ion transmembrane transport [GO:0034765]	"Calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel complex [GO:0005891]; metal ion binding [GO:0046872]; voltage-gated calcium channel activity [GO:0005245]; regulation of ion transmembrane transport [GO:0034765]	metal ion binding [GO:0046872]; voltage-gated calcium channel activity [GO:0005245]	RQLPQTPAVPRPHVTYSPAVR	1.129999995	2369.479896	11.20198	0	9.199647	11.39605	8.531639	11.39638	0	12.66381	12.95154	7.953045	10.72367	13.1082	0	0	11.59387	0	0	0	14.08474	0	12.16155	7.965931	0	0	13.51859	0	16.58073	0	11.59452	12.9497	10.64758	17.63293	13.4808	0	0	11.409	14.02661	10.53125	13.6987	16.53281	13.46077	0	11.05537	0	11.04123	0	12.91319	13.18864	7.861472	0	10.99853	13.31045	9.655494	13.49331
A0A669DLN8	A0A669DLN8_ORENI		regulation of ion transmembrane transport [GO:0034765]	"Calcium channel, voltage-dependent, R type, alpha 1E subunit a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel complex [GO:0005891]; metal ion binding [GO:0046872]; voltage-gated calcium channel activity [GO:0005245]; regulation of ion transmembrane transport [GO:0034765]	metal ion binding [GO:0046872]; voltage-gated calcium channel activity [GO:0005245]	SFSGALMLLFR	16.79999924	1242.347399	14.65993	14.08741	12.44771	14.34437	0	12.17871	12.98299	12.04583	12.67705	0	15.08488	0	17.06182	13.65148	14.17267	0	0	11.96503	12.2591	0	14.05308	0	12.85023	14.69169	12.83002	15.38681	13.12345	12.80281	11.99908	14.87411	15.80105	17.91136	17.11691	15.65949	12.75271	11.78911	14.991	0	14.98166	0	0	14.27851	13.94167	14.48362	14.91197	12.59305	0	8.387744	15.83819	15.5931	15.11427	0	15.18158	15.68892
I3J5P3	I3J5P3_ORENI			"Calcium channel, voltage-dependent, T type, alpha 1H subunit b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel complex [GO:0005891]; voltage-gated calcium channel activity [GO:0005245]	voltage-gated calcium channel activity [GO:0005245]	ENGMLRCSDVPR	5.150000095	1434.416687	13.52215	13.22911	10.59756	0	0	14.64388	0	13.77637	12.22252	15.2038	14.9389	14.3136	0	9.618642	0	12.29515	11.45581	12.47313	0	15.4797	0	0	0	15.13531	12.59844	13.0735	0	0	13.53543	0	0	0	0	0	0	11.81602	0	12.69337	0	13.95164	0	0	0	0	0	13.6964	0	0	0	0	0	14.84909	14.45583	0
I3K0R9	I3K0R9_ORENI		regulation of ion transmembrane transport [GO:0034765]	"Calcium channel, voltage-dependent, alpha 2/delta subunit 4a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium channel activity [GO:0005262]; voltage-gated ion channel activity [GO:0005244]; regulation of ion transmembrane transport [GO:0034765]	calcium channel activity [GO:0005262]; voltage-gated ion channel activity [GO:0005244]	LNCVCVLK	6.699999809	1006.11556	0	15.7023	16.756	0	16.65478	0	0	0	0	16.28811	0	0	0	0	14.34311	0	0	17.89497	0	17.13293	16.00054	15.86647	0	0	14.50416	0	14.46876	15.86424	0	16.46138	16.9825	0	0	0	15.92204	14.17277	16.34094	0	0	0	15.39662	0	16.0922	15.55046	14.96789	0	0	17.0869	15.72746	14.98954	16.65769	0	0	0
A0A669CBL5	A0A669CBL5_ORENI		regulation of ion transmembrane transport [GO:0034765]	"Calcium channel, voltage-dependent, alpha 2/delta subunit 4b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium channel activity [GO:0005262]; voltage-gated ion channel activity [GO:0005244]; regulation of ion transmembrane transport [GO:0034765]	calcium channel activity [GO:0005262]; voltage-gated ion channel activity [GO:0005244]	DIIIMVDISGSMK	4.099999905	1453.368631	13.28805	0	13.84816	0	12.04775	13.00341	0	10.72708	13.18264	0	0	12.38971	0	13.07964	11.8012	12.80844	14.68453	0	0	12.54549	0	0	12.48188	12.18363	11.56263	0	13.12349	13.54621	14.5413	11.6678	18.1368	0	15.69896	14.19933	0	11.78338	12.62906	14.64414	0	0	0	12.7741	0	13.36949	0	12.91059	0	12.90981	0	0	0	0	8.509233	12.65929
A0A669EUV1	A0A669EUV1_ORENI			"Calcium channel, voltage-dependent, beta 4b subunit"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel complex [GO:0005891]; voltage-gated calcium channel activity [GO:0005245]	voltage-gated calcium channel activity [GO:0005245]	NGANHCSFFSR	5.630000114	1295.470476	0	0	0	12.20302	12.4666	13.32282	12.59187	11.48808	0	0	17.56169	0	11.06339	12.3518	0	13.63642	10.54924	0	9.618209	14.39631	13.31286	0	15.16492	14.45578	13.53216	0	12.88968	11.27207	0	14.69042	0	0	0	0	12.21532	16.99729	12.53621	12.3995	11.879	10.95095	0	12.71164	14.54029	12.35337	14.15997	10.06853	13.34885	0	0	12.38904	9.388554	0	0	11.24118
A0A669EJV3	A0A669EJV3_ORENI		endoplasmic reticulum calcium ion homeostasis [GO:0032469]	Calcium load-activated calcium channel (CLAC channel)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of endoplasmic reticulum membrane [GO:0030176]	integral component of endoplasmic reticulum membrane [GO:0030176]; calcium channel activity [GO:0005262]; endoplasmic reticulum calcium ion homeostasis [GO:0032469]	calcium channel activity [GO:0005262]	MVMMTLK	3.849999905	869.8896236	0	10.01065	14.85215	15.78117	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.96734
A0A669E527	A0A669E527_ORENI	mcu	mitochondrial calcium ion homeostasis [GO:0051560]	Calcium uniporter protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; calcium channel activity [GO:0005262]; uniporter activity [GO:0015292]; mitochondrial calcium ion homeostasis [GO:0051560]	calcium channel activity [GO:0005262]; uniporter activity [GO:0015292]	GIDRVAIYSMDGAR	1.820000052	1518.235166	0	11.40802	0	10.67726	13.75134	10.64504	14.05494	13.57491	0	0	0	13.97113	14.58916	0	12.40131	8.642937	0	12.33677	12.69902	0	13.72398	12.77692	8.872338	14.65959	12.0936	11.56545	15.3229	12.73588	13.75273	0	15.65758	18.1547	17.01041	14.84997	16.76769	0	10.86869	0	11.8492	13.61331	13.732	11.98232	15.44237	15.5859	14.90501	0	14.5183	14.64438	15.14323	12.91978	14.03045	12.73156	12.991	9.676007
I3K3B1	I3K3B1_ORENI	CACNA2D3	regulation of ion transmembrane transport [GO:0034765]	Calcium voltage-gated channel auxiliary subunit alpha2delta 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium channel activity [GO:0005262]; voltage-gated ion channel activity [GO:0005244]; regulation of ion transmembrane transport [GO:0034765]	calcium channel activity [GO:0005262]; voltage-gated ion channel activity [GO:0005244]	SPIAAAVGIQMKLEFFQK	4.170000076	1994.610672	15.59603	12.99905	12.39109	9.821534	13.12325	0	0	0	14.68651	13.54765	0	12.54005	0	11.00962	14.27286	14.68912	0	12.59389	12.0953	13.95287	13.11412	13.62129	13.86929	0	14.14954	0	0	11.50097	10.91251	0	15.31482	0	0	14.59186	13.94667	0	0	13.03386	12.79049	13.73774	12.08522	0	0	13.78443	13.67523	14.41951	13.67517	14.32138	0	14.97157	14.70355	0	0	14.12775
A0A669EY61	A0A669EY61_ORENI		calcium ion import [GO:0070509]; flagellated sperm motility [GO:0030317]; neuronal action potential [GO:0019228]	Calcium voltage-gated channel subunit alpha1 Ia	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel complex [GO:0005891]; low voltage-gated calcium channel activity [GO:0008332]; calcium ion import [GO:0070509]; flagellated sperm motility [GO:0030317]; neuronal action potential [GO:0019228]	low voltage-gated calcium channel activity [GO:0008332]	SSSQTTVGPCR	9.680000305	1178.526296	17.10772	0	16.56422	0	17.22756	18.15555	18.24108	19.35267	18.57702	18.72097	18.27521	19.90079	20.225	0	0	19.1762	20.06842	20.26678	0	15.45787	11.39231	0	14.07808	20.31815	13.77116	13.09835	0	14.67719	0	12.10617	15.49707	0	15.97734	0	14.6185	0	14.70658	14.32655	0	12.59827	0	0	15.04608	0	0	0	17.43561	0	15.42066	16.58245	14.74278	15.11617	15.96443	16.93555
A0A669E4H4	A0A669E4H4_ORENI	LOC100696988		Calcium-activated neutral proteinase 1 (EC 3.4.22.52) (Calpain mu-type) (Calpain-1 catalytic subunit) (Calpain-1 large subunit) (Micromolar-calpain)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; calcium-dependent cysteine-type endopeptidase activity [GO:0004198]	calcium-dependent cysteine-type endopeptidase activity [GO:0004198]; calcium ion binding [GO:0005509]	GSSGVHLKR	2.650000095	940.0457723	0	0	14.06012	15.16971	0	0	13.8017	13.53683	0	13.52501	14.36174	0	15.81445	0	14.76195	14.99053	15.64152	0	12.04827	0	0	0	0	13.9222	0	13.89193	14.3663	14.36586	10.19833	0	0	13.57562	16.93328	15.0643	15.22452	0	0	13.66495	14.90835	12.27837	11.72575	0	12.20681	0	0	0	12.94834	14.38425	16.36903	0	0	14.20367	14.76067	12.85273
A0A669DRK5	A0A669DRK5_ORENI	LOC100698516		Calcium-transporting ATPase (EC 7.2.2.10)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; sarcoplasmic reticulum membrane [GO:0033017]	"integral component of membrane [GO:0016021]; sarcoplasmic reticulum membrane [GO:0033017]; ATP binding [GO:0005524]; calcium transmembrane transporter activity, phosphorylative mechanism [GO:0005388]; metal ion binding [GO:0046872]"	"ATP binding [GO:0005524]; calcium transmembrane transporter activity, phosphorylative mechanism [GO:0005388]; metal ion binding [GO:0046872]"	YLEISMIDDPGNVQY	5.96999979	1773.930979	13.90767	12.70065	0	15.60163	11.96143	14.64084	14.80921	14.19372	13.94731	14.51643	15.56565	16.0023	13.02081	0	14.70951	10.44626	14.10388	15.4182	15.68662	14.74942	0	0	5.42144	15.95087	0	13.41419	14.84326	15.84021	14.21419	0	0	17.49516	16.96828	15.10431	14.30983	14.89716	0	0	15.50343	14.7222	0	0	0	0	0	14.05181	15.27019	15.28937	15.42761	0	16.96995	0	0	16.00946
A0A669B0J5	A0A669B0J5_ORENI	LOC100695450		Calcium/calmodulin-dependent protein kinase (EC 2.7.11.17)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; calmodulin-dependent protein kinase activity [GO:0004683]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; calmodulin-dependent protein kinase activity [GO:0004683]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	AMCLCLSARK	8.460000038	1209.561773	10.53412	7.156005	6.062976	13.48724	11.59139	17.15998	11.23589	0	0	0	13.44923	0	0	0	12.38836	13.41703	17.21098	0	0	14.87169	11.41393	12.28309	12.41121	10.49345	13.615	0	12.8924	0	13.57793	0	0	0	15.3266	0	12.85753	0	0	10.83809	12.63789	0	14.83194	16.8618	11.03332	0	0	16.14684	0	0	14.55282	13.74895	0	8.083782	0	0
I3IZS7	I3IZS7_ORENI		neuron projection development [GO:0031175]	"Calmodulin regulated spectrin-associated protein family, member 3"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; calmodulin binding [GO:0005516]; microtubule binding [GO:0008017]; spectrin binding [GO:0030507]; neuron projection development [GO:0031175]	calmodulin binding [GO:0005516]; microtubule binding [GO:0008017]; spectrin binding [GO:0030507]	AQSTPSTPGAVPDSGVK	7.25	1599.256159	14.5685	14.05255	14.91447	0	0	0	0	0	12.95988	0	0	0	15.98172	14.46452	13.35792	15.0886	0	0	15.43319	0	0	0	14.45711	14.91278	15.01059	15.37928	0	13.96585	0	12.96483	0	0	0	0	14.17513	0	15.70944	15.59479	0	0	0	0	0	0	15.40731	0	0	15.72068	0	0	0	0	16.03515	14.97476
A0A669BWN9	A0A669BWN9_ORENI	capn10	cellular response to insulin stimulus [GO:0032869]	Calpain catalytic domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium-dependent cysteine-type endopeptidase activity [GO:0004198]; cellular response to insulin stimulus [GO:0032869]	calcium-dependent cysteine-type endopeptidase activity [GO:0004198]	TAGGSR	3.069999933	549.6642303	14.31172	0	13.58929	14.71829	14.61211	14.49377	13.88754	14.15259	9.915945	12.87449	11.95111	14.70931	14.06724	14.79485	15.19079	12.86344	15.87379	0	13.49786	0	0	14.74989	14.96085	13.80572	17.00295	15.54639	15.41436	15.92897	14.61134	12.38609	15.88768	15.56718	15.29589	15.89563	13.44774	14.17769	14.698	14.23397	14.62886	14.09965	14.439	14.50993	10.21539	11.57328	14.50005	13.58381	15.33578	13.70353	14.7497	14.1852	14.60184	15.30541	0	12.89713
A0A669CG06	A0A669CG06_ORENI	cast		Calpain inhibitor (Calpastatin)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AGTKPK	7.650000095	599.3384636	14.49197	16.33704	13.97521	0	15.95273	11.46422	13.5287	16.87873	14.10058	0	13.05271	14.69627	13.03235	15.04242	15.32225	0	15.5956	0	15.6433	14.80149	16.29475	16.53691	11.22867	0	18.61128	15.43809	0	0	16.47383	0	0	0	0	0	15.90548	13.93771	0	0	0	0	0	0	0	0	0	13.33708	14.08244	0	0	0	15.39082	0	0	15.56134
A0A669CN94	A0A669CN94_ORENI	LOC100699569	sarcomere organization [GO:0045214]	Calpain-3 (EC 3.4.22.54)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; calcium ion binding [GO:0005509]; calcium-dependent cysteine-type endopeptidase activity [GO:0004198]; sarcomere organization [GO:0045214]	calcium-dependent cysteine-type endopeptidase activity [GO:0004198]; calcium ion binding [GO:0005509]	SMIALMDTDGTGKLNLQEFK	8.550000191	2211.41598	15.75703	0	15.21705	12.52074	15.39753	17.04373	17.49632	16.90301	18.1632	16.93751	0	0	14.77301	10.56599	0	13.86081	0	15.7219	0	0	14.98098	15.239	13.13306	0	0	17.2702	0	14.9488	12.28271	15.82384	14.53049	19.72933	14.86046	0	17.00489	17.34492	13.36503	0	14.72443	15.92632	0	14.71853	0	16.18917	17.33392	18.40474	16.6159	15.01603	15.38009	11.30962	16.69655	18.61763	16.49582	0
I3JWE5	I3JWE5_ORENI	LOC100695259	actomyosin structure organization [GO:0031032]	Calponin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]	cytoskeleton [GO:0005856]; actin binding [GO:0003779]; calmodulin binding [GO:0005516]; actomyosin structure organization [GO:0031032]	actin binding [GO:0003779]; calmodulin binding [GO:0005516]	GASQAGMTAPGTR	10.97000027	1219.400823	0	13.32499	9.066362	16.66819	10.00767	0	17.22203	0	8.956872	13.4774	12.92722	12.17554	14.51642	11.42832	0	13.31044	13.35456	18.0892	9.943824	0	13.09475	9.759009	0	13.98541	13.78964	0	15.86458	0	17.94353	12.10101	14.56319	0	0	14.3213	0	0	0	13.37506	0	13.17375	16.62929	0	14.35412	0	0	13.70067	9.331393	10.67402	0	12.56051	0	0	12.62442	14.45682
A0A669D8N9	A0A669D8N9_ORENI	LOC100696125		Calponin-homology (CH) domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MNSEPIKPK	9.399999619	1055.489122	13.56514	14.24465	11.79977	14.33013	14.53019	12.95263	17.06564	15.16883	0	14.88923	13.2395	0	0	0	11.78051	0	0	17.88831	13.96284	12.01724	14.20801	14.92144	0	0	16.03764	13.52226	13.91491	16.88885	14.26422	13.63532	12.21085	13.72279	12.87863	14.51371	11.34126	0	12.8071	13.01599	15.60432	13.90242	0	13.81942	13.59923	17.04653	14.44929	0	0	13.95286	17.10089	12.02202	14.77726	12.58734	16.54324	0
I3J0U7	I3J0U7_ORENI		protein folding [GO:0006457]	Calreticulin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum lumen [GO:0005788]	endoplasmic reticulum lumen [GO:0005788]; calcium ion binding [GO:0005509]; unfolded protein binding [GO:0051082]; protein folding [GO:0006457]	calcium ion binding [GO:0005509]; unfolded protein binding [GO:0051082]	GQPLVIQFSVK	3.329999924	1216.907527	12.6376	13.85106	14.12033	0	13.42074	13.79984	14.14395	13.12733	0	12.30572	11.96881	13.70256	13.42746	13.87593	0	14.66138	0	11.34534	11.99386	16.99844	0	0	0	0	0	0	0	0	11.38597	0	16.98673	0	16.80356	14.04549	0	11.91446	0	0	0	0	0	0	0	12.80608	0	0	0	10.07576	0	0	0	13.73137	0	13.95185
A0A669B286	A0A669B286_ORENI	LOC100698459		Calretinin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]	calcium ion binding [GO:0005509]	QSIMSLSDGGK	8.210000038	1138.250304	13.62538	14.061	13.52859	14.70748	13.90679	0	15.01111	0	0	15.10719	13.8543	17.14478	13.55989	13.32044	14.87918	12.51071	13.58953	13.85388	14.86146	15.00546	14.71439	18.09274	14.50694	14.59105	17.44417	14.28271	16.63432	0	14.22143	11.2544	17.06273	18.87992	0	13.70486	10.32971	17.0758	14.50681	12.15254	13.9861	11.83239	11.21759	0	14.33177	0	13.78587	0	0	8.717836	0	13.89562	13.75985	0	15.13959	15.22393
I3JBM5	I3JBM5_ORENI			Capicua transcriptional repressor a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	EEMDVEVSR	7.360000134	1092.828515	15.86624	16.30663	0	0	0	0	15.20848	0	0	0	15.20689	0	15.77559	0	0	0	14.9034	0	15.35154	0	14.08108	0	0	0	0	16.03901	0	16.60944	0	0	0	15.92129	0	0	15.15689	0	0	0	0	0	15.99212	0	0	0	0	15.06109	0	0	0	11.46267	15.99505	0	16.12899	0
I3K2T7	I3K2T7_ORENI	chst10	carbohydrate biosynthetic process [GO:0016051]	Carbohydrate sulfotransferase (EC 2.8.2.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; sulfotransferase activity [GO:0008146]; carbohydrate biosynthetic process [GO:0016051]	sulfotransferase activity [GO:0008146]	AGSPSGTVPGTK	8.460000038	1058.382593	14.8854	14.33279	0	14.72164	6.389169	14.7666	0	17.35326	0	13.73744	0	17.23147	14.01291	0	11.02417	14.36523	10.83802	0	0	14.33635	18.26706	0	0	0	0	14.64217	0	0	0	0	0	0	0	15.6887	0	0	0	0	14.79253	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669D3L9	A0A669D3L9_ORENI			Carbonic anhydrase (EC 4.2.1.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	anchored component of membrane [GO:0031225]; plasma membrane [GO:0005886]	anchored component of membrane [GO:0031225]; plasma membrane [GO:0005886]; carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]	carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]	FPMEMHIVHIK	9.479999542	1396.542329	13.64462	9.751122	0	0	0	13.59028	14.20822	0	11.64523	12.87176	0	0	12.91048	12.6959	0	0	14.35843	0	14.6528	0	0	0	14.22507	0	13.63548	15.76529	14.6548	0	7.640628	14.45477	0	17.09371	0	0	11.36364	0	0	14.89185	0	0	14.08913	0	14.60103	0	0	14.51402	14.17364	12.83927	15.56493	0	0	14.92223	0	0
I3JGC4	I3JGC4_ORENI	LOC100690919		Carbonic anhydrase-related protein 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]	carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]	MGGTMYNTGK	8.680000305	1091.709061	12.96892	14.96513	0	0	14.86695	14.8517	14.94142	0	0	15.85951	16.39852	15.37226	0	0	15.14641	15.49307	14.0819	0	0	15.7874	0	14.44348	14.63846	15.68872	14.97627	0	0	0	14.5527	0	19.02693	0	0	15.12467	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.7136	0	0	0	0	15.17705
A0A669C6B5	A0A669C6B5_ORENI	CEL	lipid metabolic process [GO:0006629]	Carboxylic ester hydrolase (EC 3.1.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"hydrolase activity, acting on ester bonds [GO:0016788]; lipid metabolic process [GO:0006629]"	"hydrolase activity, acting on ester bonds [GO:0016788]"	GDVIIVSVGYR	3.440000057	1177.742841	0	13.35472	0	0	16.00819	10.63264	12.17304	12.19125	16.69678	11.0909	12.17396	13.51837	12.98021	11.10888	0	13.31337	0	0	0	0	14.38098	17.08435	15.6717	17.61955	13.56337	14.12564	14.05488	11.28289	0	3.924256	8.404214	13.98301	15.74689	0	0	0	0	0	0	0	0	0	0	0	0	0	12.40541	0	0	0	0	0	0	0
I3IVC1	I3IVC1_ORENI			"Carboxypeptidase X (M14 family), member 1a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; metallocarboxypeptidase activity [GO:0004181]; zinc ion binding [GO:0008270]	metallocarboxypeptidase activity [GO:0004181]; zinc ion binding [GO:0008270]	VEDHDHDIR	6.639999866	1136.424086	0	12.873	12.50909	15.39924	0	16.78596	16.7062	9.361639	0	0	14.37488	13.96507	13.92415	13.3103	0	13.08934	11.89801	14.47816	0	14.06614	14.45827	15.24787	14.9327	14.18093	17.13627	15.11608	13.40355	0	13.47253	0	14.09237	15.07343	0	13.13936	13.46895	17.7986	17.021	10.75172	13.83153	0	0	12.52756	0	12.24119	12.71288	13.21327	13.52975	0	0	0	0	12.7911	0	14.41606
I3KGH2	I3KGH2_ORENI	LOC100700808		Carn_acyltransf domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"transferase activity, transferring acyl groups [GO:0016746]"	"transferase activity, transferring acyl groups [GO:0016746]"	GTFSDSEKMK	3.960000038	1128.76393	15.44843	12.76332	14.2275	11.83179	16.95878	13.40386	13.47081	13.75727	13.50698	19.58762	15.06521	0	15.24	8.623077	11.9773	14.67811	17.28496	8.697572	15.3712	14.84849	0	8.316668	18.95938	0	13.7767	12.27695	14.53004	0	0	13.12115	16.0651	0	17.56453	19.31865	14.305	13.79039	0	12.33323	0	12.81654	14.45222	0	16.8434	10.93858	13.77559	15.47181	13.77498	13.73316	12.75362	13.58622	14.66704	16.59732	14.25657	14.143
I3K0D5	I3K0D5_ORENI			Carnitine O-acetyltransferase a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"transferase activity, transferring acyl groups [GO:0016746]"	"transferase activity, transferring acyl groups [GO:0016746]"	KSVSAIER	9.949999809	889.6667431	15.04614	14.94336	14.18083	15.29473	14.74161	15.15538	0	16.6071	15.47927	14.39256	0	15.73341	16.269	15.5921	15.03254	16.23233	16.32114	15.33447	16.78803	16.44726	17.16064	14.01871	0	13.3087	16.07281	16.46684	0	16.08878	0	14.27379	15.64004	16.82915	0	16.12529	0	16.29098	0	16.80746	13.15308	16.46939	0	0	15.31523	0	0	17.21642	17.49964	18.22293	16.85046	18.14337	16.05411	15.31763	0	16.08282
I3KUX6	I3KUX6_ORENI			Carnosine dipeptidase 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		carboxypeptidase activity [GO:0004180]; metal ion binding [GO:0046872]; metallodipeptidase activity [GO:0070573]	carboxypeptidase activity [GO:0004180]; metal ion binding [GO:0046872]; metallodipeptidase activity [GO:0070573]	DLPINIK	14.59000015	811.9888941	14.36012	15.11908	15.30283	14.87655	12.20012	13.81464	17.04406	15.10305	13.41194	16.09715	15.37066	16.72839	15.52087	15.91518	0	0	16.57273	15.03019	0	16.02438	0	0	0	16.13443	16.11592	0	0	0	16.14855	0	0	0	0	0	0	0	0	16.30485	16.50822	0	0	0	0	0	0	0	0	0	0	19.14576	0	0	19.56349	0
A0A669CTZ5	A0A669CTZ5_ORENI	LOC100711357	fatty acid biosynthetic process [GO:0006633]	Carrier domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		[acyl-carrier-protein] S-malonyltransferase activity [GO:0004314]; fatty acid biosynthetic process [GO:0006633]	[acyl-carrier-protein] S-malonyltransferase activity [GO:0004314]	MISPDGTSKPFSSRADGYGR	3.130000114	2128.812552	13.68263	12.17442	13.03291	13.33489	12.986	0	13.32567	13.73226	12.76664	14.64121	16.65496	13.49265	12.21734	0	0	0	9.98916	14.05728	9.730289	14.88495	16.10217	13.1035	0	14.14835	15.2156	0	0	9.239873	11.42959	0	0	12.72954	14.13956	11.20577	11.05938	0	0	13.33933	0	0	14.20936	0	10.98071	17.68213	0	10.76112	13.79784	13.60083	14.80875	10.60641	0	12.72143	15.11415	10.68867
A0A669F1Y3	A0A669F1Y3_ORENI	casd1		Cas1_AcylT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transferase activity [GO:0016740]	transferase activity [GO:0016740]	AGQPTPGA	11.56999969	696.7994485	0	12.86235	15.42169	0	0	0	0	15.10783	0	14.2387	0	17.61055	0	14.96916	12.37868	15.88049	13.72341	16.41359	12.55675	0	14.39862	15.30986	15.23682	0	0	14.62021	15.2093	16.09027	16.13964	0	16.52523	14.18601	0	16.514	0	14.90639	14.46258	14.36204	15.57062	13.77524	0	0	16.67162	15.27487	0	13.56769	0	0	14.73522	0	0	0	16.858	0
I3J645	I3J645_ORENI		regulation of apoptotic process [GO:0042981]	"Caspase recruitment domain family, member 14"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		regulation of apoptotic process [GO:0042981]		SSVPPFLMR	9.800000191	1034.461619	0	12.61959	13.16238	14.61194	10.26067	11.10116	12.03821	14.60744	13.52857	14.72735	0	11.2327	17.0672	17.48054	21.40127	20.52973	19.89268	0	16.80454	16.46687	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I6LL60	I6LL60_ORENI		apoptotic process [GO:0006915]	Caspase-3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; cysteine-type endopeptidase activity [GO:0004197]; apoptotic process [GO:0006915]	cysteine-type endopeptidase activity [GO:0004197]	RSAGSSSASVPMDVDAKPQSHSFR	9.920000076	2503.483431	0	14.37441	12.15341	13.81754	12.02873	8.943041	12.89522	17.32818	0	11.64822	0	0	11.85735	13.82337	0	9.874145	0	0	11.61084	14.09825	0	0	0	12.93588	12.25029	0	0	8.878139	12.90783	12.97866	14.71723	0	0	0	12.20898	14.58694	0	11.69342	13.32191	0	17.39947	11.03494	0	0	0	0	9.573506	8.690561	7.958922	0	0	0	11.09581	0
A0A669DUV8	A0A669DUV8_ORENI		hydrogen peroxide catabolic process [GO:0042744]; response to oxidative stress [GO:0006979]	Catalase (EC 1.11.1.6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	peroxisome [GO:0005777]	peroxisome [GO:0005777]; catalase activity [GO:0004096]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; hydrogen peroxide catabolic process [GO:0042744]; response to oxidative stress [GO:0006979]	catalase activity [GO:0004096]; heme binding [GO:0020037]; metal ion binding [GO:0046872]	IPERVVHAK	1.799999952	1048.755465	12.47901	13.87589	0	16.07593	12.9342	0	15.90982	15.63017	15.31817	20.54383	14.58557	15.61587	12.64923	13.29377	13.56383	14.79702	14.07451	13.26392	12.75601	8.428328	14.36334	15.26553	17.58143	14.80929	0	0	0	20.05289	0	15.03974	0	12.10658	14.46704	19.07228	12.6784	14.72507	13.88086	9.984291	10.98328	17.69616	12.7455	0	18.0459	14.98808	10.05367	14.81232	14.69291	12.85268	14.91786	15.02751	16.5388	14.12444	13.50058	14.85559
A0A669EYB5	A0A669EYB5_ORENI	CTNND2	cell-cell adhesion [GO:0098609]	Catenin delta 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell junction [GO:0030054]	cell junction [GO:0030054]; cell-cell adhesion [GO:0098609]		ELEAER	27.51000023	746.3041934	13.10551	8.393958	14.74441	17.27384	14.86195	13.2235	0	0	16.57647	14.19733	15.05783	0	14.82057	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.78268	0	0	0
A0A669CCS0	A0A669CCS0_ORENI	ctsk		Cathepsin K (EC 3.4.22.38)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	apical plasma membrane [GO:0016324]; extracellular region [GO:0005576]	apical plasma membrane [GO:0016324]; extracellular region [GO:0005576]; cysteine-type endopeptidase activity [GO:0004197]	cysteine-type endopeptidase activity [GO:0004197]	EYNGLGEEGIR	17.72999954	1237.109759	0	0	13.56606	13.46803	13.52316	0	15.89532	0	0	14.51329	0	14.79006	15.93392	15.95573	15.89478	15.02138	14.05639	15.35483	13.8317	14.68639	0	0	0	15.24823	0	15.40951	15.29883	14.6948	14.50812	0	17.51152	17.11244	17.09447	0	12.94696	0	0	15.23201	14.18357	0	13.3937	0	0	0	0	14.12831	15.01409	0	0	15.88843	0	0	16.86347	0
I3J349	I3J349_ORENI	atp13a3	cation transport [GO:0006812]	Cation-transporting ATPase (EC 7.2.2.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; metal ion binding [GO:0046872]; cation transport [GO:0006812]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	KQYVMLR	3.910000086	936.4237136	11.5754	8.697223	15.87818	12.85493	11.10022	15.41071	9.359802	16.12554	12.45136	10.0053	9.757404	10.84043	15.5298	11.88115	0	16.09764	12.96092	13.34329	0	0	0	10.71178	0	0	0	15.05365	16.18966	15.8864	15.53843	0	0	13.78675	0	0	0	0	0	0	0	0	16.21655	0	0	0	0	14.44999	0	0	15.12078	0	0	0	15.00711	0
A0A669DY53	A0A669DY53_ORENI		termination of RNA polymerase I transcription [GO:0006363]	Caveolae associated protein 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	caveola [GO:0005901]	caveola [GO:0005901]; termination of RNA polymerase I transcription [GO:0006363]		SLTPDHK	3.380000114	797.1324587	11.39674	12.30599	14.25348	0	13.78154	13.07849	12.96621	14.47125	10.46936	15.00645	14.79929	12.08745	0	13.78678	12.28128	13.21067	15.2708	13.44358	18.6928	14.35873	13.46837	15.42207	15.14995	15.45989	14.6818	0	0	14.55956	0	14.37012	0	0	0	15.97543	14.68841	11.55524	0	16.14273	0	0	18.03216	0	0	17.09805	14.1329	0	13.19853	0	10.76719	15.7157	14.39739	0	15.23006	14.21016
I3K7K5	I3K7K5_ORENI	LOC100712477	multicellular organism development [GO:0007275]; response to stimulus [GO:0050896]; visual perception [GO:0007601]	Ceh-10 homeodomain-containing homolog (Homeobox protein CHX10) (Visual system homeobox 2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; multicellular organism development [GO:0007275]; response to stimulus [GO:0050896]; visual perception [GO:0007601]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]"	CWGRSSVMAEYGLYGAMVR	1.919999957	2209.011702	10.59018	0	14.89232	12.96179	0	10.12116	11.65353	12.0568	0	13.96636	13.4363	0	13.52004	9.927362	15.56263	0	13.21717	12.67049	14.13223	14.05891	0	11.36386	0	0	14.40067	11.99552	15.94208	13.23369	11.56349	10.46521	13.11356	12.98538	15.17878	14.80624	14.93704	0	13.44442	13.59865	10.78702	9.59875	0	8.006185	0	13.008	12.75803	11.62525	0	11.01625	0	0	14.86887	14.34378	0	0
I3JMW3	I3JMW3_ORENI	LOC100708259	phospholipid transport [GO:0015914]	Cell cycle control protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transport vesicle membrane [GO:0030658]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transport vesicle membrane [GO:0030658]; phospholipid transport [GO:0015914]		ECEPYR	2.470000029	853.1844826	11.86001	13.88037	13.97905	13.33845	11.59594	13.52924	0	14.12059	12.46505	14.08963	16.41516	11.79355	14.67687	14.01274	15.65624	14.25625	12.32161	13.73259	14.03289	14.3787	14.91875	14.04837	12.8345	0	15.1486	13.13335	14.04876	0	13.15232	14.37003	16.49378	15.54545	16.18724	15.03656	15.03789	13.8327	0	12.62734	0	0	14.55873	11.72649	13.78883	13.71661	0	13.60907	14.95127	11.09808	0	0	0	0	0	15.19418
A0A669EKZ7	A0A669EKZ7_ORENI			Cell division cycle 16 homolog (S. cerevisiae)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ATTLER	3.769999981	691.559203	14.21339	0	12.78889	12.28657	14.34617	11.47117	12.80555	12.68558	11.12268	12.76227	0	13.22676	15.42454	0	15.01783	12.47057	13.68997	14.75441	12.02357	11.35726	0	13.17355	0	14.45366	12.71672	0	0	11.09272	12.57378	12.90898	0	17.34493	0	14.59319	13.23163	12.88097	14.32127	12.51238	14.78143	0	9.760402	0	10.28177	0	0	0	13.15915	0	13.83841	0	0	12.47284	14.08061	13.56558
A0A669CKT4	A0A669CKT4_ORENI			"Cell division cycle 42, like"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	CAQAIRK	5.050000191	844.8426592	14.50925	12.99098	14.09085	14.07215	15.00973	15.02299	14.50646	13.08004	15.24869	13.64223	13.67798	12.31604	14.17512	0	14.6096	10.63996	0	12.97261	13.10141	16.65544	15.17888	0	11.65388	13.19788	0	15.48213	0	13.72775	0	0	15.44475	15.63905	14.30118	0	9.769347	14.32589	8.579655	12.31073	14.55535	0	4.411776	11.88232	0	12.62649	0	14.15594	13.93176	14.1446	0	0	15.72526	17.16827	0	15.66945
I3JWR6	I3JWR6_ORENI			Cell division cycle 7 homolog (S. cerevisiae)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	LSSKTTTVSTSLPLPAR	8.43999958	1754.629786	0	14.21027	0	15.64498	15.3092	14.11866	0	14.96453	14.65641	14.10527	13.0394	14.955	0	0	0	0	0	0	0	15.23153	0	0	0	14.313	0	0	0	16.94431	0	0	0	0	13.30478	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.98646	0	0	0	0	0	0
I3KPZ5	I3KPZ5_ORENI		"cell cycle [GO:0007049]; regulation of transcription, DNA-templated [GO:0006355]"	Cell division cycle and apoptosis regulator 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	"cytoplasm [GO:0005737]; cell cycle [GO:0007049]; regulation of transcription, DNA-templated [GO:0006355]"		ALAALPTK	11.38000011	784.4895727	0	17.43212	19.40802	19.1772	0	18.99027	19.25595	19.38787	18.54241	19.79593	19.02154	18.74968	18.80993	0	18.96501	18.23976	18.68246	19.36108	18.70227	19.03839	19.04761	19.98512	18.76022	19.79766	18.03485	19.0122	19.3382	19.20326	18.84145	18.64793	20.70485	17.58924	20.62581	18.6932	18.81253	19.31636	18.0654	18.16857	19.26394	18.71832	15.04777	18.75178	18.23885	18.89491	18.28992	16.45505	19.31232	18.90697	19.36093	17.61752	19.6375	18.6395	17.80156	18.33418
D5KTJ0	D5KTJ0_ORENI	p53	apoptotic process [GO:0006915]; cell cycle [GO:0007049]; protein tetramerization [GO:0051262]	Cellular tumor antigen p53	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; metal ion binding [GO:0046872]; transcription regulatory region sequence-specific DNA binding [GO:0000976]; apoptotic process [GO:0006915]; cell cycle [GO:0007049]; protein tetramerization [GO:0051262]	DNA-binding transcription factor activity [GO:0003700]; metal ion binding [GO:0046872]; transcription regulatory region sequence-specific DNA binding [GO:0000976]	EPPKGAILR	4.510000229	981.1600018	0	15.45918	0	0	15.52966	14.41012	12.30537	0	16.5157	14.16405	14.02711	0	0	14.86972	15.82733	15.44386	12.19211	13.77215	11.98913	14.6747	14.96757	13.73548	14.35316	14.92142	0	14.79471	15.64717	10.52512	0	0	0	17.31291	13.15577	0	15.68523	13.67468	17.10247	0	12.80179	15.23232	15.62035	0	0	0	0	0	0	0	0	15.34666	0	16.4219	0	0
I3IVX4	I3IVX4_ORENI		centromere complex assembly [GO:0034508]	Centromere protein O	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	kinetochore [GO:0000776]; nucleus [GO:0005634]	kinetochore [GO:0000776]; nucleus [GO:0005634]; centromere complex assembly [GO:0034508]		NCSLLMETPVHKALITMK	10.22999954	2104.058187	14.40097	0	0	14.10124	15.42563	15.90881	0	0	13.69356	13.77734	0	0	0	0	15.11496	0	0	12.4862	0	0	0	13.8034	0	0	14.0971	14.60123	0	0	0	13.18909	15.04966	12.02396	18.54303	14.64162	0	0	0	0	14.88903	0	13.06088	14.50939	0	16.30033	0	0	0	0	0	0	0	0	0	0
A0A669DIW8	A0A669DIW8_ORENI			Centromere protein V	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		carbon-sulfur lyase activity [GO:0016846]; metal ion binding [GO:0046872]	carbon-sulfur lyase activity [GO:0016846]; metal ion binding [GO:0046872]	LQAGSSMDLVK	4.409999847	1164.793538	14.14588	10.97121	0	6.278939	11.67694	11.46356	0	0	12.70797	17.54104	14.49021	0	5.614034	0	0	0	0	10.98552	0	0	0	14.16573	0	0	0	17.94781	16.89806	0	0	0	14.9452	0	0	13.87357	0	0	0	16.98858	0	0	11.11818	0	18.2852	13.55071	14.17063	13.88705	0	0	0	0	19.80926	0	0	13.60731
I3IXU4	I3IXU4_ORENI	CEP128		Centrosomal protein 128	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EASATLEDETRR	4.139999866	1378.833244	14.39046	0	12.0391	14.19884	0	0	12.50358	0	0	13.41008	14.72512	0	12.90402	10.2289	0	6.162023	12.46896	14.60693	0	14.20679	0	12.82137	13.1584	0	12.78719	13.42654	14.32431	14.95767	13.57753	13.12402	0	17.14429	16.59857	11.99137	12.72659	13.1142	13.6445	12.8454	0	13.84238	5.008724	12.88145	0	0	12.14932	0	14.82829	0	0	0	14.66467	14.89505	14.261	14.83921
I3K2G9	I3K2G9_ORENI			Centrosomal protein 170B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LQDKAER	1.879999995	859.1241011	0	0	14.96338	15.46908	0	16.04072	17.12105	19.42373	0	16.48356	17.03208	15.28204	16.96479	16.28537	15.57544	15.85658	0	0	15.37823	0	16.19046	0	17.47797	0	0	17.05014	16.99049	15.94658	0	18.11348	16.8764	0	17.8298	0	0	16.27561	0	15.74459	16.27481	0	0	15.74254	14.92164	15.15511	15.53228	18.26855	0	16.19093	15.68973	16.9177	0	18.197	0	17.33454
I3K9Y5	I3K9Y5_ORENI			Centrosomal protein 97	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MQEHILFLSEKLDHVQK	2.319999933	2111.236835	11.92117	12.9967	13.07942	13.33014	0	0	11.47374	11.74399	14.35011	13.19294	10.4442	13.25773	15.1407	14.37355	13.72854	11.89257	13.10217	0	14.87845	12.84829	13.44277	13.32243	0	11.41484	11.4464	0	11.09554	10.91063	8.698204	0	12.69507	14.60329	14.93577	0	0	0	10.93756	0	13.76479	0	0	14.47683	6.484628	0	0	0	0	0	0	0	0	0	0	11.89528
I3KGR3	I3KGR3_ORENI	poc5	cell cycle [GO:0007049]; eye photoreceptor cell development [GO:0042462]; visual behavior [GO:0007632]	Centrosomal protein POC5 (Protein of centriole 5)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centriole [GO:0005814]; cytoplasm [GO:0005737]; photoreceptor connecting cilium [GO:0032391]	centriole [GO:0005814]; cytoplasm [GO:0005737]; photoreceptor connecting cilium [GO:0032391]; cell cycle [GO:0007049]; eye photoreceptor cell development [GO:0042462]; visual behavior [GO:0007632]		MSSDEEEPTSPVLPK	2.299999952	1660.610234	0	13.42389	14.43493	0	14.43418	0	0	13.62482	13.24829	0	0	14.20613	13.36509	0	17.11676	14.93244	0	0	0	12.13769	13.88937	0	0	1.697619	0	14.34664	0	0	0	0	15.74509	0	0	0	0	0	0	0	0	15.73167	0	0	0	0	0	0	0	0	15.29976	0	14.45004	0	0	0
I3KI94	I3KI94_ORENI	cep162	cell projection organization [GO:0030030]	Centrosomal protein of 162 kDa	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centriole [GO:0005814]; cytoplasm [GO:0005737]; microtubule [GO:0005874]	centriole [GO:0005814]; cytoplasm [GO:0005737]; microtubule [GO:0005874]; cell projection organization [GO:0030030]		KILNMELR	17.06999969	1017.519996	12.32766	13.21169	0	13.68909	0	14.02824	13.90441	13.68637	13.57891	11.15625	9.300316	16.10468	13.66288	14.41598	14.93761	19.19066	13.19429	13.30756	15.541	13.19047	0	11.40206	13.19523	12.28176	0	13.19299	10.04832	17.57888	13.93566	14.21523	0	15.24691	15.68493	14.30806	14.10369	13.49115	12.81183	15.33688	11.90217	12.82087	0	14.12711	0	14.35313	13.79852	13.77936	0	14.09772	13.40228	13.85809	0	14.63869	14.25022	10.158
I3JIJ3	I3JIJ3_ORENI	cep76		Centrosomal protein of 76 kDa	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centriole [GO:0005814]; cytoplasm [GO:0005737]	centriole [GO:0005814]; cytoplasm [GO:0005737]		GIIDDMMK	3.579999924	938.9899823	14.52665	0	15.76213	14.77986	14.04321	0	0	14.34062	15.77391	15.29304	0	0	16.39718	0	16.82207	16.70141	15.21798	16.35299	14.60083	0	14.27307	15.81189	16.35182	0	15.84754	16.18991	0	16.70214	12.49884	0	14.07286	15.28064	14.55252	15.08647	0	15.80858	13.15378	0	15.99552	16.12969	0	0	15.78402	15.29347	0	0	0	0	0	0	16.57758	16.34309	0	15.56162
A0A669CPF3	A0A669CPF3_ORENI	LOC100692589	cell differentiation [GO:0030154]; chemotaxis [GO:0006935]; inflammatory response [GO:0006954]; regulation of lipid catabolic process [GO:0050994]	Chemerin (Retinoic acid receptor responder protein 2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; signaling receptor binding [GO:0005102]; cell differentiation [GO:0030154]; chemotaxis [GO:0006935]; inflammatory response [GO:0006954]; regulation of lipid catabolic process [GO:0050994]	signaling receptor binding [GO:0005102]	GVNLVR	1.00999999	657.2755976	0	0	16.72351	0	14.57115	13.86903	14.59	14.62019	12.07268	16.10728	13.79931	15.00733	13.25174	14.62587	13.73502	0	15.03516	0	0	0	15.22806	16.79587	17.04636	16.15464	0	15.26928	14.61791	13.4908	0	0	16.23418	0	16.40137	14.83588	16.08603	16.38149	14.09434	0	0	0	0	0	14.14789	16.17892	0	13.85474	0	14.86704	16.201	14.49893	16.31113	15.11329	15.17705	14.5667
A0A669EN57	A0A669EN57_ORENI		chemotaxis [GO:0006935]; immune response [GO:0006955]	Chemokine (C-C motif) receptor 6a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; C-C chemokine receptor activity [GO:0016493]; chemotaxis [GO:0006935]; immune response [GO:0006955]	C-C chemokine receptor activity [GO:0016493]	RSMDGSSNSGASFTM	10.34000015	1550.288394	0	17.99694	0	18.16107	18.76393	18.50632	18.94935	0	0	18.612	11.60303	0	8.984119	0	15.36064	15.9448	12.08295	0	0	15.01679	11.9881	15.29165	12.0789	0	13.12892	13.51877	0	0	0	0	0	0	0	0	16.90217	0	17.35565	0	0	16.85295	0	15.28063	0	17.27274	0	16.63753	17.61553	0	0	15.70849	18.00682	0	16.96317	0
A0A669CFS3	A0A669CFS3_ORENI	LOC102076176		Chitin synthase (EC 2.4.1.16)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; chitin synthase activity [GO:0004100]	chitin synthase activity [GO:0004100]	KTSQLFVR	8.270000458	977.4291766	13.19506	8.732693	13.7431	15.29251	18.62281	0	12.16943	0	14.92143	0	14.40359	13.78499	19.26373	12.12522	15.95402	0	13.34677	0	13.92519	0	13.79471	14.5529	0	20.60668	13.60717	13.64764	13.83076	13.94076	0	12.15487	11.25166	0	0	13.81205	14.56137	13.22658	11.85647	12.81297	15.58939	15.16273	0	14.38694	14.85892	15.89801	14.2503	14.44932	13.17339	13.18733	13.84579	15.88563	16.01294	0	17.95518	15.54043
I3KT17	I3KT17_ORENI		carbohydrate metabolic process [GO:0005975]	Chitinase (EC 3.2.1.14)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; chitin binding [GO:0008061]; chitinase activity [GO:0004568]; carbohydrate metabolic process [GO:0005975]	chitinase activity [GO:0004568]; chitin binding [GO:0008061]	SGLGTGTSCK	9.43999958	965.3248669	14.61464	0	15.58161	14.01551	13.6549	15.61925	15.12434	13.35554	14.03167	10.00193	14.66253	15.07684	15.4571	0	11.26102	13.86834	13.55321	12.83585	11.60372	0	12.2978	13.80162	0	13.89753	12.70842	13.92803	0	0	14.41922	11.8505	0	16.92923	15.52015	0	0	12.35145	9.638799	14.00622	14.85151	14.61098	0	0	0	0	0	14.61204	0	12.0841	20.83697	13.81297	0	16.23874	0	0
I3JHC7	I3JHC7_ORENI	LOC100698259		Chloride channel protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; voltage-gated chloride channel activity [GO:0005247]	voltage-gated chloride channel activity [GO:0005247]	TPDDSRR	2.420000076	843.1952045	0	0	13.7837	11.61941	14.18535	0	0	0	15.9411	13.2873	11.75634	14.74995	13.90873	14.47692	16.04545	13.1428	0	0	0	14.77035	13.12578	15.6838	12.57072	14.55585	13.89865	6.444234	6.137211	11.6282	13.58319	12.55145	16.56767	17.03207	0	13.90442	0	0	0	13.53109	16.32695	12.5219	12.85966	0	8.666361	14.53712	0	0	13.01098	13.45095	15.40204	0	15.64396	13.73203	15.64579	13.76691
A0A669D9W8	A0A669D9W8_ORENI	chdh	glycine betaine biosynthetic process from choline [GO:0019285]	Choline dehydrogenase (EC 1.1.99.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		choline dehydrogenase activity [GO:0008812]; flavin adenine dinucleotide binding [GO:0050660]; glycine betaine biosynthetic process from choline [GO:0019285]	choline dehydrogenase activity [GO:0008812]; flavin adenine dinucleotide binding [GO:0050660]	FIRDCR	5.150000095	867.0086369	15.41783	0	15.77321	0	0	0	0	0	16.58408	16.57327	15.80505	0	16.20322	0	0	16.48667	15.40664	0	15.44854	0	0	0	14.00133	0	0	0	0	0	16.53691	15.65938	0	14.96707	17.32765	15.23019	0	0	0	16.84034	0	0	14.38947	0	16.2926	16.36379	0	14.21988	0	15.9668	14.61573	0	12.39228	17.2644	16.89354	0
I3K080	I3K080_ORENI	enpp6	lipid catabolic process [GO:0016042]	Choline-specific glycerophosphodiester phosphodiesterase (EC 3.1.4.38) (Ectonucleotide pyrophosphatase/phosphodiesterase family member 6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; glycerophosphocholine cholinephosphodiesterase activity [GO:0047390]; lipid catabolic process [GO:0016042]	glycerophosphocholine cholinephosphodiesterase activity [GO:0047390]	MNVRAAPIR	2.890000105	1026.486261	14.34931	0	0	0	0	0	0	11.63679	14.36934	13.6415	13.00099	12.7139	14.6736	0	14.29274	13.08069	14.59245	17.55352	0	14.11004	13.36113	14.33486	0	11.3442	13.64306	14.00496	14.42606	0	12.27325	15.66302	0	0	0	0	13.14743	13.86035	0	14.96684	0	0	0	0	0	0	0	0	0	0	13.08055	0	13.23873	0	0	0
A0A669D961	A0A669D961_ORENI			Chondroadherin-like b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MSQSALAGLGPGLR	2.079999924	1374.878441	14.09542	12.43123	15.97962	0	14.91335	0	14.49226	0	0	15.36403	0	0	0	0	0	15.09517	13.01591	0	13.34877	11.31981	15.90347	14.48678	0	0	0	0	0	0	0	0	14.73811	0	13.6198	0	14.3674	0	0	0	0	0	13.08161	0	14.784	16.24452	0	0	0	0	0	16.04312	0	0	0	0
A0A669ENV4	A0A669ENV4_ORENI		nervous system development [GO:0007399]	Chondroitin sulfate proteoglycan 5b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; nervous system development [GO:0007399]		SLPPLS	5.800000191	614.0775425	0	0	13.61379	12.67926	15.48444	15.04371	0	0	0	0	0	15.07652	0	0	0	14.96576	14.7453	0	0	0	0	18.15208	16.45892	17.44534	0	0	0	14.40218	0	14.24322	0	15.71947	0	0	0	0	0	0	15.37661	15.11917	0	0	0	0	0	0	0	0	18.49841	0	0	0	0	0
I3KJX2	I3KJX2_ORENI	uhrf1bp1		Chorein_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GEDQVVAVEAQTLTPVHMGNVR	5.03000021	2366.139984	0	14.33242	13.50216	14.48399	0	13.41276	15.08066	0	14.74355	15.15788	0	0	0	0	14.55145	0	15.96582	13.7094	0	0	13.83563	15.39719	0	0	0	0	16.79869	16.32363	0	0	16.50478	0	15.71352	16.96294	14.3692	13.5412	0	16.18373	14.64478	12.13386	13.4597	0	0	13.66294	0	0	16.73411	15.49311	13.23939	0	0	0	14.29373	15.93744
I3JPK6	I3JPK6_ORENI	LOC100710669	blood coagulation [GO:0007596]	Christmas factor (EC 3.4.21.22) (Coagulation factor IX) (Coagulation factor IXa heavy chain) (Coagulation factor IXa light chain)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]	extracellular space [GO:0005615]; calcium ion binding [GO:0005509]; serine-type endopeptidase activity [GO:0004252]; blood coagulation [GO:0007596]	calcium ion binding [GO:0005509]; serine-type endopeptidase activity [GO:0004252]	VNLSSSSLTR	6.710000038	1062.611583	0	15.07573	0	0	16.15673	0	13.8268	0	0	0	0	0	0	15.07623	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20.95234	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3K5Z0	I3K5Z0_ORENI		mitotic cell cycle [GO:0000278]	Chromatin licensing and DNA replication factor 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		mitotic cell cycle [GO:0000278]		ALIGLALKTEDK	8.210000038	1271.272213	15.14204	8.92155	0	0	11.54986	0	14.90588	14.14484	16.03525	9.679026	8.942356	0	14.45134	10.30869	17.47448	11.42007	0	15.50813	13.7265	13.04522	0	13.43675	0	0	13.13981	0	0	0	15.28571	14.92375	19.451	19.11367	19.31048	0	11.20443	0	15.97235	14.50771	0	13.91241	0	0	13.25355	17.2764	0	0	0	10.62323	0	0	0	11.58686	0	0
A0A669CGK4	A0A669CGK4_ORENI	ino80	"ATP-dependent chromatin remodeling [GO:0043044]; DNA repair [GO:0006281]; transcription, DNA-templated [GO:0006351]"	Chromatin-remodeling ATPase INO80 (EC 3.6.4.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Ino80 complex [GO:0031011]; integral component of membrane [GO:0016021]	"Ino80 complex [GO:0031011]; integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; nucleosome-dependent ATPase activity [GO:0070615]; ATP-dependent chromatin remodeling [GO:0043044]; DNA repair [GO:0006281]; transcription, DNA-templated [GO:0006351]"	ATP binding [GO:0005524]; DNA binding [GO:0003677]; nucleosome-dependent ATPase activity [GO:0070615]	FSHDAPLPMVK	11.53999996	1240.72244	10.41208	12.91886	16.73418	0	16.50395	11.32596	12.75062	0	12.19136	11.03636	16.98521	0	11.61064	12.38759	17.82648	10.87273	8.715392	14.3987	0	12.87081	14.26638	0	14.48132	9.108032	0	13.97141	15.25072	0	0	0	11.46257	0	0	14.18106	0	0	12.8467	0	12.85274	0	9.44858	6.718805	9.418661	15.78953	0	0	0	0	11.25307	0	15.2011	0	0	0
A0A669DQZ8	A0A669DQZ8_ORENI	CBX4	"negative regulation of transcription, DNA-templated [GO:0045892]"	Chromo domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; negative regulation of transcription, DNA-templated [GO:0045892]"		VKDITMELK	14.17000008	1091.813977	16.12459	16.04103	0	0	0	16.15863	16.54096	16.25841	16.25968	16.26317	0	15.76022	16.70887	16.69092	16.49846	17.71949	0	16.19945	16.01412	16.02072	15.8594	17.95548	0	0	16.34338	16.50019	16.76722	15.61748	16.7969	17.53342	17.15323	18.00533	19.60961	15.9398	15.79883	0	16.33594	15.69197	15.73898	16.91188	0	0	15.16349	0	15.82785	16.88208	18.87332	0	15.34713	0	16.12634	15.4694	16.09359	0
A0A669D413	A0A669D413_ORENI		"negative regulation of transcription, DNA-templated [GO:0045892]"	"Chromobox homolog 4 (Pc class homolog, Drosophila)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; negative regulation of transcription, DNA-templated [GO:0045892]"		DTGCLNK	20.95999908	805.5631442	0	0	18.0365	0	19.44397	18.62341	17.04308	19.59413	20.72227	0	18.13294	19.64563	17.09922	19.77955	19.18589	18.80786	0	18.27972	0	17.75493	13.80372	0	19.12648	19.23237	0	18.48849	0	13.50193	17.9752	17.32444	20.07407	13.04412	12.8523	19.90917	19.27357	17.04443	17.9315	17.49934	11.8513	0	17.32992	18.46263	0	17.73059	19.04092	12.62663	0	14.81611	0	0	0	18.40866	9.09424	0
I3JSS1	I3JSS1_ORENI	C1orf35		Chromosome 1 open reading frame 35	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DLTWYAK	2.75	896.2907446	12.15356	15.22157	15.57426	12.73722	14.6124	15.56591	14.24998	16.16876	15.986	15.72224	15.57055	15.29151	15.60855	15.72928	15.37479	16.035	15.32921	14.75717	0	0	0	13.99822	0	16.91211	15.08395	15.41292	15.76743	14.51735	16.79377	16.53571	16.71229	16.64743	15.36794	15.84097	13.98618	15.23429	15.78866	14.83032	0	15.0028	15.19509	14.74243	16.31841	16.74832	15.7808	16.76082	17.82287	15.32754	16.82815	16.91819	16.70804	16.49294	17.18307	0
A0A669BW64	A0A669BW64_ORENI	C2orf42		Chromosome 2 open reading frame 42	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LSLGSK	11.52000046	604.6072766	12.45434	13.45674	0	11.38825	14.35764	0	15.45004	11.62358	0	12.94429	15.14521	13.30336	0	13.4733	14.98305	12.96489	13.03979	14.39077	13.95447	15.81613	14.20532	14.92161	15.21399	11.79527	0	0	0	16.13718	14.98868	0	13.91889	15.40386	0	14.3991	15.04844	13.59919	16.09207	15.69341	14.96658	16.74524	0	0	15.0996	15.2705	15.77872	13.49137	15.70439	0	16.5849	16.28014	16.64966	16.36456	14.23152	0
I3KX68	I3KX68_ORENI	C7orf25		Chromosome 7 open reading frame 25	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AVTMTANSR	15.46000004	965.5589137	14.57123	14.68129	0	16.01072	14.60618	15.05974	0	13.46578	12.08705	13.74681	0	15.14067	16.08693	15.7121	13.03539	14.53606	14.27446	0	15.02282	16.17514	0	11.69047	15.89591	0	0	0	14.87652	14.20685	14.16294	0	0	16.15359	11.65081	13.25729	14.24233	12.84036	14.22519	11.81377	0	0	0	12.25523	0	0	15.17162	14.70194	0	13.01216	14.09942	0	15.87072	0	0	14.53189
I3KZP0	I3KZP0_ORENI	CXorf56		Chromosome X open reading frame 56	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	QPEAPK	8.090000153	667.509958	20.49307	16.5776	19.85305	16.3256	19.88946	21.8786	21.70928	21.27317	17.36724	15.53633	20.07243	21.32282	11.7102	21.13164	21.32608	0	15.76037	0	16.46195	17.23055	20.55553	0	16.24856	0	16.56004	20.18864	21.40359	18.05922	20.74701	19.92564	20.82204	21.90396	18.33119	18.36606	22.01528	22.13298	12.77282	0	17.68083	17.94387	19.97583	19.12185	18.87859	21.06319	21.28857	17.28483	16.31319	18.20321	0	16.39189	0	21.34401	0	17.19456
I3K237	I3K237_ORENI		cilium assembly [GO:0060271]; cilium movement [GO:0003341]	Cilia and flagella associated protein 221	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]	cilium [GO:0005929]; cilium assembly [GO:0060271]; cilium movement [GO:0003341]		SEFNQMGK	8.079999924	953.4823525	0	15.24254	15.9857	14.13948	15.90993	13.22431	15.31322	17.83098	13.65027	12.62291	15.42614	0	0	17.48928	19.4891	0	18.70741	15.2997	0	17.9147	0	16.50655	16.25875	18.83508	0	0	17.31462	20.58535	0	0	0	0	0	15.87185	16.26349	15.74012	0	0	0	15.51198	0	0	0	17.90721	16.79368	17.12208	15.91251	16.23718	0	16.02583	16.43239	0	0	0
I3K887	I3K887_ORENI	LOC100708255		Cilia- and flagella-associated protein 157	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]	cilium [GO:0005929]		LIDDLKFR	21.78000069	1018.990258	0	15.5635	0	0	16.49556	15.85457	16.37338	15.09773	16.0226	0	15.58164	15.34066	0	0	0	16.14701	0	15.65592	0	16.55537	0	0	16.77667	0	15.50784	15.54819	14.99416	0	15.70205	16.84986	16.56869	0	0	0	0	0	15.98371	0	0	0	16.18186	0	16.89189	0	0	17.01511	0	15.2097	0	0	0	0	0	15.11098
I3JPT3	I3JPT3_ORENI	CIR1		Cir_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		transcription corepressor activity [GO:0003714]	transcription corepressor activity [GO:0003714]	LLMGDDRVK	9.100000381	1045.847735	0	0	15.87836	0	0	0	0	0	0	0	0	0	0	12.40511	0	0	0	0	13.31511	0	12.6275	11.80075	0	0	0	0	14.47098	0	0	0	0	0	18.23408	0	0	0	0	14.41047	0	0	0	0	0	0	14.93314	0	15.12049	0	0	15.07887	0	14.22872	0	0
A0A669EW20	A0A669EW20_ORENI		intracellular signal transduction [GO:0035556]	Citron rho-interacting serine/threonine kinase b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		intracellular signal transduction [GO:0035556]		GQQIQQMADK	15.5	1161.998907	0	14.2477	14.05169	0	13.31842	12.01481	0	0	11.57449	0	14.72551	16.71692	0	14.9016	17.77123	12.25241	11.55326	17.55039	16.83798	12.9404	12.48858	12.34375	13.18347	0	15.48634	0	0	0	0	0	0	13.74195	11.49137	0	19.10026	13.69509	13.94861	10.99994	0	11.35966	0	12.21441	0	0	15.25801	14.19251	0	0	0	0	0	0	0	0
A0A669D0U1	A0A669D0U1_ORENI		intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	Clat_adaptor_s domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane coat [GO:0030117]	membrane coat [GO:0030117]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]		GGYTVLLFK	3.809999943	997.9568236	15.10896	10.45252	0	15.30725	15.58546	0	14.40826	0	14.45494	14.78627	12.8983	12.75824	12.11512	13.27721	0	0	0	0	0	15.19155	13.33289	0	16.21722	16.55243	17.63163	0	0	0	0	0	15.86243	0	0	15.08275	0	15.40202	0	0	0	0	0	0	0	0	0	16.67002	15.79636	16.428	0	0	0	0	0	15.77934
I3KZ55	I3KZ55_ORENI	CLDN4		Claudin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	bicellular tight junction [GO:0005923]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	bicellular tight junction [GO:0005923]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; structural molecule activity [GO:0005198]	structural molecule activity [GO:0005198]	ITMSVIKISLTIK	3.619999886	1463.156739	0	15.47127	13.92144	0	0	0	15.08775	0	15.49804	0	12.97834	13.73878	0	0	0	0	17.18893	16.97628	16.41891	15.25523	0	0	13.59762	0	0	0	0	14.72319	10.97695	0	18.50282	0	0	0	0	0	0	11.6385	0	0	0	0	15.81889	0	0	13.0595	0	10.7627	0	0	0	0	0	0
A0A669F1M8	A0A669F1M8_ORENI			Cleavage and polyadenylation specific factor 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				CMAVYQTYVNAMNDKIR	8.300000191	2093.700252	10.63799	13.65201	11.42493	12.93489	14.19052	12.8583	14.85724	9.980449	12.61717	17.22698	0	15.38365	14.80397	10.66827	14.28609	13.21448	15.31168	0	12.9745	0	12.99388	10.7875	7.62134	13.75926	0	12.95783	15.22339	12.49737	0	0	0	13.5567	0	0	12.4076	13.15013	10.38628	13.16412	14.31428	11.73879	0	0	0	10.68811	0	11.01132	10.10897	0	0	0	0	13.92098	11.36354	0
A0A669BZ71	A0A669BZ71_ORENI	cpsf4		Cleavage and polyadenylation specificity factor subunit 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; nucleic acid binding [GO:0003676]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270]	FDLEIAVEQQLGAQPLPFPGMDK	11.31000042	2541.592854	0	15.60345	15.52545	0	14.07958	17.06581	17.74246	17.86374	18.30183	15.30921	16.15634	16.41931	15.24173	0	15.76989	19.43547	0	14.73033	0	0	0	0	0	0	0	17.26068	0	19.00963	0	0	0	0	0	0	0	0	0	19.60905	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669CTQ3	A0A669CTQ3_ORENI	ints11		Cleavage and polyadenylation-specific factor 3-like protein (Integrator complex subunit 11)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		VSSSTEDSNTK	7.570000172	1154.928342	17.79308	13.6413	15.01617	0	13.94777	14.91286	18.47023	0	0	0	14.896	15.42558	17.12269	17.56933	16.36182	16.8798	16.63326	15.02729	0	17.02903	16.73841	16.98746	0	16.82955	0	0	16.37737	16.97925	0	16.92426	0	0	0	0	15.89318	0	0	0	16.28397	18.05885	17.33568	0	0	16.54854	0	15.67208	16.3387	15.86467	13.58412	17.34568	13.92892	0	17.5307	0
A0A669BBN3	A0A669BBN3_ORENI		intracellular distribution of mitochondria [GO:0048312]	Clustered mitochondria protein homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; RNA binding [GO:0003723]; intracellular distribution of mitochondria [GO:0048312]	RNA binding [GO:0003723]	TMNEIYKNGSNASIMPLK	7.519999981	2043.698143	18.38382	0	18.03719	0	19.27324	0	0	0	17.89573	0	17.30316	0	15.27126	0	14.77725	14.11926	15.08418	0	0	0	0	0	0	13.11656	14.60643	18.07793	16.108	16.55056	0	17.52323	0	14.63517	15.5905	14.91086	0	14.72556	0	18.2832	0	0	0	15.32198	0	18.03948	0	0	16.83162	0	0	0	0	0	18.03584	17.11025
A0A669CBX3	A0A669CBX3_ORENI	cdk5rap2		Cnn_1N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]	cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]		EESTGGVLQGTEDSLHELQR	4.510000229	2186.427355	13.48904	0	13.71971	0	19.39685	15.79988	13.23256	14.96894	0	14.8817	16.91969	0	0	15.2896	0	15.75564	14.50371	14.0395	14.9427	14.80726	0	12.80045	16.81546	14.8021	16.1853	16.68744	21.48341	0	0	15.19882	0	15.56099	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.69689	0	0
A0A669FC66	A0A669FC66_ORENI			"Coagulation factor VII, like"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; serine-type endopeptidase activity [GO:0004252]	serine-type endopeptidase activity [GO:0004252]	CYCADGYVLGDDGR	12.02000046	1620.125111	0	15.84661	0	0	0	0	0	15.20613	0	0	15.39311	0	0	14.12269	0	0	0	0	12.83465	9.799908	14.69612	13.75932	12.47943	0	10.96769	17.01925	0	6.760139	16.87379	0	15.75446	15.19026	0	0	0	0	14.24863	0	0	15.52765	0	0	0	0	0	0	0	0	0	0	0	16.34779	0	0
A0A669EST6	A0A669EST6_ORENI		blood coagulation [GO:0007596]	Coagulation factor X	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]	extracellular space [GO:0005615]; calcium ion binding [GO:0005509]; serine-type endopeptidase activity [GO:0004252]; blood coagulation [GO:0007596]	calcium ion binding [GO:0005509]; serine-type endopeptidase activity [GO:0004252]	LGEAQIPSMFMKR	3.640000105	1523.736275	12.28094	11.51372	14.02419	11.35659	14.59535	9.873514	7.220206	12.83611	0	14.07989	15.92481	13.06434	12.83063	0	0	12.26103	0	13.30772	13.79677	11.31969	10.35197	0	0	0	13.33234	14.20097	12.50774	8.861953	0	0	16.2836	19.65503	19.57382	15.17094	15.199	14.21131	0	12.50627	0	0	0	15.02379	0	15.47874	0	13.90691	0	0	12.47787	13.27654	12.03321	14.1433	0	0
A0A669DAZ8	A0A669DAZ8_ORENI		"blood coagulation, fibrin clot formation [GO:0072378]; peptide cross-linking [GO:0018149]"	"Coagulation factor XIII, A1 polypeptide b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"metal ion binding [GO:0046872]; protein-glutamine gamma-glutamyltransferase activity [GO:0003810]; blood coagulation, fibrin clot formation [GO:0072378]; peptide cross-linking [GO:0018149]"	metal ion binding [GO:0046872]; protein-glutamine gamma-glutamyltransferase activity [GO:0003810]	EVASVESKNYMK	6.5	1400.597797	16.14659	0	16.26107	15.6041	0	16.33108	16.01642	14.64009	13.47098	15.5022	14.4173	15.0939	11.25969	0	0	10.97826	12.4044	0	0	0	14.41963	12.73713	10.94625	0	0	0	0	11.10905	0	0	16.24026	15.35056	0	0	15.55229	15.30403	0	15.6806	13.19673	0	0	14.55967	14.88092	14.31534	0	0	0	15.48212	0	0	0	15.93159	0	12.89444
A0A669B7T6	A0A669B7T6_ORENI		intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	Coatomer protein complex subunit beta 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi membrane [GO:0000139]; membrane coat [GO:0030117]	Golgi membrane [GO:0000139]; membrane coat [GO:0030117]; structural molecule activity [GO:0005198]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	structural molecule activity [GO:0005198]	LSPVEDVGSCVK	1.679999948	1287.457132	0	13.54204	0	12.53819	0	13.81926	13.21431	0	0	13.51674	0	0	0	0	12.68078	0	14.64356	14.09045	5.811287	12.97927	0	0	0	0	13.81861	12.96843	0	0	0	0	0	20.34629	0	0	0	0	13.20526	0	0	14.92877	0	0	0	14.39589	0	13.63072	15.48318	12.84128	0	0	14.1765	0	0	0
A0A669DPW7	A0A669DPW7_ORENI	copb1	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	Coatomer subunit beta (Beta-coat protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	COPI vesicle coat [GO:0030126]; Golgi membrane [GO:0000139]	COPI vesicle coat [GO:0030126]; Golgi membrane [GO:0000139]; structural molecule activity [GO:0005198]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	structural molecule activity [GO:0005198]	RNAFMMLIHADQDR	21.51000023	1748.832311	18.87999	19.78905	18.01128	18.32616	0	19.78866	19.50873	0	21.56017	21.08878	0	17.58934	18.82827	0	15.83234	17.52323	18.58052	22.33945	15.95648	16.64639	0	17.79116	0	0	0	21.55084	0	16.98331	16.6097	0	19.32222	0	0	21.69068	0	0	0	0	21.70971	21.94075	0	0	21.26546	0	20.02826	0	0	0	18.24118	19.89754	21.30892	0	0	0
A0A669DEP1	A0A669DEP1_ORENI	copg2	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	Coatomer subunit gamma	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	COPI vesicle coat [GO:0030126]; Golgi membrane [GO:0000139]	COPI vesicle coat [GO:0030126]; Golgi membrane [GO:0000139]; structural molecule activity [GO:0005198]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	structural molecule activity [GO:0005198]	QAIVDKVPSVSSSALVSSLLFISFMHMVK	4.659999847	3137.526939	7.951885	11.63538	12.27402	11.9692	14.31643	0	12.65915	15.28163	13.42709	16.1302	11.93919	13.51398	14.36127	13.97674	12.007	18.52389	0	0	0	0	0	0	0	0	0	0	14.22322	0	13.54053	14.12728	0	0	13.67842	11.33742	9.949792	0	8.778194	14.11513	14.68552	14.22691	0	12.57769	0	0	0	0	0	0	0	0	12.63283	0	0	0
A0A669EJV4	A0A669EJV4_ORENI		activation of MAPKK activity [GO:0000186]; adult feeding behavior [GO:0008343]; cellular response to starvation [GO:0009267]; chemical synaptic transmission [GO:0007268]; G protein-coupled receptor signaling pathway [GO:0007186]; negative regulation of appetite [GO:0032099]	Cocaine- and amphetamine-regulated transcript protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]; synapse [GO:0045202]	extracellular space [GO:0005615]; synapse [GO:0045202]; neuropeptide hormone activity [GO:0005184]; activation of MAPKK activity [GO:0000186]; adult feeding behavior [GO:0008343]; cellular response to starvation [GO:0009267]; chemical synaptic transmission [GO:0007268]; G protein-coupled receptor signaling pathway [GO:0007186]; negative regulation of appetite [GO:0032099]	neuropeptide hormone activity [GO:0005184]	RLPGLCR	9.5	871.4199324	9.954281	11.12408	11.99566	15.8123	15.27923	14.74784	13.01735	13.37959	12.18661	13.24408	15.80931	13.93552	12.25254	14.86072	11.5817	0	10.76406	14.36617	0	0	11.87044	0	0	0	0	0	15.6943	0	0	0	15.36035	14.22309	0	14.48258	0	0	0	0	0	0	16.73642	0	0	0	13.05529	0	0	0	14.73685	0	16.0074	14.73425	13.85039	13.93721
I3JWE4	I3JWE4_ORENI	LOC100694988	regulation of transcription by RNA polymerase II [GO:0006357]	Cofactor required for Sp1 transcriptional activation subunit 7 (Mediator complex subunit 26) (Mediator of RNA polymerase II transcription subunit 26)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mediator complex [GO:0016592]	mediator complex [GO:0016592]; regulation of transcription by RNA polymerase II [GO:0006357]		QDTMTKR	9.729999542	879.1484652	14.5196	13.05575	0	14.02741	14.44003	0	0	17.49795	14.35212	14.44106	15.1238	14.08137	13.92773	15.3542	12.91509	12.41676	14.1129	11.41614	11.46816	16.36026	14.36478	14.2327	13.02626	12.09799	18.56979	0	14.5073	0	12.72812	14.22106	13.1329	13.25761	16.04211	0	12.51547	0	0	12.07278	17.69279	0	12.35909	16.32648	15.20859	12.18661	13.51651	13.13605	13.82277	14.33743	17.00175	16.53236	0	0	14.56042	14.4179
I3J1P0	I3J1P0_ORENI			Coiled-coil domain containing 105	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EKLNRPLVK	10.68000031	1097.178023	0	13.67485	0	14.1631	0	13.95458	0	0	0	13.19057	0	15.25071	15.81873	12.35513	14.32988	0	0	15.49862	0	15.75879	0	0	17.02136	0	17.58302	0	0	14.93862	0	15.67994	0	0	0	0	16.89384	0	0	16.45984	0	16.09223	0	0	0	17.52451	17.97139	17.10512	16.86763	16.87334	17.60475	17.09667	16.75655	0	0	0
I3JQ95	I3JQ95_ORENI			Coiled-coil domain containing 173	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NAELIAEEENR	3.289999962	1286.484839	17.24504	0	0	17.30801	0	0	0	16.23512	0	17.64013	0	17.51972	0	17.05812	0	0	17.38044	0	0	16.95184	15.22202	17.40179	21.09862	0	16.42707	0	17.48799	16.04418	0	16.23231	0	0	16.23288	16.01545	15.76306	0	0	0	18.07895	0	0	0	0	0	0	15.99531	0	0	0	19.64172	0	0	0	0
I3K997	I3K997_ORENI			Coiled-coil domain containing 191	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QCQLAAESDRR	2.660000086	1334.241058	0	0	13.06415	11.31589	0	0	0	0	0	0	0	0	0	12.56861	0	0	8.423866	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8.494924	0	0	0	0	0	0	11.68908	0	0	12.80593	0	0	9.643623	0	0	0	0	0	0	0	10.50747	0
I3KE13	I3KE13_ORENI			Coiled-coil domain containing 33	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LMLMER	24.23999977	792.5812723	0	0	19.4696	19.38972	0	19.71886	19.72307	0	19.94785	0	0	0	20.37119	0	0	20.82848	0	0	0	0	0	0	0	19.76875	0	20.55059	0	20.48266	0	21.11636	0	20.31549	0	0	0	0	0	0	0	22.01431	0	0	24.53517	24.23794	24.95345	24.67869	24.90433	25.48985	0	0	0	17.03678	15.54039	0
I3J989	I3J989_ORENI			Coiled-coil domain containing 66	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centrosome [GO:0005813]	centrosome [GO:0005813]; microtubule binding [GO:0008017]	microtubule binding [GO:0008017]	EEDRGGGEGVK	12.48999977	1132.633009	13.07212	0	0	0	0	0	0	12.06477	12.95025	0	12.12151	11.55148	12.45583	16.55498	12.3649	0	13.30055	13.35201	15.66127	12.35243	12.34928	17.80533	16.79188	13.74728	12.05262	0	0	14.55776	12.84503	11.40913	14.35352	13.9946	10.87612	12.83834	11.35908	12.98311	12.54435	14.07364	12.10325	12.10849	9.547626	0	13.95584	14.58982	12.38159	14.32872	11.29542	0	17.36544	13.69348	0	12.62807	13.74546	0
I3JI15	I3JI15_ORENI	CCDC85A		Coiled-coil domain containing 85A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	adherens junction [GO:0005912]	adherens junction [GO:0005912]		RDVCEFSGR	4.570000172	1126.171041	17.28938	16.41661	13.09275	12.76172	15.16208	13.39277	11.11328	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.48772	0	0	0	0	0	15.45984	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669ENV6	A0A669ENV6_ORENI	CCDC88A	cell migration [GO:0016477]; cytoskeleton-dependent intracellular transport [GO:0030705]; regulation of actin cytoskeleton organization [GO:0032956]	Coiled-coil domain containing 88A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; actin binding [GO:0003779]; cell migration [GO:0016477]; cytoskeleton-dependent intracellular transport [GO:0030705]; regulation of actin cytoskeleton organization [GO:0032956]	actin binding [GO:0003779]	ASLSSQGK	4.820000172	776.8542239	0	0	14.28642	14.52228	13.21863	15.14011	0	10.93867	0	13.98104	14.18029	15.03201	13.7806	14.03933	0	14.11713	14.81181	14.96249	10.08028	0	14.81237	14.34371	13.91952	14.61331	0	15.24086	14.39037	14.92851	0	0	19.5715	17.03045	17.78979	16.57528	15.1846	15.79543	0	0	15.01246	0	0	14.40101	11.67572	14.24824	15.47065	0	14.97068	0	0	14.47872	15.46983	15.54836	14.95538	0
I3K0W0	I3K0W0_ORENI		cytoskeleton-dependent intracellular transport [GO:0030705]; Wnt signaling pathway [GO:0016055]	Coiled-coil domain containing 88C	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; cytoskeleton-dependent intracellular transport [GO:0030705]; Wnt signaling pathway [GO:0016055]		RVEGDEER	4.480000019	986.9856685	12.55205	13.61068	15.94845	12.42963	15.78901	12.83404	14.40435	0	13.18096	12.5125	17.21017	14.44421	14.18681	0	12.94855	13.80548	0	14.08171	13.40985	16.14662	0	13.49211	13.4973	12.63144	0	0	0	14.26441	12.424	0	17.42317	0	15.89961	14.25905	11.87918	15.56827	0	0	0	0	15.25823	0	0	0	0	0	0	0	14.49272	0	0	15.44344	13.94375	0
A0A669EPC4	A0A669EPC4_ORENI		cell division [GO:0051301]; mitotic spindle assembly [GO:0090307]	Coiled-coil domain-containing protein 52 (Spindle and centriole-associated protein 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centriole [GO:0005814]; cytoplasm [GO:0005737]; spindle [GO:0005819]	centriole [GO:0005814]; cytoplasm [GO:0005737]; spindle [GO:0005819]; cell division [GO:0051301]; mitotic spindle assembly [GO:0090307]		VAGCQSATGAER	10.94999981	1205.945179	10.12995	12.92024	13.92379	14.2679	8.819598	6.495968	11.50309	18.55965	14.83919	11.93625	13.11889	12.06291	17.04628	0	18.16524	15.25465	13.05761	12.05257	12.18366	11.45151	13.82816	0	17.90701	14.14865	11.78202	9.946109	0	13.3101	0	0	0	0	13.21818	14.08431	0	13.22705	14.17156	0	14.06494	0	16.41836	0	0	0	0	0	0	14.05587	0	10.19825	0	0	0	0
I3JDQ6	I3JDQ6_ORENI			Coiled-coil domain-containing protein 55 (Nuclear speckle splicing regulatory protein 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EAEGEKFADK	3.75	1123.747263	14.33241	9.87576	16.27583	13.35373	12.22728	13.06206	15.13966	15.09579	12.20703	14.45349	15.18707	13.79672	13.74618	14.75157	14.05818	13.90768	15.1347	13.92873	12.14096	8.787329	12.57102	15.05122	13.08521	12.02997	13.5714	13.98877	12.82522	10.94872	11.84364	14.33305	0	15.49426	0	0	13.39602	13.59679	12.59902	0	12.85929	12.80094	13.00798	15.16046	16.33006	0	14.41037	0	11.81536	0	14.9913	11.1825	10.32646	11.55225	14.3011	14.80764
I3JUY4	I3JUY4_ORENI	gpatch11		Coiled-coil domain-containing protein 75 (G patch domain-containing protein 11)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	kinetochore [GO:0000776]	kinetochore [GO:0000776]; nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	GGIGMEEMKK	4.610000134	1095.158144	13.40479	13.40352	15.01077	13.37086	0	0	12.83968	0	12.6083	0	17.01154	12.873	13.17193	14.49163	0	13.88543	0	14.37951	14.67079	12.69421	0	15.25008	15.1434	13.57809	14.50593	0	12.12824	11.28409	14.40708	12.05571	19.0417	19.76893	18.42815	0	13.42534	15.17166	15.57127	14.07351	17.19772	0	11.88861	13.52346	13.81013	0	15.23347	0	0	14.07242	0	0	0	14.58895	14.29825	0
A0A669BSM7	A0A669BSM7_ORENI	col4a1		Collagen IV NC1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	basement membrane [GO:0005604]; collagen trimer [GO:0005581]; membrane [GO:0016020]	basement membrane [GO:0005604]; collagen trimer [GO:0005581]; membrane [GO:0016020]; extracellular matrix structural constituent [GO:0005201]	extracellular matrix structural constituent [GO:0005201]	GEQGPPGIGFPGPTGPK	8.880000114	1591.620329	0	15.31371	0	16.37688	16.49157	15.60242	16.06419	15.77102	0	15.2743	15.44387	16.78817	16.53233	16.69998	15.91608	17.31071	16.23173	0	17.21077	0	0	16.04425	0	0	0	17.02147	16.60028	0	16.76362	16.5414	16.47411	0	17.52225	18.21775	17.12022	0	17.30026	16.73507	0	15.38628	16.01802	0	16.34667	16.57257	16.70331	15.80232	0	16.41075	0	16.28625	15.24073	0	14.31434	16.04386
G9M6I7	G9M6I7_ORENI	COL1A3		Collagen type I alpha 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	collagen trimer [GO:0005581]	collagen trimer [GO:0005581]; extracellular matrix structural constituent [GO:0005201]; metal ion binding [GO:0046872]	extracellular matrix structural constituent [GO:0005201]; metal ion binding [GO:0046872]	GLTGPIGVPGPPGAQGEK	2.299999952	1630.936591	0	11.16061	0	14.52902	0	0	16.24103	0	0	13.7254	0	13.07588	0	0	12.74244	0	0	0	0	0	0	17.9276	0	10.67076	0	0	15.42305	0	14.06568	0	15.50911	0	13.06914	13.84369	0	14.56734	15.25654	0	0	0	0	0	11.91716	0	14.0952	0	14.6307	14.61662	0	14.70688	0	14.68784	14.83716	0
A0A669BIT2	A0A669BIT2_ORENI		cell adhesion [GO:0007155]	Collagen type VI alpha 3 chain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	collagen trimer [GO:0005581]	collagen trimer [GO:0005581]; serine-type endopeptidase inhibitor activity [GO:0004867]; cell adhesion [GO:0007155]	serine-type endopeptidase inhibitor activity [GO:0004867]	MAGVEMFAVGVQDAVDWELR	6.199999809	2238.377695	10.58404	6.107342	14.22895	14.40998	12.6112	13.53055	0	11.29339	12.39838	0	13.3891	15.22581	12.70671	0	14.6216	8.718996	12.94267	13.03477	0	11.09937	15.29603	13.78047	14.56089	0	10.73808	0	14.64294	0	12.13564	13.23115	15.51374	14.65513	0	10.17158	13.79273	11.16509	0	13.12133	8.015746	0	10.3629	15.55457	14.14879	13.37582	13.61367	13.81398	12.2637	12.83912	0	12.54499	9.748518	0	0	0
A0A669CE32	A0A669CE32_ORENI	COL6A6		Collagen type VI alpha 6 chain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LIISKK	34.95999908	701.462507	19.368	18.69617	18.57407	18.94657	18.56848	18.65939	18.65944	18.49658	17.75471	18.11632	17.87669	18.21319	18.59179	17.82714	18.40152	18.63682	17.24518	18.44028	17.51639	17.83565	16.80281	18.33066	19.44424	17.61007	18.36025	18.53588	14.99183	18.27998	18.10857	18.20105	17.83326	16.96442	18.37832	18.66522	18.07787	18.47221	17.92947	18.64923	19.34325	18.43868	18.53003	18.0526	18.67636	18.59838	18.36947	17.96165	18.34661	18.98635	18.62201	18.56113	17.73382	18.24443	17.55244	17.93105
A0A669BI00	A0A669BI00_ORENI			Collagen type XI alpha 2 chain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		extracellular matrix structural constituent [GO:0005201]	extracellular matrix structural constituent [GO:0005201]	GEKGEAGPAGAAGPPGPK	7.630000114	1549.224199	14.75128	14.64022	14.9983	0	16.0391	14.24424	17.15447	0	16.98613	15.89821	15.83714	0	0	0	0	15.25889	13.3168	0	13.65667	15.2045	14.89288	0	10.30184	16.73737	0	12.80137	10.90228	15.29455	15.21285	10.21778	0	15.4383	0	14.98087	0	13.24573	13.91656	13.96463	0	15.0599	0	0	0	0	0	14.43978	0	0	0	0	0	15.39647	0	15.25516
I3JL73	I3JL73_ORENI	COL22A1		Collagen type XXII alpha 1 chain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	collagen trimer [GO:0005581]	collagen trimer [GO:0005581]		HVSAVLQGLRGDK	3.059999943	1378.841173	13.54838	0	12.06606	13.43578	14.34617	13.56742	12.81745	10.25936	11.14564	12.24438	15.10216	14.22094	13.86065	0	14.25792	0	0	14.60423	12.38444	0	0	0	15.47952	13.59303	14.30954	0	11.56911	0	0	12.36702	14.71751	0	18.43585	14.6058	0	0	0	13.61009	13.65438	12.26274	0	13.48518	7.68854	0	11.2745	0	13.58041	12.77141	13.50341	11.40671	13.87241	12.51208	13.45373	9.659596
A0A669B9E2	A0A669B9E2_ORENI			"Collagen, type II, alpha 1a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		extracellular matrix structural constituent [GO:0005201]; metal ion binding [GO:0046872]	extracellular matrix structural constituent [GO:0005201]; metal ion binding [GO:0046872]	VRSSFVTGPR	16.70999908	1106.333171	12.81852	0	0	12.92739	0	14.08669	0	13.94429	0	0	0	0	14.85854	14.78827	12.57935	14.47462	0	12.70511	0	15.22556	14.95309	13.96871	12.47708	14.89229	0	0	0	0	0	0	13.70332	0	0	0	13.37253	12.14009	0	0	10.03942	16.24347	13.10745	18.02905	14.31528	14.17918	17.15249	13.82726	0	0	0	0	15.23886	0	15.07916	15.29077
A0A669D6Y3	A0A669D6Y3_ORENI			"Collagen, type VI, alpha 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ILTWNSGALHYSDEVK	3.430000067	1831.988407	14.77755	11.78384	0	14.2351	13.7125	0	0	12.56277	13.37832	13.89584	0	0	0	0	0	0	13.12428	0	0	13.50732	14.87585	0	0	0	0	0	0	0	16.67214	0	14.02367	0	0	0	0	14.47404	0	14.48626	0	0	0	0	16.56733	0	15.03573	0	0	0	0	0	0	0	0	0
I3JAW5	I3JAW5_ORENI			"Collagen, type XI, alpha 1a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		extracellular matrix structural constituent [GO:0005201]	extracellular matrix structural constituent [GO:0005201]	GDPGPQGSTGK	6.960000038	998.1387467	14.21318	13.19232	13.27981	0	14.37496	11.49291	12.89007	15.49699	13.80448	13.82127	13.5578	0	17.67641	0	14.50903	11.62809	12.92867	13.63284	0	13.16437	14.27336	12.79119	10.21746	0	0	9.881348	0	14.06521	10.91251	13.61487	0	15.05113	0	14.59186	13.94667	12.51067	0	14.38774	13.59144	0	14.55744	0	13.44291	13.90735	0	11.66	13.35649	12.38057	14.99319	14.97157	0	0	14.35111	15.04959
A0A669B1Z5	A0A669B1Z5_ORENI			"Collagen, type XI, alpha 1b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		extracellular matrix structural constituent [GO:0005201]	extracellular matrix structural constituent [GO:0005201]	AGGEAHK	3.200000048	666.9264446	15.5043	15.30203	15.04586	16.11679	18.2977	16.1567	17.00935	16.0812	17.5287	16.63616	16.88447	15.73923	17.49755	16.82838	14.60204	18.18348	17.31954	18.27679	16.5915	17.33489	16.62333	16.84269	15.30287	17.74276	16.96489	17.91037	19.00429	16.58517	18.24698	17.35559	17.36134	17.75187	17.3585	17.39645	16.98145	0	15.54002	14.66742	16.668	16.01999	15.9464	16.25041	16.31133	15.20281	16.83251	15.44862	17.71721	17.17735	15.69004	15.03135	15.692	17.9088	16.97229	17.35558
I3JMU4	I3JMU4_ORENI			"Collagen, type XII, alpha 1a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	collagen trimer [GO:0005581]; extracellular region [GO:0005576]	collagen trimer [GO:0005581]; extracellular region [GO:0005576]		ELTQSICLR	10.43000031	1120.461281	7.753768	13.49329	0	13.26804	12.92375	14.07652	12.09859	13.09821	0	0	13.05541	14.00029	0	0	0	11.62248	13.59617	17.99386	12.51999	0	0	14.40044	0	0	14.83058	13.68467	14.24057	0	0	17.36997	0	0	0	0	14.08865	0	12.73668	0	14.38603	0	0	14.3121	16.70395	13.20521	0	0	0	12.81758	0	13.0155	0	0	15.07991	0
I3JKP1	I3JKP1_ORENI	kiaa0930		Uncharacterized protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GPQGK	6.949999809	486.0005258	0	15.80916	0	15.82479	15.27294	13.97346	15.81521	16.27159	0	15.42202	14.8828	0	16.53524	16.41917	16.92991	15.06086	0	16.09368	14.95329	0	15.93879	15.32655	16.31964	14.85331	0	13.70961	15.07639	15.60009	0	0	16.94539	17.54986	15.49765	0	0	15.54835	16.02316	15.01009	15.36007	0	16.07424	0	15.73407	16.11371	14.59272	16.41561	16.95705	15.9419	13.8463	0	14.18343	14.23564	14.43335	16.11637
I3JH60	I3JH60_ORENI		cell adhesion [GO:0007155]	"Collagen, type XXVIII, alpha 1b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	collagen trimer [GO:0005581]	collagen trimer [GO:0005581]; serine-type endopeptidase inhibitor activity [GO:0004867]; cell adhesion [GO:0007155]	serine-type endopeptidase inhibitor activity [GO:0004867]	GDRGYEGPK	8.229999542	978.4450143	0	13.65374	13.00813	13.48446	0	11.44624	0	12.81893	0	14.28581	0	13.76748	14.04704	12.99283	10.26999	13.41156	14.35233	14.05781	16.23445	14.22464	12.51479	14.64137	12.10836	0	16.50445	13.15343	17.57743	0	10.0964	11.05401	0	0	14.31764	0	13.3386	0	0	14.24554	13.2818	13.42794	0	0	0	12.51581	0	14.37499	15.12125	0	15.18952	12.4594	15.3737	14.55997	13.8872	15.09956
I3JQB3	I3JQB3_ORENI			"Collagen, type XXVIII, alpha 2a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	collagen trimer [GO:0005581]	collagen trimer [GO:0005581]; serine-type endopeptidase inhibitor activity [GO:0004867]	serine-type endopeptidase inhibitor activity [GO:0004867]	SQGMTGPR	21.10000038	833.2341532	0	17.33231	0	0	0	19.97052	0	14.37946	0	17.04253	13.4333	0	16.7104	18.38524	0	0	0	0	3.211242	0	0	0	0	6.855817	14.81447	0	11.95316	0	0	0	17.49734	0	17.9542	15.41887	0	18.36626	0	0	16.54686	0	20.03677	0	18.94798	0	0	0	18.24145	0	0	14.40411	0	0	15.55537	0
I3KFV2	I3KFV2_ORENI	LOC100702644		Collagen-binding protein (Serpin H1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum [GO:0005783]; extracellular space [GO:0005615]	endoplasmic reticulum [GO:0005783]; extracellular space [GO:0005615]; collagen binding [GO:0005518]; serine-type endopeptidase inhibitor activity [GO:0004867]	collagen binding [GO:0005518]; serine-type endopeptidase inhibitor activity [GO:0004867]	TGLFGFYDDK	12.48999977	1161.446158	14.29309	0	11.25283	12.7877	11.76037	0	14.23828	11.80221	11.76709	11.04814	13.52845	9.821055	7.227207	0	12.44856	10.90834	11.93537	14.2138	0	9.980881	14.76125	12.87099	14.76293	0	0	12.35278	0	0	17.27462	0	0	0	0	0	0	0	0	0	0	13.11136	0	0	14.24032	0	0	0	0	0	14.04777	0	10.1906	0	15.2607	11.97119
I3JCK2	I3JCK2_ORENI		collagen catabolic process [GO:0030574]	Collagenase 3 (Matrix metalloproteinase-13)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular matrix [GO:0031012]; extracellular region [GO:0005576]	extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]; collagen catabolic process [GO:0030574]	metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	EMQKFFK	6.940000057	972.6321781	15.64829	15.64135	15.16905	0	14.59992	16.28892	16.07279	18.46288	15.71299	0	15.5598	0	15.55663	15.49419	15.49116	0	0	14.43903	14.67702	16.24184	15.30405	15.92509	15.04963	0	0	0	0	15.48347	0	0	20.15654	0	15.59502	0	0	0	0	0	0	0	15.4619	15.79521	0	16.9036	15.7321	16.79267	0	0	0	0	17.08382	15.81941	0	0
I3JFL3	I3JFL3_ORENI	COLEC12		Collectin-12	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	collagen trimer [GO:0005581]; integral component of membrane [GO:0016021]	collagen trimer [GO:0005581]; integral component of membrane [GO:0016021]		LDKEVTSLSIVMEEMK	5.099999905	1884.864805	13.26208	0	13.98592	12.35518	14.16353	12.95048	13.29367	15.18451	10.91648	12.73869	15.24267	12.69199	12.8225	15.17898	10.74885	0	14.61575	13.09241	0	6.243929	0	16.23428	0	11.43569	0	13.09244	15.08639	0	0	0	0	0	0	0	0	0	0	14.36766	13.93636	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669CRF4	A0A669CRF4_ORENI	arhgef9		Collybistin (Rac/Cdc42 guanine nucleotide exchange factor 9) (Rho guanine nucleotide exchange factor 9)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; postsynaptic density [GO:0014069]	cytoplasm [GO:0005737]; postsynaptic density [GO:0014069]; guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	GENSSAR	12.98999977	717.5199572	13.06853	0	11.40009	13.06237	13.45153	14.1493	15.92903	14.07492	15.08716	12.97007	10.7816	14.37531	0	0	15.69121	14.34366	14.49869	13.25936	13.11796	12.43023	14.03519	0	15.68432	0	16.50221	0	0	16.2485	16.06538	14.5304	16.84668	0	0	15.4573	16.42464	0	16.20582	16.29911	16.82198	14.91402	0	0	15.79397	16.33817	15.94433	15.15497	15.99349	0	0	0	13.41763	0	0	10.46089
A0A493QWZ7	A0A493QWZ7_ORENI	C4		Complement C4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]	extracellular space [GO:0005615]; endopeptidase inhibitor activity [GO:0004866]	endopeptidase inhibitor activity [GO:0004866]	FTISAMYTHGEK	8.489999771	1401.523247	16.96991	0	0	0	0	16.83319	0	16.47844	0	16.61639	0	0	14.82714	13.33512	15.14414	0	14.65656	12.24264	13.51771	13.81006	15.01276	0	15.1381	0	14.66112	13.87216	14.5133	12.91232	11.78477	0	14.88317	0	15.80601	16.65005	15.86464	15.78491	0	0	15.30381	0	14.55957	0	15.58715	0	15.78045	15.89844	16.65284	0	14.42387	14.76373	0	13.90041	0	0
A0A669CUV3	A0A669CUV3_ORENI	c8b	"complement activation, alternative pathway [GO:0006957]; complement activation, classical pathway [GO:0006958]; cytolysis [GO:0019835]"	Complement component 8 subunit beta (Complement component C8 beta chain)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]; membrane attack complex [GO:0005579]	"extracellular region [GO:0005576]; membrane attack complex [GO:0005579]; complement activation, alternative pathway [GO:0006957]; complement activation, classical pathway [GO:0006958]; cytolysis [GO:0019835]"		CDCVCPVGYTGR	8.590000153	1441.525637	14.74019	13.98761	0	0	15.09498	15.78803	16.90983	0	0	0	0	15.59442	0	15.57776	0	0	0	0	12.02505	0	0	0	0	18.55506	0	15.91988	15.13515	13.84109	0	0	16.62221	0	0	0	15.50859	0	0	15.09753	0	0	0	16.90032	15.5669	0	0	15.1079	15.91954	16.09823	16.8742	0	15.85779	0	0	0
A0A669BJL2	A0A669BJL2_ORENI		complement activation [GO:0006956]	"Complement component c3a, duplicate 5"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]	extracellular space [GO:0005615]; endopeptidase inhibitor activity [GO:0004866]; complement activation [GO:0006956]	endopeptidase inhibitor activity [GO:0004866]	WFNEQQR	8.069999695	1007.625817	14.80474	14.63995	14.54332	0	0	13.04845	13.48035	15.17323	14.93099	0	0	0	15.59673	0	0	15.31944	14.71144	0	0	0	13.70151	0	13.3076	14.45807	0	0	15.2229	0	14.59452	15.15966	15.65513	0	0	0	0	16.08022	0	0	0	0	0	15.2869	14.46857	15.34545	0	15.64792	12.76332	12.73213	16.6569	0	0	14.89383	0	0
I3KPP7	I3KPP7_ORENI	ndufs2		"Complex I-49kD (NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial) (NADH-ubiquinone oxidoreductase 49 kDa subunit)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"4 iron, 4 sulfur cluster binding [GO:0051539]; NAD binding [GO:0051287]; oxidoreductase activity, acting on NAD(P)H [GO:0016651]; quinone binding [GO:0048038]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; NAD binding [GO:0051287]; oxidoreductase activity, acting on NAD(P)H [GO:0016651]; quinone binding [GO:0048038]"	AATMLRSLSK	2.089999914	1094.961351	12.95154	15.22669	12.29733	0	11.54848	12.39976	13.85791	18.33105	13.82465	13.22682	14.61288	0	14.99798	11.78298	0	0	14.28908	13.73434	0	0	0	0	14.74806	15.7128	16.65512	0	0	7.675221	0	15.1621	12.34026	0	0	14.55231	15.0016	14.42667	15.60525	0	0	0	11.96543	0	0	0	0	15.37261	14.02767	0	14.08171	14.65091	0	16.18735	13.21723	0
A0A669B799	A0A669B799_ORENI	ndufb3	electron transport chain [GO:0022900]	Complex I-B12 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3) (NADH-ubiquinone oxidoreductase B12 subunit)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]; electron transport chain [GO:0022900]		WGFAAFTVALAVEYTMFPPK	7.599999905	2261.809712	13.18202	0	11.39118	0	9.927131	12.45587	10.53392	12.66496	0	0	10.34018	0	15.10741	0	13.15959	13.25216	12.34893	14.25482	17.93742	12.58065	0	17.93257	13.87776	11.3087	11.68136	12.42966	0	9.629162	0	10.14105	0	13.2853	11.59058	0	0	14.9372	11.44335	0	9.647173	11.97733	11.85141	13.26381	0	13.99625	13.00377	12.3384	8.933327	0	0	0	0	0	0	13.61378
I3J2U2	I3J2U2_ORENI			Complex I-MWFE (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1) (NADH-ubiquinone oxidoreductase MWFE subunit)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]		VSGTGR	1.889999986	577.3560619	16.11136	16.79461	15.96149	0	15.67961	16.59861	16.50541	0	15.97321	15.39373	17.19045	0	0	0	0	0	0	0	14.90009	0	0	0	0	0	0	17.20494	0	0	0	0	16.04968	0	17.44512	17.0542	0	0	16.5355	0	0	0	0	0	0	0	0	0	16.49361	0	16.04715	0	0	18.38337	0	0
I3IZS3	I3IZS3_ORENI	ndufb5		"Complex I-SGDH (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial) (NADH-ubiquinone oxidoreductase SGDH subunit)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SVAAFAAR	9.010000229	790.7068012	13.35138	12.36683	12.21725	13.4887	12.50132	15.16826	13.59522	14.00703	13.22397	12.49206	14.44367	15.50436	15.56588	0	16.12352	14.82332	12.25201	0	0	0	0	0	0	12.84943	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.29745	15.33545	0	0	16.44211	14.63906	16.05799	15.85971	0	0	0	15.49906	0
A0A669BZ12	A0A669BZ12_ORENI		intracellular protein transport [GO:0006886]	Component of oligomeric Golgi complex 3 (Conserved oligomeric Golgi complex subunit 3)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cis-Golgi network [GO:0005801]; membrane [GO:0016020]	cis-Golgi network [GO:0005801]; membrane [GO:0016020]; intracellular protein transport [GO:0006886]		ILNPK	4.519999981	583.4445194	13.71671	15.2226	13.86577	13.96682	16.05774	15.57383	17.33791	16.0138	10.31314	17.24185	0	16.74386	16.52295	12.42535	16.06522	15.83897	7.8114	15.81744	15.77401	14.44748	15.08907	15.59803	16.1862	0	15.60849	15.79999	15.55496	8.670984	14.79238	16.81275	19.86997	19.0462	0	0	15.15516	15.33021	0	15.53717	0	0	13.74802	9.052167	0	16.88627	0	16.56879	0	11.52725	0	0	17.08122	0	0	0
A0A669D757	A0A669D757_ORENI			Contactin 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VMNEDGVGDLK	7.739999771	1192.66752	14.40977	13.40094	0	12.80721	0	0	0	0	10.45798	0	0	11.9171	0	0	0	0	0	14.27298	13.7978	0	0	0	0	0	14.83411	16.90483	0	0	14.32729	0	10.62603	0	12.84676	11.12889	0	11.49843	0	11.92548	15.07761	0	0	17.23498	0	0	0	0	13.31981	12.64486	0	0	0	0	0	0
A0A669B210	A0A669B210_ORENI			Membrane palmitoylated protein 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AFVPR	5.130000114	589.1221468	0	0	13.56882	14.52655	13.35137	13.04256	14.10738	14.89086	0	14.7672	14.19292	0	15.64572	0	0	0	0	15.77038	15.16775	14.70233	15.25876	0	0	0	13.86487	12.69268	13.10693	0	0	0	17.63289	18.29139	18.15857	14.18173	14.67925	14.26915	0	14.8164	14.43989	14.8243	0	14.54038	14.66597	0	0	0	0	13.89675	16.0687	14.53802	13.96979	12.33441	14.46706	0
A0A669CB37	A0A669CB37_ORENI			Copine 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LLQAPSGVVASR	2.970000029	1198.242329	14.7508	12.67407	14.86927	13.95184	0	13.89085	15.02982	13.45972	15.39924	14.31635	14.37921	0	0	15.88678	14.71919	0	14.89403	0	16.07497	16.58503	16.15459	15.96828	15.12395	16.14938	16.05903	14.66893	0	14.83367	0	0	0	0	15.91269	0	15.60568	0	15.65177	0	13.9627	15.2246	13.75552	15.91328	0	12.67556	0	0	13.49936	0	0	0	14.38836	0	0	0
A0A669BKS0	A0A669BKS0_ORENI			Copine IVb	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DFKHASPAALAK	6.960000038	1254.920588	0	0	11.93401	12.72347	10.4445	0	0	13.09973	0	12.32048	0	14.51923	11.1458	12.04825	0	12.05885	0	7.660388	8.942881	13.79473	0	10.51053	0	17.91087	13.14513	0	11.27827	14.13628	17.38086	0	16.86799	0	0	8.526608	11.79594	11.87124	0	9.57869	11.34727	9.437922	9.936419	14.20532	17.43021	12.95356	12.13599	10.23775	0	13.14454	13.86697	9.232646	12.28594	12.09362	0	12.73876
I3K5B7	I3K5B7_ORENI	slc31a2	cellular copper ion homeostasis [GO:0006878]	Copper transporter	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; copper ion transmembrane transporter activity [GO:0005375]; cellular copper ion homeostasis [GO:0006878]	copper ion transmembrane transporter activity [GO:0005375]	QVVNYR	2.079999924	779.3755498	14.70322	10.92993	11.72522	15.17715	14.05989	13.63332	16.25115	15.25037	14.32774	14.85097	13.90854	13.76904	17.06909	12.49417	14.43204	16.12955	15.77119	13.34096	13.82199	13.52697	16.38325	15.0322	14.76397	13.1206	13.94348	13.61632	13.69497	13.93613	18.27575	16.36388	19.15556	18.73698	18.11958	14.6862	14.8328	11.86929	15.27021	14.20876	15.02441	0	14.66752	0	0	0	0	13.24465	18.22297	15.1713	11.2977	12.60721	15.0342	13.03252	14.40559	15.38025
I3IZW5	I3IZW5_ORENI	cpox	hemoglobin biosynthetic process [GO:0042541]; protoporphyrinogen IX biosynthetic process [GO:0006782]	Coproporphyrinogen oxidase (EC 1.3.3.3)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; coproporphyrinogen oxidase activity [GO:0004109]; hemoglobin biosynthetic process [GO:0042541]; protoporphyrinogen IX biosynthetic process [GO:0006782]	coproporphyrinogen oxidase activity [GO:0004109]	GTREAEMLDALR	22.79000092	1378.755893	17.67863	0	0	18.2632	18.42874	0	17.43781	0	19.48903	0	19.37916	18.75371	0	13.24478	0	0	17.05075	16.35868	18.13818	16.00747	17.43423	18.07458	17.23438	16.50791	17.62531	0	0	0	0	0	0	0	0	0	18.77402	0	0	17.08831	0	0	0	17.86712	0	0	0	0	0	17.27849	0	0	18.18318	19.71441	0	0
A0A669D736	A0A669D736_ORENI	LOC100699679	nucleosome assembly [GO:0006334]	Core histone macro-H2A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleosome [GO:0000786]; nucleus [GO:0005634]	nucleosome [GO:0000786]; nucleus [GO:0005634]; chromatin DNA binding [GO:0031490]; protein heterodimerization activity [GO:0046982]; nucleosome assembly [GO:0006334]	chromatin DNA binding [GO:0031490]; protein heterodimerization activity [GO:0046982]	STKAGVIFPVGR	14.73999977	1229.991532	0	0	0	0	16.41235	13.49866	16.22221	18.20774	17.4202	0	0	0	0	16.99205	0	0	0	0	0	0	13.29994	0	10.31467	0	12.42652	0	0	13.64252	0	13.90124	14.11609	0	0	0	0	0	0	13.72521	12.36238	0	0	0	0	0	0	0	17.10482	0	15.48383	13.52866	12.95415	0	11.51101	11.49027
A0A669DBF5	A0A669DBF5_ORENI		actin cytoskeleton organization [GO:0030036]	Coronin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	actin cytoskeleton [GO:0015629]	actin cytoskeleton [GO:0015629]; actin filament binding [GO:0051015]; actin cytoskeleton organization [GO:0030036]	actin filament binding [GO:0051015]	NGDPILISLK	5.730000019	1070.244622	14.3688	13.59577	14.01749	15.62868	15.45671	11.56789	0	10.19273	0	15.68415	15.20871	0	0	11.49924	17.39885	0	15.15403	10.83204	0	12.01304	0	0	14.14947	14.22462	11.49311	12.54334	0	15.3462	0	14.03089	13.10754	0	14.64234	10.50566	0	0	14.78879	14.09567	12.63467	13.90615	0	14.18261	14.25115	0	11.54467	14.74405	13.05841	9.216446	15.82139	14.74781	10.93648	14.19663	12.46201	0
A0A669E761	A0A669E761_ORENI	LOC100708656		Corpuscles of Stannius protein (Hypocalcin) (Stanniocalcin) (Teleocalcin)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; hormone activity [GO:0005179]	hormone activity [GO:0005179]	SVDKINNVM	3.410000086	1036.024408	13.93601	12.08228	13.83444	17.4958	13.23827	11.02829	12.65622	15.30826	15.42054	15.02221	13.98285	0	0	0	14.13839	0	0	0	13.17467	0	0	0	0	14.06932	0	15.39932	11.93331	14.90506	0	0	0	0	0	0	0	0	0	0	0	0	15.0109	0	12.97397	0	0	0	0	0	0	0	15.97597	15.30757	0	0
I3K3G4	I3K3G4_ORENI	LOC100696724		CortBP2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KPGMSPTPGSPSHSAR	10.26000023	1593.037121	13.99419	11.76029	0	13.61539	13.77665	13.37667	16.13574	16.06367	12.75546	14.4079	5.395434	11.64688	13.61687	14.68035	12.28128	0	13.96315	16.21536	13.51333	0	12.28605	0	0	0	16.7047	12.95435	0	13.05334	0	9.85818	18.47136	15.06913	18.69271	17.00703	15.95377	0	17.08474	13.77429	0	0	16.65748	0	0	0	0	0	14.50657	0	14.13024	0	0	18.07767	15.58112	0
A0A669DFW7	A0A669DFW7_ORENI			Cramped chromatin regulator homolog 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SKGNSTGGVSK	4.590000153	1021.118492	12.78899	14.68606	15.48077	15.87847	0	14.41516	0	13.59618	11.68293	15.61733	13.82146	15.55786	18.25122	13.71856	0	0	14.58859	0	14.51711	0	0	10.82442	0	0	15.13131	0	6.98856	12.96423	15.2251	12.5987	0	13.7349	14.00131	0	13.97611	8.797403	0	13.55169	12.69576	13.73703	11.53335	11.75757	12.64305	0	13.49042	14.30685	13.90767	12.40429	0	16.15979	14.7305	14.03618	0	0
I3KFP0	I3KFP0_ORENI	LOC100701380	phosphocreatine biosynthetic process [GO:0046314]	Creatine kinase (EC 2.7.3.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; creatine kinase activity [GO:0004111]; phosphocreatine biosynthetic process [GO:0046314]	ATP binding [GO:0005524]; creatine kinase activity [GO:0004111]	GGDDLDPNYVLSSR	25.26000023	1502.980787	15.22179	16.18089	13.23164	14.4608	16.59801	15.36721	0	16.05668	0	15.94772	0	16.05358	16.83974	16.22444	15.19824	16.45868	15.26564	13.60547	17.47788	13.84694	15.95022	16.40304	16.80976	15.17102	15.08119	16.1127	14.59297	16.01055	16.87423	13.85838	14.54811	11.54432	0	12.64925	14.7791	15.77091	14.85781	15.18587	15.99357	0	16.0158	14.96358	0	0	0	0	14.68089	14.96123	0	16.76531	17.15689	15.86018	0	0
I3K0X7	I3K0X7_ORENI			Crystallin beta-gamma domain containing 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SPTTAARPGR	2.130000114	1010.289419	13.482	14.75775	17.16157	14.16322	0	0	12.38353	16.35485	14.86164	15.07658	18.65124	0	17.82134	15.43048	15.4037	13.48104	14.28019	0	0	0	0	11.21468	15.75969	14.11607	14.08553	14.16224	0	15.20159	0	14.83573	16.06824	0	0	14.93938	13.92589	0	12.80405	13.65895	0	12.79968	14.33471	15.32457	0	13.32769	0	0	0	12.93258	13.91923	12.1714	14.32486	13.79473	14.53011	0
I3JN68	I3JN68_ORENI			"Crystallin, beta A1a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SNHKESK	3.74000001	828.5916162	14.66615	14.46281	14.21142	0	14.59096	15.6324	13.00757	0	0	14.80311	14.96126	14.77108	12.99357	14.48301	14.24809	15.89523	14.43598	12.45041	9.014441	8.973574	13.58517	14.90965	12.70126	13.35277	14.05814	15.2789	11.86164	12.9591	15.33787	13.24276	16.42499	17.13857	17.44691	15.08858	0	12.86779	0	13.37689	15.86522	15.44759	12.0894	14.52245	14.34262	14.2477	14.79356	0	15.02153	15.15216	14.82517	0	0	0	0	0
I3KF96	I3KF96_ORENI		fatty acid metabolic process [GO:0006631]	"Crystallin, lambda 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"NAD+ binding [GO:0070403]; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]; fatty acid metabolic process [GO:0006631]"	"NAD+ binding [GO:0070403]; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]"	GLEDYMSR	3.25	984.6235385	14.09827	13.27138	13.33221	12.18048	11.49307	0	14.37277	13.15323	0	13.14978	14.49171	13.65679	11.53347	13.08213	14.17884	13.93546	13.95043	11.74717	14.20049	14.89697	14.38582	12.37414	0	0	0	0	14.32863	13.31387	13.77734	0	15.83991	9.823061	0	0	9.432965	14.34296	13.41059	0	0	0	0	0	0	0	0	0	0	0	13.64145	0	0	13.72173	0	0
A0A669EIB6	A0A669EIB6_ORENI		protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511]	Cullin 4A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cullin-RING ubiquitin ligase complex [GO:0031461]	cullin-RING ubiquitin ligase complex [GO:0031461]; ubiquitin protein ligase binding [GO:0031625]; protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511]	ubiquitin protein ligase binding [GO:0031625]	IMIIFR	26.45999908	792.6352709	17.53214	16.77244	16.37053	17.1656	16.7279	15.8601	16.46983	16.89484	17.4745	16.19935	16.79032	15.90496	14.86779	16.23395	16.10869	15.93248	14.91667	15.03389	15.37232	15.38239	15.69047	16.09223	15.22867	16.02181	16.08338	0	0	0	15.94154	16.69401	16.5817	0	17.46563	17.54543	16.84875	17.30116	17.43497	17.09674	17.3133	16.95462	16.93809	17.51336	17.76558	16.79939	17.33619	16.72296	16.6884	16.13138	16.72213	15.6646	15.97483	17.23917	0	0
A0A669ENE9	A0A669ENE9_ORENI		protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511]	Cullin 4B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cullin-RING ubiquitin ligase complex [GO:0031461]	cullin-RING ubiquitin ligase complex [GO:0031461]; ubiquitin protein ligase binding [GO:0031625]; protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511]	ubiquitin protein ligase binding [GO:0031625]	FSCNDDFK	8.699999809	1031.744737	0	18.95504	16.55562	17.65437	15.6769	16.71213	15.43559	17.75048	17.62146	16.45963	17.28676	10.18056	18.29873	15.87237	14.56549	18.64051	17.81235	17.36067	17.7142	18.35119	12.2539	13.25934	18.71307	18.05484	17.11489	17.53388	18.21711	13.70496	17.37549	17.93109	20.59187	19.61048	0	17.09901	17.25897	18.63187	17.24631	18.41155	17.3695	18.37523	17.76288	18.40392	18.78555	18.72165	17.9033	17.00871	21.65979	17.69573	14.76979	18.22319	0	18.60504	17.26385	15.88268
I3JPQ5	I3JPQ5_ORENI	atf2	regulation of transcription by RNA polymerase II [GO:0006357]	Cyclic AMP-dependent transcription factor ATF-2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; regulation of transcription by RNA polymerase II [GO:0006357]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	KVWVQSLEK	6.420000076	1117.694835	11.78295	10.13905	12.60933	6.977264	13.72216	0	17.23148	13.92693	16.56212	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.39427	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669E7G6	A0A669E7G6_ORENI			Cyclic AMP-dependent transcription factor ATF-7	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	AEDLANMNVSLTNEVTHLR	4.769999981	2127.794909	13.48507	13.56939	17.47507	10.16512	0	0	0	12.69093	0	0	0	0	0	0	0	15.72345	0	0	0	16.82059	0	0	16.21137	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.7441	0	0	0	0	0	0	0	0
I3KB25	I3KB25_ORENI		response to stimulus [GO:0050896]	Cyclic nucleotide gated channel subunit alpha 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; voltage-gated potassium channel activity [GO:0005249]; response to stimulus [GO:0050896]	voltage-gated potassium channel activity [GO:0005249]	LYGTMELMQVK	9.050000191	1327.805786	0	0	0	0	0	15.05836	11.68548	0	14.31327	0	0	15.00493	13.80413	0	16.62782	13.53114	13.97534	10.79763	0	0	0	15.45663	17.10671	13.14987	13.40333	0	16.24129	15.02435	0	11.81606	17.96349	0	0	14.85186	14.99048	10.31021	0	11.66897	13.90903	0	0	13.3555	0	15.04209	13.9208	0	0	0	0	13.65818	13.50916	12.7847	0	0
A0A669DVC6	A0A669DVC6_ORENI		response to stimulus [GO:0050896]; visual perception [GO:0007601]	Cyclic nucleotide gated channel subunit alpha 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; intracellular cyclic nucleotide activated cation channel activity [GO:0005221]; response to stimulus [GO:0050896]; visual perception [GO:0007601]	intracellular cyclic nucleotide activated cation channel activity [GO:0005221]	SKFESIQIYR	4.119999886	1269.700771	16.04736	0	15.28474	0	14.87978	0	0	17.17291	15.29196	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.98099	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KK99	I3KK99_ORENI		response to stimulus [GO:0050896]	Cyclic nucleotide gated channel subunit alpha 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ion channel activity [GO:0005216]; response to stimulus [GO:0050896]	ion channel activity [GO:0005216]	DITGDVSIRGNR	1.460000038	1301.915857	10.58583	0	12.96811	11.88612	12.62083	15.63038	10.4008	0	0	0	0	14.39983	11.67833	12.81922	16.76601	12.20539	14.2947	0	0	10.64239	14.19179	9.554306	14.0107	14.49953	0	0	10.70894	0	14.31699	0	0	0	0	7.878045	0	0	9.812551	12.67348	12.92719	14.41946	0	10.82355	0	12.78869	0	0	10.57209	0	0	0	0	0	0	0
I3JAN0	I3JAN0_ORENI		visual perception [GO:0007601]	"Cyclic nucleotide gated channel subunit beta 3, tandem duplicate 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; intracellular cAMP-activated cation channel activity [GO:0005222]; intracellular cGMP-activated cation channel activity [GO:0005223]; visual perception [GO:0007601]	intracellular cAMP-activated cation channel activity [GO:0005222]; intracellular cGMP-activated cation channel activity [GO:0005223]	GSSQKSAAPALTSSSIQWR	6.510000229	1963.007758	0	12.0053	13.99559	11.32969	0	9.090629	15.3679	11.39208	0	13.28497	12.84017	15.17372	11.94263	12.53576	11.13958	0	15.05444	11.82088	13.80785	0	0	0	14.41414	12.5987	0	0	14.71363	12.77661	11.04853	0	14.82251	13.84136	0	11.15241	12.01272	0	12.71325	0	0	14.63446	17.3918	13.64826	12.61982	7.899167	13.28895	14.00514	14.65807	14.65948	17.98333	14.65079	12.64837	13.63428	14.68382	0
A0A669F8J2	A0A669F8J2_ORENI	rapgef2	cell differentiation [GO:0030154]; regulation of cell population proliferation [GO:0042127]; small GTPase mediated signal transduction [GO:0007264]	Cyclic nucleotide ras GEF (Neural RAP guanine nucleotide exchange protein) (PDZ domain-containing guanine nucleotide exchange factor 1) (RA-GEF-1) (Rap guanine nucleotide exchange factor 2) (Ras/Rap1-associating GEF-1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell junction [GO:0030054]; late endosome [GO:0005770]; membrane [GO:0016020]; perinuclear region of cytoplasm [GO:0048471]	cell junction [GO:0030054]; late endosome [GO:0005770]; membrane [GO:0016020]; perinuclear region of cytoplasm [GO:0048471]; GTPase activator activity [GO:0005096]; guanyl-nucleotide exchange factor activity [GO:0005085]; cell differentiation [GO:0030154]; regulation of cell population proliferation [GO:0042127]; small GTPase mediated signal transduction [GO:0007264]	GTPase activator activity [GO:0005096]; guanyl-nucleotide exchange factor activity [GO:0005085]	RSSFLNAK	8.699999809	921.8857813	14.96826	15.42027	15.63235	14.77784	0	14.76892	0	0	14.99228	0	15.68875	0	15.45037	14.75609	14.67938	0	0	14.00204	0	0	0	11.61224	0	14.24767	13.32267	0	0	14.80789	0	15.13673	15.35459	0	0	0	0	0	13.52702	0	13.80235	0	15.35194	0	0	14.17261	14.66653	0	0	13.26613	0	0	0	0	12.33208	0
I3IWA6	I3IWA6_ORENI	LOC100702614	regulation of ion transmembrane transport [GO:0034765]	Cyclic nucleotide-binding domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; voltage-gated potassium channel activity [GO:0005249]; regulation of ion transmembrane transport [GO:0034765]	voltage-gated potassium channel activity [GO:0005249]	HGSARIGGMK	1.139999986	1012.571168	11.16457	13.07111	0	11.67404	10.34864	0	0	13.29374	13.34413	13.8888	8.269656	0	16.31073	16.1878	15.19994	14.04903	11.68194	12.06317	0	13.19816	0	0	0	0	0	0	0	13.60747	0	0	14.96715	0	0	13.65192	13.91605	14.15131	0	0	14.97577	0	12.73816	0	0	0	0	0	0	0	0	0	0	0	15.73669	0
A0A669DYN9	A0A669DYN9_ORENI	mocs1	Mo-molybdopterin cofactor biosynthetic process [GO:0006777]	"Cyclic pyranopterin monophosphate synthase (EC 4.1.99.22) (EC 4.6.1.17) (GTP 3',8-cyclase) (Molybdenum cofactor biosynthesis protein A) (Molybdenum cofactor biosynthesis protein C)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	molybdopterin synthase complex [GO:0019008]	"molybdopterin synthase complex [GO:0019008]; 4 iron, 4 sulfur cluster binding [GO:0051539]; cyclic pyranopterin monophosphate synthase activity [GO:0061799]; GTP 3',8'-cyclase activity [GO:0061798]; GTP binding [GO:0005525]; metal ion binding [GO:0046872]; Mo-molybdopterin cofactor biosynthetic process [GO:0006777]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; cyclic pyranopterin monophosphate synthase activity [GO:0061799]; GTP 3',8'-cyclase activity [GO:0061798]; GTP binding [GO:0005525]; metal ion binding [GO:0046872]"	AAPVSMCCR	7.059999943	1066.976497	13.98045	16.82544	12.25918	14.37178	12.68712	13.39966	14.85305	0	0	13.43888	16.51748	14.81184	15.11753	12.70099	15.30769	12.64423	17.88319	14.07984	0	17.10031	13.20815	0	12.38983	12.86682	0	12.78051	14.60009	13.03076	14.74759	13.0199	15.07394	13.94625	0	14.00589	15.45821	10.2481	0	14.15232	13.1807	11.71774	12.34732	11.32987	12.51581	14.0655	14.20246	14.44486	9.057311	13.30878	0	15.0015	14.73217	0	12.38914	0
I3JTT1	I3JTT1_ORENI		neuroblast proliferation [GO:0007405]; neuronal stem cell population maintenance [GO:0097150]	Cyclin Dx	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		neuroblast proliferation [GO:0007405]; neuronal stem cell population maintenance [GO:0097150]		DEEVETERPGTPADMR	9.630000114	1830.782834	15.86508	14.34943	0	18.77691	0	0	10.23577	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19.31622	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DV88	A0A669DV88_ORENI	LOC100692470		Cyclin N-terminal domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VANSDVER	4.960000038	890.151855	13.46465	15.34572	12.59818	0	11.55053	13.47669	0	0	13.40865	13.92438	0	14.79334	11.41496	0	0	14.48812	10.0283	0	12.07441	14.53236	13.54957	0	12.50878	15.0605	13.05481	13.8894	13.56801	0	13.9648	13.42667	15.36167	14.11707	12.88769	14.21144	0	11.594	0	14.03585	14.40638	13.42191	12.65042	11.5306	14.42694	12.56095	11.91457	15.60922	0	13.40933	0	13.91138	0	0	0	12.37667
A0A669CAX6	A0A669CAX6_ORENI		regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]	Cyclin Pas1/PHO80 domain containing 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein kinase binding [GO:0019901]; regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]	protein kinase binding [GO:0019901]	VQALLMPG	7.590000153	845.298848	9.857044	0	11.66222	0	13.8354	0	0	20.48112	14.66189	19.51336	0	12.93239	10.38067	13.58089	16.93987	13.58474	14.58211	16.34391	13.45254	0	9.625166	0	12.29016	18.58512	10.65626	13.66877	8.286391	0	0	0	15.03516	0	12.1229	7.959549	0	9.784219	0	14.5712	13.67859	12.14867	0	0	0	13.96783	0	0	0	12.10086	0	16.44608	17.09401	0	0	13.29918
I3IUP6	I3IUP6_ORENI	CNNM1		Cyclin and CBS domain divalent metal cation transport mediator 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		TIWVTRLLMVLSFPISYPISK	5.230000019	2465.214933	0	0	10.03838	0	11.46066	0	0	0	11.38103	12.28649	0	0	0	9.16318	15.55186	0	0	12.17231	12.42675	11.99871	10.62928	0	0	14.24559	0	11.51672	0	0	0	0	11.8982	13.70772	12.25836	12.78909	12.16154	14.21652	12.29056	12.167	12.68332	10.2787	0	9.91998	0	0	0	13.19631	0	0	11.90576	0	0	9.904752	13.99129	0
A0A669BY65	A0A669BY65_ORENI			Cyclin and CBS domain divalent metal cation transport mediator 4a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GGSGMMDAVDK	2.680000067	1066.581091	14.05824	11.75266	15.38921	11.57511	13.16972	14.37925	18.09845	10.93806	14.1686	15.60026	15.76333	0	10.81765	15.75818	0	15.13216	0	14.65509	15.58502	14.51835	16.85938	15.57011	15.61016	14.41206	13.87825	0	0	15.65961	15.51296	14.92066	13.58618	15.58575	15.65611	15.84342	14.43207	14.08776	15.20192	14.57087	13.85351	14.7153	14.66742	0	16.24192	0	14.36107	13.98745	12.64727	0	15.09923	11.57658	16.45254	16.85444	16.79442	15.28869
A0A669BYL6	A0A669BYL6_ORENI	ccnh	"regulation of transcription by RNA polymerase II [GO:0006357]; transcription, DNA-templated [GO:0006351]"	Cyclin-H	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	transcription factor TFIIK complex [GO:0070985]	"transcription factor TFIIK complex [GO:0070985]; cyclin-dependent protein serine/threonine kinase regulator activity [GO:0016538]; regulation of transcription by RNA polymerase II [GO:0006357]; transcription, DNA-templated [GO:0006351]"	cyclin-dependent protein serine/threonine kinase regulator activity [GO:0016538]	WGNIVLSLTVLF	2.220000029	1362.927617	15.44018	16.51479	18.86003	15.36983	14.47942	15.4406	16.95417	12.11537	13.33117	15.58113	0	15.82394	0	15.63357	16.65828	16.59766	14.97182	15.23092	14.64844	0	15.05888	12.21912	18.02431	0	0	0	0	0	0	14.03152	15.76662	0	14.73161	12.99921	0	0	0	0	14.03635	14.71925	0	0	14.4694	16.29194	14.01058	16.20504	0	0	18.55368	15.51181	0	0	0	0
I3K8L4	I3K8L4_ORENI			Cyclin-dependent kinase 2 interacting protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LNEDGFMAAASIVNMRR	7.119999886	1910.061641	0	0	17.14607	17.40726	17.88309	0	0	0	0	0	0	0	0	0	17.19715	18.66242	0	16.36078	0	0	0	0	0	0	0	0	0	0	18.13449	0	17.30463	0	0	0	18.40623	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18.00161	0	0	0	0
A0A669DJX2	A0A669DJX2_ORENI			Cyclin-dependent kinase 5 activator	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	plasma membrane [GO:0005886]; protein kinase 5 complex [GO:0016533]	plasma membrane [GO:0005886]; protein kinase 5 complex [GO:0016533]; cyclin-dependent protein serine/threonine kinase activator activity [GO:0061575]	cyclin-dependent protein serine/threonine kinase activator activity [GO:0061575]	KVPQGTVTSSPK	11.46000004	1228.455105	0	13.60248	13.36087	13.80133	10.73044	13.47586	0	12.11931	0	14.60511	15.21222	13.40349	0	12.77431	12.84548	14.58334	13.77914	11.97839	14.70361	13.45372	13.62033	15.4454	14.40438	0	10.94836	15.81689	10.40918	13.14863	13.16964	0	22.52488	0	22.61693	15.92339	0	0	13.94287	0	0	14.879	14.32698	0	12.98094	0	0	0	15.08688	0	0	10.00837	0	0	12.28127	0
I3JKR1	I3JKR1_ORENI		cyclooxygenase pathway [GO:0019371]; inflammatory response [GO:0006954]; regulation of blood pressure [GO:0008217]; response to oxidative stress [GO:0006979]	Cyclooxygenase-1 (EC 1.14.99.1) (Prostaglandin G/H synthase 1) (Prostaglandin H2 synthase 1) (Prostaglandin-endoperoxide synthase 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		heme binding [GO:0020037]; metal ion binding [GO:0046872]; peroxidase activity [GO:0004601]; prostaglandin-endoperoxide synthase activity [GO:0004666]; cyclooxygenase pathway [GO:0019371]; inflammatory response [GO:0006954]; regulation of blood pressure [GO:0008217]; response to oxidative stress [GO:0006979]	heme binding [GO:0020037]; metal ion binding [GO:0046872]; peroxidase activity [GO:0004601]; prostaglandin-endoperoxide synthase activity [GO:0004666]	TCPYVSFR	11.88000011	1028.347761	15.24172	0	0	13.81487	0	12.16995	12.96046	0	11.57906	15.51532	13.99969	0	13.82218	0	0	15.53396	11.90366	0	15.43602	13.62532	13.02358	15.5437	14.73776	0	0	11.68644	0	0	0	0	21.07388	17.99047	0	16.35281	14.52928	14.6012	13.87224	11.44736	0	7.019965	0	0	0	0	0	14.45282	0	0	0	14.07965	14.28079	15.12547	10.53246	0
A0A669CLE9	A0A669CLE9_ORENI		protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	"Cylindromatosis (turban tumor syndrome), like"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		thiol-dependent ubiquitin-specific protease activity [GO:0004843]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	thiol-dependent ubiquitin-specific protease activity [GO:0004843]	LMKHHSGR	9.489999771	964.7444339	16.30206	16.22488	15.18815	14.68414	15.84996	20.02305	16.73233	21.58818	17.20691	21.90242	22.16765	17.32589	20.86311	0	15.11569	20.40419	19.38651	19.5757	0	19.79714	16.16863	0	16.64004	19.85049	21.1373	22.29155	21.596	16.94823	20.71891	16.19694	21.381	18.86857	17.96714	13.2853	18.43094	22.02449	16.6634	17.51781	20.63957	15.79713	15.62461	19.17519	21.73228	21.11913	14.98718	17.52127	20.17354	16.71293	17.69737	18.97279	16.55054	20.62402	20.14425	21.44411
A0A669BAG0	A0A669BAG0_ORENI			Cys_knot domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; hormone activity [GO:0005179]	hormone activity [GO:0005179]	KQNQSMMTGGYEAALK	1.049999952	1771.645043	17.81359	17.40412	16.67305	17.8954	0	0	17.90453	16.35845	17.07215	18.30223	0	16.92944	16.89434	17.45787	0	0	0	16.86529	0	18.7603	0	0	0	0	0	0	0	0	0	0	0	17.5851	14.69172	0	14.12716	12.21824	0	0	18.30529	0	11.73212	14.39734	15.95737	10.81127	14.60305	14.74935	0	0	0	0	0	0	17.82983	0
A0A669D5R0	A0A669D5R0_ORENI	LOC106097837		Cystatin domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cysteine-type endopeptidase inhibitor activity [GO:0004869]	cysteine-type endopeptidase inhibitor activity [GO:0004869]	DPIQPF	1.909999967	715.9443942	14.19074	13.20399	13.12046	0	14.85958	14.99747	13.63304	0	14.0683	14.70603	0	12.36585	14.91468	13.71361	13.08911	12.09787	14.5709	12.2024	14.46726	13.60819	14.64139	0	0	16.88408	13.47556	13.87182	14.54441	14.17661	0	13.3226	15.80081	0	17.98185	15.31232	0	16.4111	0	14.29532	0	0	0	0	15.10766	14.18989	15.24382	0	14.63342	15.08955	0	14.8465	16.07631	0	15.2761	14.17163
I3K2F9	I3K2F9_ORENI	cyyr1		Cysteine and tyrosine-rich protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		METLWR	9.06000042	849.3208477	14.88784	15.43741	11.84064	13.63566	13.80436	11.53864	16.4416	0	15.50228	11.69898	13.90561	14.10807	15.17249	16.06684	13.22369	0	15.3918	0	17.15208	0	15.17583	0	0	16.90813	17.08424	0	0	16.25204	0	0	16.16385	0	0	14.60931	14.98467	14.95108	0	0	0	0	14.13156	12.2295	0	0	0	0	0	13.10234	18.88899	0	17.13242	0	0	0
A0A669EIN1	A0A669EIN1_ORENI	atg4d	autophagy [GO:0006914]; protein transport [GO:0015031]	Cysteine protease (EC 3.4.22.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; cysteine-type peptidase activity [GO:0008234]; autophagy [GO:0006914]; protein transport [GO:0015031]	cysteine-type peptidase activity [GO:0008234]	SLPSSQAPR	10.81999969	942.2708172	15.06326	14.24795	14.49967	6.342274	14.21423	13.46965	13.64053	14.30836	12.69439	14.51909	13.43558	13.57968	13.79159	11.00516	14.78022	0	13.35289	13.90714	0	13.85729	13.82063	11.74256	14.67874	13.16629	15.19842	14.63867	15.71801	14.95807	14.2026	0	16.35378	16.29318	14.95457	12.3726	16.27296	13.79006	14.54784	15.97733	14.6823	14.1853	14.41304	14.22185	16.14122	15.38981	0	0	0	16.24245	14.23849	12.01771	13.72003	12.98126	15.06267	0
A0A669D4F6	A0A669D4F6_ORENI	cdpf1		Cysteine-rich DPF motif domain-containing protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MEEKAASDNPQK	4.070000172	1365.311231	11.96418	13.34843	13.78833	0	0	15.72296	0	0	17.1802	15.55766	13.06503	14.96834	15.58084	15.26613	14.2903	15.47594	15.09781	0	0	11.74554	0	0	14.57587	0	0	15.33277	0	0	0	0	12.85603	0	13.95246	16.15327	14.75664	14.77732	12.96521	15.96333	13.19648	14.36597	16.66731	0	14.07038	0	15.36603	17.34634	15.61629	0	14.95555	16.1716	0	16.45503	0	0
A0A669CC93	A0A669CC93_ORENI	cars1	cysteinyl-tRNA aminoacylation [GO:0006423]	Cysteinyl-tRNA synthetase (EC 6.1.1.16)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; cysteine-tRNA ligase activity [GO:0004817]; metal ion binding [GO:0046872]; cysteinyl-tRNA aminoacylation [GO:0006423]	ATP binding [GO:0005524]; cysteine-tRNA ligase activity [GO:0004817]; metal ion binding [GO:0046872]	DALAKNTAR	6.809999943	960.4289168	0	0	13.35449	13.11018	14.35516	12.5799	0	10.10786	0	13.4411	14.88235	13.15348	13.80899	13.56733	13.72572	9.791185	13.16863	10.85064	13.11556	12.06748	14.56182	0	14.87692	0	11.56793	0	11.52567	11.09495	13.07334	0	11.44495	0	11.74064	0	0	0	0	0	0	0	0	11.63046	14.28629	12.94865	13.34586	0	13.38696	0	0	0	0	0	15.48277	13.10829
Q800S5	Q800S5_ORENI			Cytochrome P450 aromatase type I	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	FGSIQGLSYLGMNER	3.980000019	1671.13239	15.87987	0	13.24571	0	16.07873	12.91012	0	0	14.80102	14.46062	16.1544	11.7877	13.24993	11.51033	12.68243	15.19023	13.89876	13.35897	14.96408	0	13.74975	13.57173	15.56415	12.3163	0	11.85533	13.67233	13.26207	0	14.25684	0	13.42211	0	14.20952	0	13.33402	12.09378	0	13.31522	0	12.1104	15.06041	8.084513	13.33711	0	0	13.93198	14.02819	0	0	16.57053	13.92607	15.94766	0
Q98SW9	Q98SW9_ORENI			Cytochrome P450 aromatase type II	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	ALEDNDFAGTKIK	4.269999981	1420.533748	13.12337	13.31253	13.14395	14.48179	0	0	0	14.08997	0	13.98962	15.65747	15.4116	14.10415	0	15.46692	13.30319	0	0	15.72613	17.65884	0	0	0	0	0	0	14.30623	15.15056	0	15.89948	0	0	0	14.31154	0	0	0	0	14.2671	0	14.51286	0	15.2477	0	0	15.18498	15.49977	0	0	16.83358	0	0	0	0
I3KYY7	I3KYY7_ORENI			"Cytochrome P450, family 1, subfamily C, polypeptide 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	FLDESGALDK	3.319999933	1093.00468	16.14487	0	0	14.70587	16.39779	0	16.61805	15.64677	0	0	16.21196	0	0	0	17.47722	16.56013	16.94263	16.32096	0	0	17.00436	0	0	0	16.44395	0	0	15.46434	16.36423	0	0	17.4229	18.32386	16.30887	16.93785	16.43612	15.50686	0	0	17.13473	0	15.9054	16.63424	0	0	18.82227	16.54409	16.25905	15.59281	0	0	16.63767	0	15.85727
A0A669AWN6	A0A669AWN6_ORENI			"Cytochrome P450, family 2, subfamily N, polypeptide 13"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	DKMVIISGYK	10.52000046	1146.580803	14.15272	0	12.5712	0	0	13.66109	14.73225	0	0	0	10.44687	11.20298	13.98412	12.50869	16.53226	17.56474	14.11225	14.14622	15.52609	13.26824	14.80653	18.18053	14.42903	14.54352	0	13.20216	12.09304	14.69528	0	11.98848	16.78094	21.40591	16.32006	13.86164	14.46395	0	12.87883	13.94531	13.746	0	14.02672	14.05499	0	0	12.66637	15.6598	14.21063	12.64614	0	0	0	0	0	0
A0A669BVI6	A0A669BVI6_ORENI			"Cytochrome P450, family 3, subfamily A, polypeptide 65"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]	"integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen [GO:0016712]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen [GO:0016712]"	EVHPSLALR	1.409999967	1021.662226	12.33158	13.07195	14.85438	11.8703	14.5977	12.43049	15.97112	0	14.75886	0	0	0	17.20561	15.05791	15.40076	0	15.29672	15.4433	8.737593	13.39439	0	14.58254	0	17.00469	17.29527	15.15769	13.83978	14.66495	0	0	0	0	0	14.53598	14.65401	0	0	0	0	0	0	15.34478	15.29065	0	14.34528	17.47578	0	0	20.64211	17.65887	18.056	16.06605	0	15.29547
I3JGK2	I3JGK2_ORENI	LOC100693612	electron transport chain [GO:0022900]	Cytochrome b-561 (Cytochrome b561)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; transport vesicle membrane [GO:0030658]	integral component of membrane [GO:0016021]; transport vesicle membrane [GO:0030658]; ferric-chelate reductase activity [GO:0000293]; metal ion binding [GO:0046872]; electron transport chain [GO:0022900]	ferric-chelate reductase activity [GO:0000293]; metal ion binding [GO:0046872]	TLTDGGSPTTP	12.09000015	1044.675088	12.76083	14.26103	0	14.14554	14.43947	13.85213	0	0	14.87461	13.63492	0	0	11.78663	0	15.08743	0	0	0	11.04581	11.42469	10.4875	0	14.44649	0	7.868592	12.38907	18.64733	12.04899	0	15.58169	14.74481	12.8196	13.06756	14.93979	18.24879	14.70895	0	0	12.80996	13.65643	12.86633	13.86181	0	14.98371	0	0	13.16843	13.95383	15.12788	0	0	0	17.21333	0
I3JW48	I3JW48_ORENI	LOC100707594		"Cytochrome b-c1 complex subunit Rieske, mitochondrial (EC 7.1.1.8)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]	"integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]; 2 iron, 2 sulfur cluster binding [GO:0051537]; metal ion binding [GO:0046872]; ubiquinol-cytochrome-c reductase activity [GO:0008121]"	"2 iron, 2 sulfur cluster binding [GO:0051537]; metal ion binding [GO:0046872]; ubiquinol-cytochrome-c reductase activity [GO:0008121]"	MMSIAAR	6.480000019	777.9819537	14.97498	0	15.38319	0	15.176	15.86572	0	0	14.14144	16.538	0	14.61589	13.16337	15.72346	0	0	16.49306	15.4394	0	15.34267	0	0	15.28772	0	0	0	15.7849	15.25777	16.57549	15.14298	16.81551	15.3261	14.31711	0	15.1174	15.54429	14.06628	15.96911	0	16.42527	17.39736	18.07949	17.33865	16.5603	0	0	16.25495	0	0	15.43892	17.1385	17.46414	0	15.96978
A0A669EPW0	A0A669EPW0_ORENI	LOC100692041		Cytochrome c domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial intermembrane space [GO:0005758]; respirasome [GO:0070469]	mitochondrial intermembrane space [GO:0005758]; respirasome [GO:0070469]; electron transfer activity [GO:0009055]; heme binding [GO:0020037]; metal ion binding [GO:0046872]	electron transfer activity [GO:0009055]; heme binding [GO:0020037]; metal ion binding [GO:0046872]	STMGDAEK	3.630000114	838.8536338	0	13.43788	0	13.89709	11.35786	13.43306	13.68779	0	0	15.05053	0	13.66465	14.65575	12.68256	15.02202	0	0	0	14.00498	0	15.10931	14.80163	0	0	13.27416	14.38263	0	13.14598	0	0	0	0	13.31029	0	0	0	0	15.2402	10.74231	0	0	12.92439	0	0	0	0	0	14.49644	0	0	15.05091	0	0	13.58812
A0A669F142	A0A669F142_ORENI			Cytochrome c oxidase subunit 7A1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial respirasome [GO:0005746]	mitochondrial respirasome [GO:0005746]; cytochrome-c oxidase activity [GO:0004129]	cytochrome-c oxidase activity [GO:0004129]	HQAFSSSARQLK	1.070000052	1360.886929	10.36391	9.310637	0	7.82275	16.83202	0	0	0	0	11.96122	0	0	12.68815	9.792893	0	0	14.20435	12.99176	0	0	12.92944	13.79182	11.98946	13.57375	0	12.17043	0	0	11.01711	0	11.66616	0	11.36895	0	11.71964	0	0	12.21166	11.35851	0	9.980622	0	0	0	0	0	7.303988	0	0	11.40911	0	0	0	0
A0A669DWW2	A0A669DWW2_ORENI		regulation of ARF protein signal transduction [GO:0032012]	Cytohesin 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]; regulation of ARF protein signal transduction [GO:0032012]	guanyl-nucleotide exchange factor activity [GO:0005085]	KQELLEDIQVILEEDMK	5.789999962	2089.301494	12.21133	14.08719	12.83749	0	13.55308	0	0	0	10.82387	0	14.16035	14.77368	0	14.04048	12.37904	15.76374	0	7.87438	0	0	15.88349	0	0	14.08403	12.81684	13.07663	0	12.87889	12.45007	0	13.17721	0	12.16604	0	13.44015	0	11.78603	12.67372	12.92718	10.5116	0	0	0	0	0	14.64704	12.54854	0	0	15.66337	0	9.770539	0	0
I3KM31	I3KM31_ORENI		regulation of actin filament polymerization [GO:0030833]; retina layer formation [GO:0010842]; retinal ganglion cell axon guidance [GO:0031290]; startle response [GO:0001964]	Cytoplasmic FMR1-interacting protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; small GTPase binding [GO:0031267]; regulation of actin filament polymerization [GO:0030833]; retina layer formation [GO:0010842]; retinal ganglion cell axon guidance [GO:0031290]; startle response [GO:0001964]	small GTPase binding [GO:0031267]	ISAAMYK	3.660000086	782.7121609	13.21394	13.64664	14.30532	14.28922	12.34997	14.27458	15.00069	11.92995	13.65235	14.0064	13.59128	12.97935	12.76619	14.27807	0	14.46083	0	10.71896	0	14.12018	15.14212	14.22468	15.2361	0	14.0586	15.2721	0	14.1257	0	12.00371	16.96481	0	0	0	0	0	0	0	15.41576	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669BMH4	A0A669BMH4_ORENI	DYNC2H1	microtubule-based movement [GO:0007018]; multicellular organism development [GO:0007275]	Cytoplasmic dynein 2 heavy chain 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; microtubule [GO:0005874]; plasma membrane [GO:0005886]	"cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; microtubule [GO:0005874]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]; microtubule-based movement [GO:0007018]; multicellular organism development [GO:0007275]"	"ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]"	AKIDDELK	5.320000172	932.2220442	0	13.49664	0	0	16.70136	16.67726	0	0	0	14.34461	0	14.48651	14.82221	0	0	0	0	0	0	15.30501	0	16.7346	0	0	14.12448	18.22177	15.45856	0	14.39285	0	15.48603	0	15.15081	0	0	0	0	0	0	0	0	0	0	15.72244	0	0	14.74617	17.10933	16.85893	0	0	19.18361	0	0
A0A669BJ11	A0A669BJ11_ORENI	dync2li1	intraciliary retrograde transport [GO:0035721]; intraciliary transport involved in cilium assembly [GO:0035735]	Cytoplasmic dynein 2 light intermediate chain 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]; cytoplasm [GO:0005737]; cytoplasmic dynein complex [GO:0005868]; microtubule [GO:0005874]; microtubule organizing center [GO:0005815]	cilium [GO:0005929]; cytoplasm [GO:0005737]; cytoplasmic dynein complex [GO:0005868]; microtubule [GO:0005874]; microtubule organizing center [GO:0005815]; intraciliary retrograde transport [GO:0035721]; intraciliary transport involved in cilium assembly [GO:0035735]		GHNTPK	5.420000076	652.2759609	0	14.99265	0	0	0	0	16.30058	17.23044	15.86995	0	16.42051	17.41433	15.34001	17.63068	16.58636	0	19.48282	20.03025	0	0	15.08212	14.54812	0	15.292	17.21009	0	14.29503	0	0	0	0	0	15.67795	0	0	16.32375	14.4981	0	13.09115	15.66281	0	0	14.83272	0	0	0	0	15.77774	0	13.22415	0	17.01076	0	15.7009
A0A669B2K2	A0A669B2K2_ORENI			Cytoplasmic linker associated protein 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	condensed chromosome kinetochore [GO:0000777]; cytoplasmic microtubule [GO:0005881]; Golgi apparatus [GO:0005794]; kinetochore microtubule [GO:0005828]; microtubule organizing center [GO:0005815]	condensed chromosome kinetochore [GO:0000777]; cytoplasmic microtubule [GO:0005881]; Golgi apparatus [GO:0005794]; kinetochore microtubule [GO:0005828]; microtubule organizing center [GO:0005815]; kinetochore binding [GO:0043515]; microtubule plus-end binding [GO:0051010]	kinetochore binding [GO:0043515]; microtubule plus-end binding [GO:0051010]	EFAPYGFGETICTYDK	2.630000114	1898.458543	12.58609	0	14.00209	14.55695	0	0	14.47194	14.18875	10.78587	12.62791	0	0	0	12.36992	0	14.24582	0	12.48242	14.52514	0	0	9.835249	0	13.97466	0	14.28444	13.1003	0	15.26597	0	12.47917	0	0	0	0	0	0	0	0	0	0	0	13.64336	0	0	15.34278	0	0	0	0	0	0	0	0
I3JRN1	I3JRN1_ORENI	CTU2 NCS2	protein urmylation [GO:0032447]; tRNA thio-modification [GO:0034227]; tRNA wobble uridine modification [GO:0002098]	Cytoplasmic tRNA 2-thiolation protein 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; nucleotidyltransferase activity [GO:0016779]; tRNA binding [GO:0000049]; protein urmylation [GO:0032447]; tRNA thio-modification [GO:0034227]; tRNA wobble uridine modification [GO:0002098]	nucleotidyltransferase activity [GO:0016779]; tRNA binding [GO:0000049]	AVLGKNR	12.21000004	756.5171637	15.66943	10.27591	14.54886	15.62888	14.42238	13.29096	14.99399	15.50199	0	16.01369	14.67698	13.91107	15.33544	0	15.25377	14.09997	0	14.46068	14.50813	14.2479	11.60589	15.76634	15.2514	12.90937	18.77821	13.49512	14.0467	0	9.561777	14.45742	0	17.66714	18.82964	15.62606	14.35808	17.70773	16.61478	13.33945	14.56689	15.26207	16.06195	11.8665	14.46095	15.28286	13.05887	0	15.31528	13.43254	15.199	13.62553	13.75824	15.87063	13.7352	15.40498
A0A669EHF7	A0A669EHF7_ORENI	specc1l	cell cycle [GO:0007049]; cell division [GO:0051301]	Cytospin-A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; gap junction [GO:0005921]; spindle [GO:0005819]	cytoplasm [GO:0005737]; gap junction [GO:0005921]; spindle [GO:0005819]; cell cycle [GO:0007049]; cell division [GO:0051301]		TPLSPSPMK	1.679999948	973.7669847	12.97008	15.56687	0	0	0	14.59789	16.45685	15.61135	0	0	12.0074	14.09246	16.01423	16.87979	14.61437	12.57315	15.83742	15.05283	14.20978	17.03547	15.3638	15.56524	15.06514	11.12657	16.12032	0	16.30824	0	13.66697	16.13543	16.17826	14.95645	15.70461	0	13.53981	0	14.85262	0	16.02161	0	12.85575	13.76585	15.58515	15.28146	10.75087	15.29689	14.69483	16.03172	14.16213	0	0	17.43332	13.35789	0
I3JTX7	I3JTX7_ORENI	LOC100704071		DAGKc domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		NAD+ kinase activity [GO:0003951]	NAD+ kinase activity [GO:0003951]	HLLRHTNK	15.31999969	1017.408991	0	14.77493	0	0	12.16792	12.74528	13.77894	15.59154	0	0	0	15.84713	14.94193	12.26977	13.82897	18.60074	17.13524	16.4485	11.00017	12.0536	14.51453	14.2156	13.29013	0	0	0	16.19436	14.21979	12.68809	13.43291	20.89818	21.2469	17.71968	15.15361	13.53821	13.5875	16.82236	14.71294	0	13.46354	16.23431	13.73306	0	16.50321	0	0	0	14.57749	0	18.49928	14.7023	16.27711	13.3557	0
I3K6Y8	I3K6Y8_ORENI	dao	D-amino acid metabolic process [GO:0046416]	DAO domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	peroxisome [GO:0005777]	peroxisome [GO:0005777]; D-amino-acid oxidase activity [GO:0003884]; FAD binding [GO:0071949]; D-amino acid metabolic process [GO:0046416]	D-amino-acid oxidase activity [GO:0003884]; FAD binding [GO:0071949]	MVMFDSFMDMR	6.809999943	1442.104341	11.85234	11.74791	11.28237	14.52757	0	0	12.65386	0	6.404081	15.13627	15.04384	14.56585	13.80865	0	13.644	0	14.66776	0	15.56831	0	0	11.68715	14.83546	12.37895	0	0	13.02736	15.98384	15.34964	12.46877	17.25826	17.05139	17.55436	13.61936	13.8635	13.81845	15.78432	14.62803	0	9.994079	14.93947	0	13.57997	15.0748	0	13.50441	0	0	0	11.92684	14.78444	15.13738	0	0
A0A669BBE0	A0A669BBE0_ORENI	LOC100707794		DBF4-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	GYGLLGK	4.460000038	707.9827435	15.54245	15.99403	14.28269	0	0	0	12.1666	16.29929	0	15.1074	0	0	12.18023	14.66783	16.15141	0	0	14.83067	16.14074	0	15.57197	0	17.34901	0	16.65368	0	14.12536	0	13.0929	14.56417	20.97232	18.25895	21.58414	16.03617	14.21386	16.30017	12.82505	0	0	0	14.44659	0	0	0	15.81889	17.60004	14.9367	13.89763	15.41199	0	0	16.82128	16.65252	17.07469
I3J162	I3J162_ORENI			DC-STAMP domain containing 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GGGGGR	2.150000095	459.1575677	16.36128	15.94409	15.12053	15.80211	15.45596	15.76421	14.90807	14.92409	15.03185	15.33716	15.17294	15.51696	15.54754	15.61521	15.51372	15.99812	15.89043	15.75232	15.77601	15.82457	16.13527	15.65977	15.23776	15.96643	16.04376	15.40899	15.13654	16.10421	16.60243	15.46395	16.89565	17.16071	16.12951	14.42583	15.31296	14.11018	15.35354	15.78009	16.21748	16.44495	15.6969	15.74588	15.8447	15.29092	14.79905	15.87091	15.36423	16.45575	15.72472	15.90677	15.591	15.97116	15.66522	15.5181
A0A669B284	A0A669B284_ORENI	dcaf15	protein ubiquitination [GO:0016567]	DCAF15_WD40 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein ubiquitination [GO:0016567]		GKLSGQFSQR	4.809999943	1105.251174	0	0	11.4273	8.64992	0	13.85683	12.03486	0	0	0	11.69524	0	0	12.38887	16.0112	14.61976	0	14.17984	0	0	12.44105	0	0	11.30221	11.17546	15.05249	14.79505	11.33033	9.595614	11.50686	12.21736	13.2838	14.4616	10.92505	15.06765	13.08698	14.12941	0	13.66223	0	0	12.31933	12.409	15.59675	0	0	16.85682	0	15.07414	19.39062	0	0	0	0
I3IU87	I3IU87_ORENI	dcaf13	protein ubiquitination [GO:0016567]	DDB1- and CUL4-associated factor 13 (WD repeat and SOF domain-containing protein 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]; protein ubiquitination [GO:0016567]		TFQAHEGFVRGMVVR	10.85999966	1750.154944	0	0	15.14404	0	16.29587	0	0	16.3565	16.53852	0	0	0	0	0	16.17781	17.03959	0	15.23927	0	0	16.08836	18.00564	0	15.81492	14.4231	0	16.50059	15.82872	0	14.41161	16.85888	14.94934	15.7829	16.58191	14.48267	15.66849	0	0	15.16795	16.69061	15.55913	15.16274	16.42438	0	0	15.912	17.69828	16.06017	17.44869	17.46831	16.22958	0	17.75898	18.20286
I3IXW8	I3IXW8_ORENI	LOC100703795		DDE Tnp4 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	MLMMMIAGGIR	3.319999933	1255.399261	0	0	16.55341	0	8.50777	10.82393	0	14.62354	0	0	8.931034	17.73208	11.97073	0	17.06311	0	13.58086	12.32845	0	18.64365	12.737	13.76514	0	14.30412	14.87911	13.06938	0	11.3559	0	0	0	10.09127	0	12.48797	0	0	0	11.30661	12.1354	10.96323	0	0	16.96326	13.38423	12.50669	10.99596	0	11.10662	0	10.298	0	0	0	10.32837
A0A669CG85	A0A669CG85_ORENI			DDE_3 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AISMLSAGMSTR	7.909999847	1241.115963	0	0	14.74743	15.84208	13.23885	0	0	0	0	16.73649	15.91576	16.96167	16.19711	16.01248	0	15.95642	0	13.61085	13.86602	15.42868	15.30387	14.03949	16.46671	0	13.32369	9.887531	12.69918	15.121	13.98974	0	15.4965	17.37539	16.2403	0	0	0	15.19848	0	16.04549	14.01489	13.56453	11.62533	14.0334	13.35455	0	0	14.92296	13.86492	15.52193	13.68953	11.88572	13.47643	0	0
A0A669F6X9	A0A669F6X9_ORENI	LOC106098917		DDE_Tnp_1_7 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KDSSSSGPK	2.869999886	891.8989597	15.66245	0	13.61297	14.39213	13.1678	0	14.43982	15.61997	15.54367	0	0	0	14.05506	0	12.81069	0	16.67121	15.65341	15.56362	15.12836	15.53529	0	13.37795	15.91077	15.18201	14.72014	13.62738	13.59531	14.58984	0	0	15.22931	13.20843	0	15.30085	0	0	0	14.59165	15.24586	14.10292	14.61638	0	0	0	15.30417	15.43099	0	15.04667	15.76554	15.59791	0	0	15.38504
A0A669B4H9	A0A669B4H9_ORENI	ddhd1		DDHD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	LEPLIIK	13.65999985	825.1749491	16.16563	0	0	0	0	15.46178	9.697886	12.86554	15.22456	15.82834	13.42161	15.53076	0	15.14232	15.38204	0	0	14.37156	17.9562	0	0	15.30857	14.31864	0	0	10.68131	16.18774	15.29259	13.61122	0	0	0	18.55686	13.64677	0	13.15833	14.23998	12.67242	0	12.67362	12.30212	12.5882	0	12.2274	0	11.68715	14.11471	0	14.52488	0	0	8.793564	13.89665	0
A0A669F077	A0A669F077_ORENI			DEAH (Asp-Glu-Ala-His) box helicase 30	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; RNA helicase activity [GO:0003724]	ATP binding [GO:0005524]; RNA helicase activity [GO:0003724]	VTCMSCDPR	8.149999619	1125.474159	0	19.52577	0	0	0	0	0	16.43572	0	15.10081	0	13.29934	15.071	15.96745	14.53363	11.81571	0	0	19.15263	13.40859	15.42357	16.27223	15.82574	0	15.50362	20.30861	0	15.22205	16.66444	18.51278	18.40338	0	0	0	19.95838	0	18.97508	18.54552	0	18.64876	0	18.83688	0	0	20.11913	0	19.66142	19.37954	19.44539	19.19286	0	0	0	16.43999
I3J8D3	I3J8D3_ORENI			DEAH (Asp-Glu-Ala-His) box polypeptide 34	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; helicase activity [GO:0004386]	ATP binding [GO:0005524]; helicase activity [GO:0004386]	EPEEALK	5.659999847	815.9082432	15.94599	16.08415	16.73037	17.06657	15.48634	16.18911	15.01835	16.25307	15.36704	14.94657	15.69746	16.94373	17.05912	16.52656	16.70384	17.20012	0	16.61222	0	15.23395	14.41306	15.47566	14.38642	17.96476	0	17.24078	15.08572	0	15.94712	13.21318	17.64972	16.26458	15.8752	16.47013	15.89742	0	14.92927	0	16.37449	16.89314	17.41007	17.66708	0	15.80892	0	0	15.5702	17.1156	18.06522	0	15.92745	17.36581	17.47698	18.94323
A0A669BJL7	A0A669BJL7_ORENI	DENND3		DENN domain containing 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	EMWAGRK	12.43000031	878.3269606	15.44355	0	15.42636	13.73488	12.05575	12.837	14.63734	13.73485	12.56112	15.19198	0	11.84231	14.22206	15.81643	0	0	14.13039	0	14.31107	0	0	0	0	14.02043	0	13.41958	13.07431	16.05917	13.3187	15.08569	16.78165	0	14.41019	0	0	15.94121	14.38776	0	0	0	0	0	15.36938	16.32966	14.14803	15.04867	15.35553	13.52602	14.91087	14.14283	0	13.9871	18.19226	15.21912
A0A669F5M1	A0A669F5M1_ORENI			DENN/MADD domain containing 1A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasmic vesicle [GO:0031410]	cytoplasmic vesicle [GO:0031410]; guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	LLNILADYTVK	15.85000038	1262.66648	0	15.18489	0	14.71975	0	0	0	14.58292	0	0	0	15.06441	14.54426	13.26596	15.0956	0	0	15.70684	12.1646	0	15.48624	0	13.37366	15.09212	0	14.81392	15.39522	14.28059	0	0	0	0	14.12856	0	14.81808	14.0707	13.36281	0	10.17891	0	0	15.02303	14.27703	15.06829	0	14.43237	0	12.32578	13.55926	15.40814	0	13.79661	0	0
I3JS46	I3JS46_ORENI			DENN/MADD domain containing 2C	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	ILEEVER	1.919999957	885.3702019	16.1538	0	15.65005	15.58582	16.22823	15.93167	15.80723	16.11344	15.42747	15.34706	15.16119	17.04025	0	0	16.13359	16.82841	16.46305	17.5423	18.15588	0	16.90575	16.43508	15.81769	16.73112	17.53722	16.57378	15.55541	16.56427	0	15.99564	0	0	15.85119	17.02893	16.51475	0	0	17.27329	15.7174	0	0	15.63474	0	0	16.51952	0	17.74867	0	0	0	15.44041	0	18.2899	16.35897
I3IZE0	I3IZE0_ORENI			DENN/MADD domain containing 4B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	GSAPSSPAPRR	2.539999962	1082.085735	15.90073	0	12.81912	0	15.98042	0	15.85731	15.38766	14.93485	0	14.49006	14.11229	0	12.43921	0	0	0	0	15.76013	0	12.11884	15.14616	14.61273	12.55647	15.12014	15.69643	16.20265	17.10812	0	16.45519	15.06993	16.00864	13.72236	14.25854	16.47385	15.09733	15.9016	14.82511	13.72971	15.21743	13.13233	15.99925	15.15143	16.14083	16.51795	15.31238	0	16.93824	14.87933	15.22103	14.65166	17.45218	17.36119	0
A0A669EX06	A0A669EX06_ORENI			DENN/MADD domain containing 6B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	LGEVKMAGDLPK	11.23999977	1274.617819	0	0	0	0	0	0	0	14.35999	0	0	16.84843	15.37695	0	0	18.33803	19.30723	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.61033	0	0	17.40888	0	0	0	0	0	0	20.54086	20.53118	0	0	0	0	0	0	0	0
A0A669E5N5	A0A669E5N5_ORENI	depdc5	intracellular signal transduction [GO:0035556]	DEP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]; intracellular signal transduction [GO:0035556]	GTPase activator activity [GO:0005096]	TSKSYK	5.860000134	712.5882232	15.35295	13.59544	0	13.40831	14.8385	0	10.96258	15.67559	14.4145	0	14.60761	14.62099	0	0	0	14.17002	13.40494	13.83751	13.17134	0	10.00192	14.64613	13.24515	13.14752	9.870615	14.00887	13.32177	15.34775	14.66439	12.05854	0	12.68356	0	14.71587	17.44172	10.32086	13.00328	15.29814	9.237828	12.83186	0	13.35349	13.821	6.431844	14.33537	14.24398	0	15.25139	13.84406	15.38579	13.08135	15.01142	12.33933	14.71497
I3JBW1	I3JBW1_ORENI	ARHGEF17		DH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	AEQPLTTTTRNVSVSR	1.269999981	1760.038901	12.08531	0	11.77717	14.17171	0	13.6633	13.36532	10.92006	0	0	0	11.95225	15.45195	14.52878	15.29579	0	15.43144	13.45058	14.0496	13.80567	15.76351	14.46507	0	15.63616	0	14.65249	15.17698	0	16.10747	0	16.62022	0	15.62916	14.79948	0	15.35162	15.61073	15.82578	0	12.3122	0	17.68742	0	0	0	15.19602	16.36954	16.0758	16.68572	0	15.21257	17.96325	16.57392	15.65429
I3IZ22	I3IZ22_ORENI	prune1		DHHA2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; metal ion binding [GO:0046872]; pyrophosphatase activity [GO:0016462]	metal ion binding [GO:0046872]; pyrophosphatase activity [GO:0016462]	QAALSLDLLIFR	32.43999863	1357.852978	0	0	0	0	0	0	0	0	16.86004	0	15.50709	0	15.9885	17.08179	17.23676	0	16.36132	15.74998	16.23055	0	16.22385	0	0	16.48758	0	16.45022	0	15.87267	0	0	17.39264	18.40564	17.2963	0	0	16.41647	0	0	16.98722	0	0	17.46136	16.95509	16.61339	0	0	0	0	0	0	16.8268	0	16.20947	16.36064
Q6YHU7	Q6YHU7_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	DM-related transcriptional factor Dmrt2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; metal ion binding [GO:0046872]; sequence-specific DNA binding [GO:0043565]; regulation of transcription, DNA-templated [GO:0006355]"	metal ion binding [GO:0046872]; sequence-specific DNA binding [GO:0043565]	MCAGDQRK	4.239999771	964.856561	0	14.74539	0	13.70784	13.04482	0	14.91458	0	13.23228	12.53547	13.00852	14.63789	11.82737	0	0	0	0	14.13973	0	0	14.78772	0	16.15496	13.56768	13.94331	0	15.94916	13.72068	0	12.82257	15.5266	13.16592	0	0	0	13.14233	14.02506	13.93378	14.2933	14.68998	16.02383	13.0964	14.11356	17.39368	14.59404	13.67168	11.35492	13.21454	12.54908	14.70151	15.48162	14.36852	14.33895	14.51976
A0A669D5Z9	A0A669D5Z9_ORENI	DIP2C		DMAP_binding domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VACVKSR	9.840000153	817.4188902	15.05595	16.76275	14.68176	14.99074	16.17449	14.14662	14.69668	15.34306	14.8358	13.68927	0	0	0	13.53454	0	13.83367	17.51658	0	0	16.75517	0	0	17.15916	0	0	15.94383	0	0	0	0	0	0	16.47004	0	15.55572	0	15.20465	0	0	0	0	0	0	0	0	0	17.08227	0	0	0	0	0	0	0
A0A669B8Y9	A0A669B8Y9_ORENI	dnmt1		DNA (cytosine-5)-methyltransferase (EC 2.1.1.37)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; chromatin binding [GO:0003682]; DNA (cytosine-5-)-methyltransferase activity [GO:0003886]; DNA binding [GO:0003677]; zinc ion binding [GO:0008270]	chromatin binding [GO:0003682]; DNA (cytosine-5-)-methyltransferase activity [GO:0003886]; DNA binding [GO:0003677]; zinc ion binding [GO:0008270]	ILLLIPEK	15.96000004	938.0629506	13.48628	14.68567	0	16.19506	0	0	16.47465	15.9255	0	0	17.90982	0	16.28809	0	0	0	16.08528	0	0	16.09489	0	17.27602	0	0	0	14.18816	17.4965	15.50744	16.80717	15.03633	10.06676	21.6682	19.34224	15.18514	15.6904	13.70618	16.63554	0	0	15.44274	0	13.53843	14.79061	15.34347	15.51633	16.12659	15.38908	13.85871	0	0	0	0	17.28314	0
A0A669CXY3	A0A669CXY3_ORENI	LOC100710512	regulation of gene expression [GO:0010468]	DNA (cytosine-5-)-methyltransferase (EC 2.1.1.37)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA (cytosine-5-)-methyltransferase activity [GO:0003886]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; regulation of gene expression [GO:0010468]	DNA (cytosine-5-)-methyltransferase activity [GO:0003886]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]	KAGVIR	3.609999895	642.4173945	0	0	0	0	0	0	0	0	0	15.41845	0	15.20605	12.02128	12.99913	0	0	13.13996	0	0	15.06796	0	0	13.86678	16.03189	15.10239	14.8309	14.14066	0	0	14.30632	0	20.12328	0	0	0	0	0	0	0	0	0	0	15.76455	14.74692	0	0	0	0	0	0	0	0	14.86294	14.72307
I3JAQ1	I3JAQ1_ORENI	rbbp8	cell division [GO:0051301]; DNA repair [GO:0006281]; meiotic cell cycle [GO:0051321]	DNA endonuclease RBBP8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; endonuclease activity [GO:0004519]; cell division [GO:0051301]; DNA repair [GO:0006281]; meiotic cell cycle [GO:0051321]	DNA binding [GO:0003677]; endonuclease activity [GO:0004519]	NLLEDENDKLR	31.13999939	1357.66956	0	0	0	0	0	18.25172	17.87927	0	0	0	0	0	18.5827	17.05717	0	0	18.14143	0	0	0	0	0	0	0	18.11706	0	0	0	18.19341	0	0	0	0	0	0	18.50396	0	0	0	0	18.43369	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669D616	A0A669D616_ORENI	LOC100705962		DNA helicase (EC 3.6.4.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; metal ion binding [GO:0046872]; nucleosome-dependent ATPase activity [GO:0070615]	ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; metal ion binding [GO:0046872]; nucleosome-dependent ATPase activity [GO:0070615]	FSDDGR	3.730000019	696.1785346	14.3567	14.36288	13.43979	14.32695	13.63774	14.32914	15.73454	13.08082	14.3608	0	0	14.30356	14.15595	16.0503	0	0	14.58128	14.37018	12.30425	12.57688	14.37795	14.25702	13.27093	16.52794	15.36499	13.55493	14.00947	0	13.30078	14.63338	15.83319	17.1513	0	15.00957	14.43457	15.52044	15.21934	14.52808	15.68325	0	15.11909	14.6551	0	14.65553	0	14.62657	14.36584	15.07432	0	15.81692	14.64274	0	14.61883	14.05612
A0A669BAN8	A0A669BAN8_ORENI	lig3	DNA biosynthetic process [GO:0071897]; DNA recombination [GO:0006310]; DNA repair [GO:0006281]; DNA replication [GO:0006260]	DNA ligase (EC 6.5.1.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA ligase (ATP) activity [GO:0003910]; zinc ion binding [GO:0008270]; DNA biosynthetic process [GO:0071897]; DNA recombination [GO:0006310]; DNA repair [GO:0006281]; DNA replication [GO:0006260]	ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA ligase (ATP) activity [GO:0003910]; zinc ion binding [GO:0008270]	GAPPKK	3.950000048	597.3406322	16.16624	14.43543	11.3353	14.55213	0	0	16.50834	16.50269	15.32809	0	15.10727	17.48054	18.27703	17.66764	17.11916	16.78376	15.78173	11.24381	15.16019	14.94341	14.4322	15.81817	13.66516	14.61308	16.67479	16.3242	13.69704	17.22302	0	17.06166	0	18.18597	18.52413	15.34815	15.99979	0	0	0	0	15.82612	0	12.92237	0	17.95935	17.21606	11.78582	19.66744	15.6677	17.19895	13.85296	17.2203	16.25317	14.91632	14.81432
A0A669F120	A0A669F120_ORENI	LOC100705722	DNA repair [GO:0006281]; protein-chromophore linkage [GO:0018298]	DNA photolyase (EC 4.1.99.3) (Deoxyribodipyrimidine photo-lyase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		deoxyribodipyrimidine photo-lyase activity [GO:0003904]; DNA binding [GO:0003677]; DNA repair [GO:0006281]; protein-chromophore linkage [GO:0018298]	deoxyribodipyrimidine photo-lyase activity [GO:0003904]; DNA binding [GO:0003677]	FLSDNEKIK	5.46999979	1090.412842	21.68381	19.44291	18.807	17.35481	17.70031	0	0	19.19179	18.77735	21.44106	16.75375	19.89817	0	19.6606	0	18.05292	0	0	19.27221	20.73625	0	20.98602	21.07831	0	0	0	0	0	0	19.74143	0	0	0	20.40781	0	0	0	0	18.97389	0	0	0	20.39033	0	0	0	0	0	0	0	0	0	0	0
I3KTE5	I3KTE5_ORENI		DNA replication [GO:0006260]	DNA polymerase (EC 2.7.7.7)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; 4 iron, 4 sulfur cluster binding [GO:0051539]; DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]; DNA replication [GO:0006260]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]"	GAAAYMK	1.25999999	728.2190435	0	0	16.02429	14.88546	14.88403	13.84749	14.28452	13.77945	13.66545	0	14.85085	0	13.96081	13.13412	13.16576	0	0	0	0	13.63682	13.0698	0	0	0	0	15.47814	13.44134	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18.25331	14.40811	0	0	0	16.31936	16.55527	0	14.25951
A0A669DF86	A0A669DF86_ORENI	pola2	DNA replication [GO:0006260]	DNA polymerase alpha subunit B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA replication [GO:0006260]	DNA binding [GO:0003677]	EEASSRMR	1.419999957	962.0879597	0	14.00902	0	14.21794	14.87812	14.93125	13.95516	15.57625	14.09082	0	14.3356	14.73048	14.61641	12.51307	0	14.02573	13.07407	15.01422	12.05611	14.89435	12.54406	14.23986	13.8425	13.10895	17.09302	14.3877	14.47548	16.1465	15.39779	12.33365	0	0	15.4719	0	0	15.06703	14.42887	12.86773	14.77965	13.38393	13.34225	13.43871	0	13.72032	14.10735	0	0	14.02715	15.39171	13.10314	0	13.15814	16.67108	15.90565
I3KCU2	I3KCU2_ORENI	pold3	DNA replication [GO:0006260]	DNA polymerase delta subunit 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	delta DNA polymerase complex [GO:0043625]	delta DNA polymerase complex [GO:0043625]; DNA replication [GO:0006260]		SKPVAKVNPVANFFGTQTSK	5.909999847	2121.280637	11.28302	13.95716	13.25866	18.00749	11.31576	13.75676	11.59895	12.18305	0	0	11.71174	0	13.50629	12.02497	10.10434	10.84791	5.797503	0	13.16306	12.04949	12.25946	0	0	17.32262	0	12.94276	0	11.37021	0	0	0	14.74416	13.28304	11.38655	10.00009	11.61111	0	12.32034	15.03981	10.05416	0	9.416886	0	10.17055	13.71792	12.76973	15.98039	10.71671	12.42502	11.78333	12.21726	0	0	14.24199
A0A669BHH7	A0A669BHH7_ORENI	pole	DNA repair [GO:0006281]; DNA replication [GO:0006260]	DNA polymerase epsilon catalytic subunit (EC 2.7.7.7)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	epsilon DNA polymerase complex [GO:0008622]; integral component of membrane [GO:0016021]	"epsilon DNA polymerase complex [GO:0008622]; integral component of membrane [GO:0016021]; 4 iron, 4 sulfur cluster binding [GO:0051539]; DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; nucleotide binding [GO:0000166]; zinc ion binding [GO:0008270]; DNA repair [GO:0006281]; DNA replication [GO:0006260]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; nucleotide binding [GO:0000166]; zinc ion binding [GO:0008270]"	AKLGYDPVELDPEEMCR	3.789999962	2037.218055	12.39221	0	12.6022	13.0568	13.61985	12.8414	9.992771	0	12.89216	11.74916	12.97559	14.64626	0	15.47948	14.27038	11.91874	0	12.72258	14.25578	13.87065	0	14.17673	0	13.57428	0	0	0	0	11.52169	0	17.31615	15.22528	0	0	0	14.8746	0	0	0	0	13.12874	11.72075	0	0	0	0	0	0	13.74849	0	14.75068	0	0	0
I3JZM5	I3JZM5_ORENI	rev3l	translesion synthesis [GO:0019985]	DNA polymerase zeta catalytic subunit (EC 2.7.7.7)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	zeta DNA polymerase complex [GO:0016035]	"zeta DNA polymerase complex [GO:0016035]; 4 iron, 4 sulfur cluster binding [GO:0051539]; DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]; translesion synthesis [GO:0019985]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]"	SAEEPK	9.350000381	659.911125	0	16.67352	17.96159	13.5113	0	0	15.25128	16.17876	16.19882	0	0	16.82101	17.02539	15.28256	0	0	17.79075	16.94188	16.97778	0	15.7331	0	17.71159	16.58143	15.74347	0	0	17.12582	0	17.10597	16.66897	0	0	19.51334	15.31892	18.14249	0	0	14.63094	0	15.9957	17.48309	18.31588	17.04522	0	16.14518	16.23513	0	16.39415	16.13715	16.47702	18.40628	0	16.79711
I3K9J7	I3K9J7_ORENI	rev1	error-prone translesion synthesis [GO:0042276]	DNA repair protein REV1 (EC 2.7.7.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; damaged DNA binding [GO:0003684]; nucleotidyltransferase activity [GO:0016779]; error-prone translesion synthesis [GO:0042276]	damaged DNA binding [GO:0003684]; nucleotidyltransferase activity [GO:0016779]	ANGGYMAAKVSK	10.77000046	1212.899074	0	0	10.07883	13.34833	12.29757	14.62664	0	0	10.09307	11.81948	12.7881	14.31028	12.16405	17.17515	18.83292	10.41113	12.71935	14.50631	9.980544	15.28773	8.929775	0	13.8641	0	11.17378	0	19.05713	15.97128	8.019006	12.14248	14.92248	0	0	0	0	13.63158	13.96084	9.667705	13.63066	11.35023	0	12.37278	0	0	0	12.1863	12.10099	0	14.61551	11.34845	14.02291	0	0	0
I3KK41	I3KK41_ORENI	dna2	"DNA repair [GO:0006281]; DNA replication, Okazaki fragment processing [GO:0033567]"	DNA replication ATP-dependent helicase/nuclease (EC 3.1.-.-) (EC 3.6.4.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]; nucleus [GO:0005634]	"mitochondrion [GO:0005739]; nucleus [GO:0005634]; 4 iron, 4 sulfur cluster binding [GO:0051539]; 5'-flap endonuclease activity [GO:0017108]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; single-stranded DNA helicase activity [GO:0017116]; DNA repair [GO:0006281]; DNA replication, Okazaki fragment processing [GO:0033567]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; 5'-flap endonuclease activity [GO:0017108]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; single-stranded DNA helicase activity [GO:0017116]"	GLNKPQKQAMK	3.220000029	1259.575929	12.53362	12.00627	0	12.35152	13.39284	0	0	9.314184	0	11.55825	11.81762	12.94157	11.85652	11.23827	0	0	12.93979	7.761595	0	0	11.14476	0	13.51528	12.45439	0	0	13.82303	0	15.07982	0	0	0	15.93434	0	14.02882	13.41461	13.96846	14.52668	0	12.21974	0	0	0	9.838144	9.695366	11.13929	10.57621	13.01713	0	0	11.38717	0	14.95357	0
A0A669DI54	A0A669DI54_ORENI	MCM7	cell cycle [GO:0007049]; DNA replication initiation [GO:0006270]	DNA replication licensing factor MCM7 (EC 3.6.4.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	MCM complex [GO:0042555]; nucleus [GO:0005634]	MCM complex [GO:0042555]; nucleus [GO:0005634]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; cell cycle [GO:0007049]; DNA replication initiation [GO:0006270]	ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]	DPADTR	21.80999947	674.5479928	15.84676	16.64138	0	17.81474	0	0	0	18.25326	17.22594	0	0	19.54976	18.84472	17.21833	16.81282	16.72433	14.99811	15.82552	0	0	0	0	0	0	0	17.81	17.49363	17.31476	0	16.57914	0	0	15.8081	19.13299	19.2905	0	15.82198	0	16.18169	16.37955	18.07941	0	17.80924	19.95916	15.43782	17.61128	17.5729	19.48723	0	0	0	0	17.36694	0
A0A669CV47	A0A669CV47_ORENI	top2a	DNA topological change [GO:0006265]	DNA topoisomerase 2 (EC 5.6.2.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity [GO:0003918]; metal ion binding [GO:0046872]; DNA topological change [GO:0006265]"	"ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity [GO:0003918]; metal ion binding [GO:0046872]"	MTELNTLKK	2.720000029	1094.021954	13.09152	14.01849	12.30178	16.16884	14.72329	13.10187	14.22755	12.70744	0	0	16.91211	13.33621	0	14.88125	0	12.38867	19.00787	0	13.97334	13.09464	0	0	13.99815	0	0	15.75767	0	12.32985	11.88229	14.14217	0	0	10.89878	0	0	0	0	0	0	0	12.53082	14.15055	12.59018	14.18146	0	0	13.2195	0	0	15.50267	0	0	12.0311	13.32457
A0A669DC88	A0A669DC88_ORENI	top3a	DNA topological change [GO:0006265]	DNA topoisomerase (EC 5.6.2.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]	"chromosome [GO:0005694]; DNA binding [GO:0003677]; DNA topoisomerase type I (single strand cut, ATP-independent) activity [GO:0003917]; zinc ion binding [GO:0008270]; DNA topological change [GO:0006265]"	"DNA binding [GO:0003677]; DNA topoisomerase type I (single strand cut, ATP-independent) activity [GO:0003917]; zinc ion binding [GO:0008270]"	MYVGLTADQR	10.39000034	1170.596302	13.54756	13.21433	11.80918	11.88883	14.13302	12.79277	11.89245	13.16181	13.59773	15.5817	0	18.80458	13.91062	12.32798	11.57668	0	0	16.95376	0	0	0	14.66364	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.05091	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669ECA2	A0A669ECA2_ORENI	neil3	base-excision repair [GO:0006284]	DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]	chromosome [GO:0005694]; class I DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0140078]; damaged DNA binding [GO:0003684]; DNA N-glycosylase activity [GO:0019104]; zinc ion binding [GO:0008270]; base-excision repair [GO:0006284]	class I DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0140078]; damaged DNA binding [GO:0003684]; DNA N-glycosylase activity [GO:0019104]; zinc ion binding [GO:0008270]	KASHAENR	3.039999962	911.1238472	0	0	0	13.94291	0	0	15.68244	0	0	0	0	0	0	0	0	0	0	0	18.10165	0	0	0	15.12072	0	14.73953	16.2218	14.84502	0	19.47661	0	0	0	17.68927	14.97592	0	11.00223	0	0	0	15.13746	0	0	0	0	0	0	0	0	15.96477	0	0	0	0	0
A0A669F875	A0A669F875_ORENI	polm	DNA repair [GO:0006281]	DNA-directed DNA/RNA polymerase mu (EC 2.7.7.7)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; metal ion binding [GO:0046872]; DNA repair [GO:0006281]	DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; metal ion binding [GO:0046872]	RFFLSQLGR	3.769999981	1123.842515	15.43835	0	14.23606	14.75082	15.13823	10.67426	13.13249	12.28472	12.85309	0	0	12.24563	14.60524	14.24208	15.01559	13.80067	0	15.08355	0	13.05386	13.63132	13.71552	13.30772	0	14.18481	13.56217	12.31839	0	13.47281	13.50354	16.33246	15.87583	15.12732	15.14858	14.68005	13.98114	15.97839	13.62909	13.83616	0	12.57826	13.42739	13.40228	15.00641	14.29083	14.7682	11.96137	12.11921	13.79521	13.27456	15.53018	15.14202	14.17415	0
I3JIG0	I3JIG0_ORENI		retina development in camera-type eye [GO:0060041]; transcription by RNA polymerase III [GO:0006383]	DNA-directed RNA polymerase III subunit RPC6 (RNA polymerase III subunit C6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	RNA polymerase III complex [GO:0005666]	RNA polymerase III complex [GO:0005666]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; retina development in camera-type eye [GO:0060041]; transcription by RNA polymerase III [GO:0006383]	DNA-directed 5'-3' RNA polymerase activity [GO:0003899]	GVNAIIQPTGLVK	6.190000057	1311.029821	15.26894	14.61706	14.4771	0	14.82181	14.15813	0	13.73174	14.43912	13.10472	12.58385	14.32673	0	12.46928	14.73961	0	0	0	15.46297	0	0	0	0	0	14.82581	13.63309	0	0	0	0	12.02369	0	14.90928	14.63887	0	0	0	0	0	0	15.26193	0	16.14797	0	14.6562	0	15.68191	15.54533	0	0	13.7515	16.69473	15.24671	0
A0A669E3G8	A0A669E3G8_ORENI	polr2b	"transcription, DNA-templated [GO:0006351]"	DNA-directed RNA polymerase (EC 2.7.7.6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; ribonucleoside binding [GO:0032549]; transcription, DNA-templated [GO:0006351]"	DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; ribonucleoside binding [GO:0032549]	MDTLAHVLYYPQKPLVTTR	5.380000114	2263.305121	0	13.62722	11.76777	15.07222	0	11.45343	0	0	0	0	0	11.87571	11.47996	16.57155	12.16568	0	0	10.87599	13.91033	0	0	18.43256	13.14399	11.09468	12.02693	18.26967	11.38316	11.96423	12.66231	10.51051	12.14342	0	10.98965	11.37667	11.16349	0	13.79055	14.60269	12.96828	0	0	0	0	11.83661	13.3051	0	0	12.36302	14.19579	0	18.11194	0	0	13.3972
I3KFX5	I3KFX5_ORENI		"transcription, DNA-templated [GO:0006351]"	DNA-directed RNA polymerase subunit (EC 2.7.7.6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; zinc ion binding [GO:0008270]; transcription, DNA-templated [GO:0006351]"	DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; zinc ion binding [GO:0008270]	VYMTASTAR	9.359999657	1016.29427	12.74027	15.97231	13.16246	10.36864	12.64053	13.92511	11.06599	0	0	14.67276	13.43547	13.04677	12.34827	13.20373	11.69417	12.32352	0	13.26549	0	12.02685	13.59455	14.56368	0	13.30954	15.05811	17.13245	13.87622	0	13.20444	15.73623	13.28701	13.82934	13.63226	0	0	0	0	13.34944	11.14724	12.04063	0	0	0	14.16849	0	0	11.92919	13.74256	0	0	13.38126	0	0	0
A0A669DSC1	A0A669DSC1_ORENI	polr1b	"transcription, DNA-templated [GO:0006351]"	DNA-directed RNA polymerase subunit beta (EC 2.7.7.6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; ribonucleoside binding [GO:0032549]; transcription, DNA-templated [GO:0006351]"	DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; ribonucleoside binding [GO:0032549]	NLTDGSFGHMK	4.940000057	1221.420874	11.83944	10.26214	12.66309	0	13.33262	0	14.47086	13.83032	12.53519	0	0	0	14.16966	13.6214	13.35334	0	12.05933	12.85509	12.51134	13.09805	9.926492	0	0	18.57166	13.92472	0	0	12.57791	13.19376	11.74402	13.79009	14.13568	13.84385	11.05799	0	0	0	12.62924	15.36191	0	11.1934	8.817132	0	12.30073	0	10.89665	11.55177	8.181947	13.29328	0	12.5853	0	11.47449	10.2677
A0A669E6K7	A0A669E6K7_ORENI			DNA-directed RNA polymerases I and III subunit RPAC1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; protein dimerization activity [GO:0046983]; RNA polymerase I activity [GO:0001054]; RNA polymerase III activity [GO:0001056]	DNA binding [GO:0003677]; protein dimerization activity [GO:0046983]; RNA polymerase I activity [GO:0001054]; RNA polymerase III activity [GO:0001056]	VLMAKCQR	9.520000458	1004.9213	14.70243	15.16046	15.60742	14.49544	14.59793	14.55362	14.64888	14.351	15.6687	0	15.59513	15.03308	0	16.24994	15.945	0	15.4383	0	0	15.96047	15.19879	16.11914	16.71778	15.22658	0	16.92816	15.36198	0	0	14.46442	17.33748	0	0	15.72084	0	0	14.74904	0	0	0	0	0	0	15.69686	0	0	14.09629	0	14.42693	0	0	0	0	0
I3ITZ7	I3ITZ7_ORENI		Golgi to endosome transport [GO:0006895]; protein transport [GO:0015031]	DOP1 leucine zipper like protein A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]	cytosol [GO:0005829]; Golgi to endosome transport [GO:0006895]; protein transport [GO:0015031]		ALHALSAIAAMLR	8.720000267	1353.448497	11.07342	0	11.6409	15.77104	0	5.701794	12.4214	0	0	12.06665	14.14389	14.93968	0	0	0	0	0	13.20358	0	0	13.84096	0	0	0	0	15.98906	0	0	0	14.49368	16.34716	0	16.15765	15.79425	12.96112	0	0	15.09174	12.09889	0	18.88179	0	0	12.76009	0	15.04049	16.05851	0	0	0	0	0	0	0
I3IZ93	I3IZ93_ORENI			DR1-associated protein 1 (negative cofactor 2 alpha)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein heterodimerization activity [GO:0046982]	protein heterodimerization activity [GO:0046982]	KPGSGR	3.799999952	601.7393639	13.92398	13.56124	14.04923	13.78468	0	13.55144	14.40436	0	12.58124	13.85144	0	0	12.17367	13.22735	11.46809	14.61724	0	13.26933	14.99514	0	10.31491	15.43569	14.87606	19.72047	13.23309	13.79884	8.653414	13.35944	0	15.53103	0	18.12184	0	0	0	15.55188	0	0	0	15.37097	0	13.71849	15.1398	15.85935	0	0	15.38506	13.81558	14.91023	14.68349	13.65684	0	0	0
A0A669EP70	A0A669EP70_ORENI	supt5h	"regulation of DNA-templated transcription, elongation [GO:0032784]; regulation of transcription by RNA polymerase II [GO:0006357]"	DRB sensitivity-inducing factor large subunit (transcription Elongation factor SPT5)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; regulation of DNA-templated transcription, elongation [GO:0032784]; regulation of transcription by RNA polymerase II [GO:0006357]"		ATAIALMR	8.470000267	861.6158418	14.19222	13.46483	16.12554	12.41785	9.049554	11.92226	13.9895	11.4113	0	14.86441	15.48141	16.22953	0	13.60237	13.02275	0	11.87212	14.95993	12.56211	12.60857	13.6421	14.127	13.93225	14.60017	14.35255	0	13.09175	13.00108	13.7736	14.95939	16.091	12.2091	14.17138	0	13.18851	12.49929	13.18524	0	13.68796	0	12.43597	13.26633	14.40139	14.91534	0	14.46601	0	12.52277	0	0	13.22621	13.23584	0	0
A0A669DFF2	A0A669DFF2_ORENI	dus2		DRBM domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		flavin adenine dinucleotide binding [GO:0050660]; tRNA binding [GO:0000049]; tRNA dihydrouridine synthase activity [GO:0017150]	flavin adenine dinucleotide binding [GO:0050660]; tRNA binding [GO:0000049]; tRNA dihydrouridine synthase activity [GO:0017150]	APHLPGGGVLCL	2.779999971	1191.513629	12.33183	16.62037	6.62061	0	0	9.775124	10.22844	7.692437	12.06311	10.2281	14.80337	12.00498	13.24039	10.79728	14.1683	12.97043	0	12.16346	0	13.29282	0	12.84237	0	12.37725	13.70982	0	0	13.78672	0	0	0	0	0	0	0	0	4.978588	13.27269	12.61141	0	0	0	15.19966	0	0	12.62373	12.53238	0	13.78869	0	14.35653	0	0	11.047
I3J9G9	I3J9G9_ORENI	DSCAML1	cell adhesion [GO:0007155]; central nervous system development [GO:0007417]	DS cell adhesion molecule like 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; cell adhesion [GO:0007155]; central nervous system development [GO:0007417]		KGHTAQDFSIILLEDGTPR	3.069999933	2098.608334	0	0	13.13488	0	13.84923	0	0	0	9.106862	13.00203	15.74541	0	15.77047	0	15.04078	15.62372	0	15.74175	15.34182	12.90348	0	0	0	13.89984	0	0	13.47619	12.67108	13.30386	11.63491	0	16.28697	0	14.14074	0	0	14.08701	11.93988	0	0	0	0	0	14.09159	0	0	15.81709	14.50338	0	0	11.92512	0	0	0
A0A669DLJ2	A0A669DLJ2_ORENI	fam210a		DUF1279 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				IATPAR	6.28000021	627.0807656	0	15.53813	16.12248	0	0	0	0	0	16.68321	17.23207	14.76025	0	16.17199	15.78611	0	0	17.5137	17.45768	0	15.44296	17.55444	15.46572	15.72806	15.41178	14.61475	15.44658	0	17.00561	17.51441	0	17.22713	18.13508	0	15.93322	17.40564	17.65491	15.26579	14.50697	14.90333	15.75308	16.1863	0	0	16.7472	16.37958	15.55466	0	0	15.22292	0	0	0	16.8047	0
I3K0G1	I3K0G1_ORENI	tctn1	cell projection organization [GO:0030030]	DUF1619 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cell projection organization [GO:0030030]		ETNYDIFCIESQNR	9.729999542	1788.546894	12.35685	0	14.33895	13.92766	14.25696	13.92253	13.83156	14.1113	0	18.44329	15.84654	0	0	0	14.65508	0	14.52013	12.36124	0	14.8871	0	11.94001	14.64665	0	0	0	0	0	13.42263	12.53334	14.2287	14.01537	12.51406	0	11.46811	0	0	0	0	0	15.29374	13.87675	0	0	12.50299	0	14.08187	12.05615	0	0	0	15.59032	0	0
I3JRU4	I3JRU4_ORENI	ctnnbl1		DUF1716 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		MDVGELLNYQPDR	15.68999958	1548.926938	15.26759	0	0	0	15.52302	14.68648	0	13.49628	14.35758	0	14.69146	0	14.93211	0	14.91586	12.44585	14.37587	14.31345	11.49319	0	13.31386	15.18241	16.14582	15.90818	0	0	0	12.18507	11.77018	11.13829	15.49528	16.90768	15.18761	14.8624	13.38585	14.57812	11.47059	14.44063	14.44967	14.23535	0	14.48065	0	14.38733	12.94246	0	0	14.79043	8.561797	14.7897	14.67139	14.35626	14.39996	13.38652
A0A669F536	A0A669F536_ORENI	thada		DUF2428 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				HPCSDR	4.710000038	770.8804611	13.34466	13.61381	16.03564	13.90492	9.984935	14.38146	14.04467	13.84101	13.01998	0	15.79115	14.72356	10.95452	15.16701	13.45769	14.81746	15.66859	13.66968	14.52757	14.15269	15.18465	14.09451	0	12.49133	13.06201	11.62302	14.45074	9.982068	12.977	12.9812	16.51214	17.65368	18.13046	14.0165	12.87028	14.18548	13.49406	14.75153	13.3229	14.32183	11.33326	15.25454	16.037	14.87668	15.8451	13.87693	13.46877	15.93976	15.26933	13.10904	16.25996	15.32908	15.63674	14.14311
I3J4D4	I3J4D4_ORENI	kiaa1841		DUF3342 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DNTPFTVSVQK	4.440000057	1235.279814	13.63087	15.34589	11.41978	14.53506	14.66197	9.78823	16.02878	11.5783	18.9588	14.29926	17.79474	19.28618	11.75762	11.95146	11.65747	0	13.41601	10.08965	9.947002	6.356345	10.50463	13.15461	0	14.11796	19.62656	11.64011	18.37055	0	14.13486	0	14.11562	14.66381	13.45808	18.43964	0	12.77957	0	14.17698	0	0	13.41601	19.78984	14.23496	0	15.02963	4.587792	0	0	14.43494	0	15.11386	12.9425	18.42791	17.29204
I3J995	I3J995_ORENI	tasor		DUF3715 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				APMLGPLNALGGIR	5.130000114	1396.664087	11.60782	0	8.350424	14.02989	0	0	10.637	0	0	0	11.02575	9.275632	0	0	0	0	14.76126	0	9.479328	14.56426	0	0	9.131097	15.65948	0	10.90925	12.56613	9.4475	0	12.80167	0	0	0	0	0	0	10.44444	0	0	0	0	0	0	0	0	0	0	11.72768	0	0	0	9.821785	0	0
A0A669EXZ5	A0A669EXZ5_ORENI	focad		DUF3730 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VMLPIQGGSR	4.28000021	1069.802012	13.78107	14.37008	13.11387	11.00139	13.89159	10.82948	12.91248	10.27795	13.29104	12.78175	14.19299	0	12.98101	10.33546	13.57913	11.90602	14.41877	12.29457	11.93586	16.18427	12.97679	15.31947	0	0	12.92165	0	12.97674	0	0	0	18.47196	13.14256	0	9.517011	0	8.586533	14.10508	0	0	15.79566	0	13.3482	17.73705	15.73813	0	0	12.78536	0	0	0	15.39429	11.19513	0	14.81182
A0A669D9Y5	A0A669D9Y5_ORENI			DUF4174 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				INKDYFSMVVVGK	5.300000191	1514.872794	9.888014	12.82165	0	14.91161	0	13.84881	0	15.22072	0	12.3304	0	0	14.53293	15.18598	14.01402	15.03999	14.64916	0	12.22988	13.0257	0	14.1087	13.59276	0	17.51554	12.22017	0	12.06404	11.62537	0	0	16.10486	15.28404	15.19035	12.06053	11.76	0	9.669037	12.97772	14.53666	13.1591	13.94489	14.91294	13.27223	13.71793	14.47292	0	15.01378	8.367199	14.5331	14.75508	13.52242	12.62717	13.05708
A0A669BA13	A0A669BA13_ORENI	fam214a		DUF4210 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SQTGYFDLDTSVAGCK	7.340000153	1747.472567	17.54285	17.60066	0	18.23472	0	0	0	17.77087	0	0	0	0	0	0	16.87393	18.28269	0	0	0	0	0	0	20.50342	0	18.2239	17.23658	17.49004	19.73159	0	0	19.24748	0	0	17.57829	15.99779	0	17.39643	0	0	19.54041	0	0	16.99706	0	0	17.57796	0	0	18.29662	20.05623	19.05542	0	0	0
I3K1Q2	I3K1Q2_ORENI		regulation of neuronal synaptic plasticity [GO:0048168]; regulation of neuron migration [GO:2001222]	DUF4347 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		regulation of neuron migration [GO:2001222]; regulation of neuronal synaptic plasticity [GO:0048168]		EGGMTLGGR	9.770000458	876.9036871	14.43327	14.53135	14.61221	14.15506	14.82502	15.83471	14.39429	13.22983	13.73379	14.78417	14.07309	15.65294	15.92586	13.78009	14.67118	13.70109	0	14.37188	14.99612	14.17937	13.87576	0	15.22018	15.85811	14.82442	0	15.01588	16.08097	0	15.43667	15.1181	0	0	16.52382	13.63051	14.81127	0	0	14.82274	15.37682	14.83121	14.46676	15.30228	16.56643	14.77947	13.57703	14.62821	14.4541	16.13855	14.99395	14.99834	15.1271	0	14.93484
A0A669D3U4	A0A669D3U4_ORENI	LOC109200235		DUF4371 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LDTFMNTHGLMWDR	21.15999985	1750.00412	21.80473	19.48423	19.30285	0	22.61878	19.17811	19.23306	0	14.02679	21.30542	21.42137	21.83772	20.7745	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21.5859	20.52498	20.1822	20.71768	0	20.22829	0	19.20637	17.91821	19.386	19.23642	21.29403	0	21.55107	21.08227	19.75408	0	19.65494	0	19.57002	15.3822	0	0	15.09609	0
I3K6P5	I3K6P5_ORENI	LOC100705440	cobalamin transport [GO:0015889]; cobalt ion transport [GO:0006824]	DUF4430 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; cobalamin binding [GO:0031419]; cobalamin transport [GO:0015889]; cobalt ion transport [GO:0006824]	cobalamin binding [GO:0031419]	SNTYHNPMAISQTLPALQQTSYVAVKSK	4.679999828	3078.643775	0	10.46326	13.19063	0	13.4485	14.49665	0	0	11.99571	6.985795	8.587402	13.55071	13.02879	0	0	0	0	11.73465	13.05321	9.75541	0	0	0	11.10159	13.81633	14.87556	0	9.339484	11.72166	0	0	14.55883	0	10.55436	13.14743	13.18343	0	15.67082	0	11.84198	14.14869	12.7435	12.12477	11.06422	0	0	0	11.74936	13.08055	0	0	0	14.23128	14.20655
I3KVQ7	I3KVQ7_ORENI	ccdc78	skeletal muscle fiber development [GO:0048741]	DUF4472 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		skeletal muscle fiber development [GO:0048741]		MSHDTVKPEEQAEMDKEQK	2.799999952	2275.424296	11.74994	12.6197	10.89701	0	12.46154	0	0	8.22908	12.22001	13.13652	12.27699	12.79892	16.1835	12.87745	12.58512	13.96965	10.19368	0	13.97118	0	9.158587	15.47573	12.47961	15.13925	17.95865	0	0	13.23844	12.68272	12.72233	15.56975	16.33884	16.57461	0	0	13.01925	0	12.69841	12.90753	0	5.21166	12.77314	7.4629	11.09812	0	15.59412	13.77796	12.59224	15.62574	0	14.09858	13.97007	0	12.70808
A0A669EXW6	A0A669EXW6_ORENI			DUF4537 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EGDGLYYMGTVIK	4.610000134	1462.505792	14.46714	11.67855	11.91946	14.10339	15.48331	14.75959	15.51649	15.13947	14.30022	15.36383	14.74316	14.7753	15.05391	16.51182	9.25164	14.4814	14.41995	15.06435	15.75726	11.67128	0	13.79825	0	0	15.69839	15.19126	0	15.58288	15.89582	15.84035	14.9809	16.90114	15.313	0	16.57668	0	15.37815	12.07926	0	0	15.86587	13.13456	17.01538	17.84134	13.79283	14.69355	16.28506	16.76061	16.26673	0	15.74642	15.58768	15.84749	13.41963
A0A669CA42	A0A669CA42_ORENI	LOC102082717		DUF4585 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EALPSMASER	4.800000191	1106.487438	0	0	11.92412	0	0	0	12.96812	0	13.76688	13.70286	15.72939	14.11396	0	0	0	0	0	0	16.2793	14.31082	13.17654	15.34458	0	9.796498	12.91463	0	0	0	0	13.98035	0	15.38775	19.74924	15.85376	14.20036	0	15.21342	0	14.0693	0	0	0	13.86444	12.20971	0	0	0	0	0	0	0	0	0	0
I3KFJ9	I3KFJ9_ORENI	LOC100707562		DUF4592 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QMEEGPSEAAK	10.86999989	1189.56161	12.08862	12.31186	0	0	0	0	0	10.26641	15.64353	12.92384	12.7672	0	0	0	14.1683	0	14.33287	7.905688	11.01104	0	0	13.25987	0	16.3542	0	16.25283	0	0	11.71421	8.507919	16.71278	14.02752	12.37787	0	0	13.19927	0	14.03767	12.86508	11.91036	5.099687	10.78646	13.3985	0	0	0	10.40234	13.48352	13.78869	13.46573	14.73833	10.36722	13.44089	0
I3KST8	I3KST8_ORENI	lg23h19orf44		DUF4614 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LEFTAETPR	10.73999977	1064.162544	12.28545	0	10.94209	14.14298	13.29487	15.04221	14.91052	14.82842	13.79533	15.68837	14.80779	14.31996	14.43157	14.92235	14.41351	13.80722	0	17.10121	13.35314	14.66534	15.33663	14.82621	15.04921	6.852849	11.32688	0	14.40734	14.29906	14.09589	15.26701	15.63421	13.73624	16.65873	14.15866	11.34538	12.06999	12.99232	12.70629	14.43834	13.19128	15.5585	14.18108	14.15095	13.16375	15.01594	13.13583	13.87755	12.90419	0	0	11.99706	12.58667	15.05611	15.78872
A0A669AUY6	A0A669AUY6_ORENI	nexmif		DUF4683 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EMAATEFDEQNGAK	1.820000052	1557.041566	0	0	0	13.96083	13.64661	15.08044	11.91062	14.15892	0	15.85018	13.72928	0	12.95478	13.37746	0	17.41834	0	15.3987	16.89952	0	13.72594	0	16.37743	0	15.32739	0	0	0	16.05398	0	13.92467	0	0	14.43287	0	0	0	0	15.18595	0	0	0	14.92594	0	14.81223	0	0	0	0	0	0	0	17.29708	0
A0A669CDV8	A0A669CDV8_ORENI			DUF4939 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GWLITSDDDRS	11.72000027	1265.40589	13.89039	15.72195	14.88707	14.21955	14.20486	12.71987	0	14.75866	15.4469	15.02696	13.9087	15.83777	17.83215	17.52012	0	16.74352	15.18624	15.40404	17.12171	0	12.73307	17.11423	0	0	0	0	15.02238	0	14.36255	14.42533	0	0	15.98755	13.9043	0	0	14.27503	13.07841	13.12996	15.32073	15.2827	0	0	0	0	0	16.49019	0	0	0	0	0	13.90921	0
A0A669CGV6	A0A669CGV6_ORENI	lg14h19orf47		DUF5577 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				APPITLR	9.56000042	767.0756071	22.04209	16.15272	20.9462	20.94898	16.35234	16.47736	21.28369	19.01713	17.19377	16.72358	20.50281	21.61412	18.53621	0	19.54492	17.82488	0	0	0	17.69626	0	18.09729	19.48499	14.96275	21.65736	0	15.76467	20.70161	21.27965	21.29088	17.30736	0	20.07711	21.18364	19.89296	20.40105	20.6977	21.90142	16.23114	17.3589	21.2464	17.1234	0	17.15504	20.71154	16.57376	0	17.30102	17.33982	17.05307	16.035	0	0	0
A0A669DUB8	A0A669DUB8_ORENI	LOC112846575		DUF659 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QYLDLKSDQWILLDELK	8.170000076	2120.860207	10.47185	0	12.15673	14.03775	12.38379	0	0	12.50101	0	0	14.83013	13.30873	8.721372	0	12.50561	15.70447	0	0	14.70755	14.33635	14.80714	0	14.77166	0	0	0	0	17.8183	0	0	0	0	14.09965	0	0	0	0	13.18175	14.52321	13.60637	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3JDV1	I3JDV1_ORENI		homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	Dachsous cadherin-related 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	calcium ion binding [GO:0005509]	FANPVRGFTINSLTGEIQATEK	1.470000029	2392.299946	14.70115	13.64561	12.44465	0	0	0	12.42716	14.5899	14.97939	0	0	13.22383	0	0	15.77781	14.80785	14.48081	15.12836	0	0	0	15.22625	0	0	0	14.37395	15.48058	15.02343	15.65584	0	0	0	0	13.94429	0	13.39433	13.3911	0	0	0	0	0	17.63266	0	0	15.11479	0	15.27626	15.66964	14.03541	0	0	0	15.90778
A0A669DQK5	A0A669DQK5_ORENI	ddb1	DNA repair [GO:0006281]	Damage-specific DNA-binding protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; nucleic acid binding [GO:0003676]; DNA repair [GO:0006281]	nucleic acid binding [GO:0003676]	IAVMELFRPKALSSSVSSSK	5.019999981	2136.262233	9.580659	13.88561	11.07574	13.89038	6.778847	13.41097	15.43013	0	7.928469	0	11.96845	12.51087	13.89459	0	0	16.06799	13.34464	12.81209	0	0	0	0	0	15.31233	0	0	0	0	0	0	0	16.0911	11.21124	0	12.27287	0	16.6355	12.99542	12.9164	0	0	0	0	0	13.3255	0	10.13752	10.91279	16.65717	0	19.86491	0	0	0
A0A669C754	A0A669C754_ORENI		small GTPase mediated signal transduction [GO:0007264]	Dedicator of cytokinesis 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; guanyl-nucleotide exchange factor activity [GO:0005085]; small GTPase mediated signal transduction [GO:0007264]	guanyl-nucleotide exchange factor activity [GO:0005085]	WVDGGKPIFK	6.880000114	1146.84091	14.18393	0	12.73638	14.47388	12.89008	14.09209	13.92664	11.69493	13.74084	0	17.93604	11.88439	14.13399	10.40485	13.42348	13.50095	10.59511	13.69101	0	0	16.63823	14.24796	13.93577	0	12.73888	17.66105	0	0	14.04314	14.33068	0	0	0	0	0	17.35517	14.91702	0	0	0	14.51014	0	12.93035	0	0	0	14.85812	0	0	0	0	0	0	13.44221
I3KPQ5	I3KPQ5_ORENI		small GTPase mediated signal transduction [GO:0007264]	Dedicator of cytokinesis 11	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]; small GTPase mediated signal transduction [GO:0007264]	guanyl-nucleotide exchange factor activity [GO:0005085]	DPKVLTEMK	10.64999962	1062.133095	15.7018	0	15.63297	15.46776	14.90652	14.28818	15.62612	13.79378	14.8229	14.67886	13.43268	15.63832	15.13914	15.9505	14.5407	16.10756	15.8365	15.48554	13.18568	14.75517	13.55362	0	13.38692	15.01483	14.79473	15.40509	15.52461	13.38354	16.15152	14.5528	16.59448	17.06601	17.03864	18.53944	16.07932	14.83692	16.47573	16.85045	13.64826	0	15.65162	15.87216	15.42152	16.55153	0	12.17391	15.95582	0	0	16.33265	0	16.87951	18.14292	14.76247
A0A669DWQ3	A0A669DWQ3_ORENI	DOCK2	actin cytoskeleton organization [GO:0030036]; small GTPase mediated signal transduction [GO:0007264]	Dedicator of cytokinesis 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; guanyl-nucleotide exchange factor activity [GO:0005085]; actin cytoskeleton organization [GO:0030036]; small GTPase mediated signal transduction [GO:0007264]	guanyl-nucleotide exchange factor activity [GO:0005085]	NHHSDPHK	9.18999958	971.627456	0	12.48362	13.14938	15.00771	0	14.65463	12.53616	0	14.66795	14.27889	12.35452	8.384281	14.87619	15.81054	15.17279	0	13.97606	13.4973	16.24411	13.63334	11.46238	0	12.1264	0	19.75065	15.14074	18.73751	11.00619	0	0	0	0	15.09492	0	0	10.85587	11.26135	0	0	12.30571	14.26002	13.23475	0	0	15.03141	0	0	0	0	0	0	0	0	15.23906
I3J9T5	I3J9T5_ORENI		small GTPase mediated signal transduction [GO:0007264]	Dedicator of cytokinesis 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; guanyl-nucleotide exchange factor activity [GO:0005085]; small GTPase mediated signal transduction [GO:0007264]	guanyl-nucleotide exchange factor activity [GO:0005085]	VMDILGR	4.420000076	819.8683334	15.07392	0	13.63601	14.86691	12.25206	14.94975	13.47093	13.92459	13.30825	14.86607	15.15494	14.83757	13.8815	14.5378	12.97918	14.78822	14.16984	14.32442	0	14.97966	0	0	15.88473	12.02312	15.30789	15.56076	13.80328	14.71725	14.6012	14.49294	0	0	14.67662	0	14.70921	0	13.38391	0	0	15.27737	0	14.18359	14.71803	14.19747	0	0	15.2042	14.37388	14.7161	14.82475	0	13.72896	12.98836	14.03238
I3KD30	I3KD30_ORENI		small GTPase mediated signal transduction [GO:0007264]	Dedicator of cytokinesis 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; guanyl-nucleotide exchange factor activity [GO:0005085]; small GTPase mediated signal transduction [GO:0007264]	guanyl-nucleotide exchange factor activity [GO:0005085]	DMQNAGTGGAVPSAESRYSTMGR	7.389999866	2358.495001	9.064036	0	0	0	10.8625	13.27593	8.039977	0	0	0	9.168361	0	13.09535	0	0	0	0	14.75377	13.07898	15.01922	0	0	13.98414	0	0	0	15.31051	0	14.0356	0	11.64237	0	6.143702	18.36682	0	0	0	0	0	0	11.92972	0	0	0	13.06365	9.854822	12.38184	12.95427	0	0	0	11.89836	0	13.94097
A0A669ER24	A0A669ER24_ORENI	DOCK9	small GTPase mediated signal transduction [GO:0007264]	Dedicator of cytokinesis 9	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]; small GTPase mediated signal transduction [GO:0007264]	guanyl-nucleotide exchange factor activity [GO:0005085]	ESLFVESRMK	8.460000038	1226.603988	10.5759	0	0	6.913519	0	0	11.77617	16.81827	14.58117	14.35083	13.89206	0	9.032826	0	12.70092	0	11.66083	0	0	0	11.0675	0	0	13.98727	12.69061	11.64356	0	0	13.21048	12.26771	0	0	0	0	0	0	7.309354	0	14.51096	12.38239	13.68722	12.36888	0	13.84352	0	12.03564	0	12.4643	12.30079	13.35999	14.12719	0	0	0
A0A669CKR2	A0A669CKR2_ORENI			Delta(24)-sterol reductase (EC 1.3.1.72)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; delta24-sterol reductase activity [GO:0050614]; FAD binding [GO:0071949]	delta24-sterol reductase activity [GO:0050614]; FAD binding [GO:0071949]	VKGLDYVIVHQR	5.599999905	1426.4492	14.64231	13.34566	14.43849	16.04985	12.21926	13.99619	0	14.46605	0	0	13.34482	0	16.00611	0	13.19156	0	0	16.20548	15.29765	14.43018	0	0	0	0	0	0	17.42912	0	0	18.25	0	0	14.19793	18.96695	11.75833	14.08917	13.24984	12.1756	11.70179	13.69716	0	14.29102	15.71064	15.69893	12.53863	10.83316	15.13773	0	14.73177	14.70802	15.03983	0	0	0
A0A669DXA9	A0A669DXA9_ORENI	LOC100705401	L-proline biosynthetic process [GO:0055129]	Delta-1-pyrroline-5-carboxylate synthase [Includes: Glutamate 5-kinase (GK) (EC 2.7.2.11) (Gamma-glutamyl kinase); Gamma-glutamyl phosphate reductase (GPR) (EC 1.2.1.41) (Glutamate-5-semialdehyde dehydrogenase) (Glutamyl-gamma-semialdehyde dehydrogenase)]	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; ATP binding [GO:0005524]; glutamate 5-kinase activity [GO:0004349]; glutamate-5-semialdehyde dehydrogenase activity [GO:0004350]; L-proline biosynthetic process [GO:0055129]	ATP binding [GO:0005524]; glutamate 5-kinase activity [GO:0004349]; glutamate-5-semialdehyde dehydrogenase activity [GO:0004350]	KEEILAANK	6.71999979	1015.016218	13.3892	13.09031	0	11.22906	14.73408	10.80105	12.44653	13.63285	13.65088	16.5643	0	0	13.16017	14.54857	0	0	12.68758	13.61508	13.38559	14.5711	14.3208	15.63552	0	15.93094	12.87228	0	14.72213	12.98311	13.59112	11.82185	0	14.59684	12.31753	15.11619	13.42901	11.72455	0	0	0	0	0	15.61226	0	0	14.17928	0	0	0	0	0	13.06588	0	0	0
A0A669CC47	A0A669CC47_ORENI	LOC100699141	multicellular organism development [GO:0007275]; Notch signaling pathway [GO:0007219]	Delta-like protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium ion binding [GO:0005509]; Notch binding [GO:0005112]; multicellular organism development [GO:0007275]; Notch signaling pathway [GO:0007219]	calcium ion binding [GO:0005509]; Notch binding [GO:0005112]	NTVTLMIYR	13.78999996	1111.789212	0	11.50173	0	12.10236	15.01317	14.26006	14.70754	16.7418	16.61797	16.9639	0	0	0	14.36992	12.62112	13.77176	14.05535	13.24475	12.57241	13.40357	14.44267	0	9.718525	13.32028	15.37157	0	0	17.15743	17.96178	0	17.21556	18.58902	17.26876	0	14.58536	15.02144	12.97792	0	0	13.23033	0	10.0211	0	16.36567	16.53563	0	13.83753	15.03321	0	16.26741	14.86026	16.46259	13.56287	17.18792
A0A669BBU6	A0A669BBU6_ORENI			Delta/notch-like EGF repeat containing	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium ion binding [GO:0005509]	calcium ion binding [GO:0005509]	QGGEGR	3.470000029	604.3249978	16.52898	15.8199	16.08572	14.97694	14.73987	14.31089	15.53559	0	14.87383	17.36276	14.77578	16.87308	15.59862	17.42998	16.02348	16.88735	0	15.76179	13.96271	0	16.51449	0	15.19797	16.55727	16.01283	16.67986	15.16087	16.78712	0	16.23001	18.54203	17.57612	20.86145	14.26674	14.97814	14.99952	14.55144	17.03158	16.54753	16.73869	14.78923	14.64447	15.72076	15.72248	0	15.9543	16.15603	19.72463	14.20227	14.73506	16.75143	16.27659	16.83116	15.98572
I3K3V9	I3K3V9_ORENI		cytoskeleton organization [GO:0007010]	Dematin actin binding protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; actin binding [GO:0003779]; cytoskeleton organization [GO:0007010]	actin binding [GO:0003779]	THMHGSLSAGASK	6.440000057	1282.496461	17.66666	0	0	14.61379	10.09806	0	17.29044	0	0	10.67042	0	0	0	0	0	14.66844	13.62318	0	0	16.53712	15.94025	16.4547	15.99503	0	0	0	0	0	14.16668	15.33274	20.72414	21.60208	12.89183	15.5985	13.80135	13.48165	0	12.39205	0	0	14.24489	0	0	0	14.68671	15.55991	0	0	0	0	0	0	0	0
A0A669EQT9	A0A669EQT9_ORENI			Deoxynucleotidyltransferase terminal-interacting protein 1 (Terminal deoxynucleotidyltransferase-interacting factor 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	HHMRATGGK	9.770000458	994.2610657	13.14143	13.96474	14.56141	13.85998	15.04447	0	0	13.71902	0	13.80729	14.86763	12.36821	13.8877	14.76124	0	18.55022	0	0	14.57596	13.5879	0	0	12.84129	14.09296	12.88424	11.31378	0	13.53366	11.56151	14.1871	0	0	0	0	14.43321	0	13.78797	0	13.94652	13.27199	17.61686	17.27893	10.79616	14.95623	14.02957	14.13359	15.54354	13.09954	13.67744	0	0	0	0	0
A0A669AZN2	A0A669AZN2_ORENI	LOC100699025	DNA catabolic process [GO:0006308]	Deoxyribonuclease	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		deoxyribonuclease activity [GO:0004536]; endonuclease activity [GO:0004519]; DNA catabolic process [GO:0006308]	deoxyribonuclease activity [GO:0004536]; endonuclease activity [GO:0004519]	SFLSAL	2.369999886	636.4123566	14.61496	14.74199	14.61114	14.11207	0	14.61693	0	14.18988	14.14582	13.52309	14.20624	14.98903	11.0041	14.41614	0	0	0	14.71321	0	13.55745	0	0	0	15.38613	0	13.56948	0	13.91163	0	0	0	15.49926	0	0	0	15.709	0	0	0	0	0	12.40868	13.55511	13.62885	0	0	0	0	0	0	0	0	0	0
A0A669DMG4	A0A669DMG4_ORENI			Desmin b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	intermediate filament [GO:0005882]	intermediate filament [GO:0005882]		QMRDMEDR	6.800000191	1079.43712	15.42486	12.83266	11.2772	16.92901	0	0	0	15.99602	15.00034	12.84952	0	0	12.29038	13.4574	0	14.16644	14.73958	14.16365	10.5479	14.61592	12.98497	13.90181	13.99858	13.44283	0	16.15636	0	0	14.0683	0	0	13.14749	13.8174	10.90638	0	0	12.89401	0	16.75068	0	0	0	0	0	16.42809	15.6462	12.40728	13.27165	0	0	15.59785	15.73894	0	0
A0A669AWV2	A0A669AWV2_ORENI		protein deubiquitination [GO:0016579]	Deubiquitinating enzyme A (EC 3.4.19.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cysteine-type peptidase activity [GO:0008234]; thiol-dependent ubiquitin-specific protease activity [GO:0004843]; protein deubiquitination [GO:0016579]	cysteine-type peptidase activity [GO:0008234]; thiol-dependent ubiquitin-specific protease activity [GO:0004843]	HHLEYR	1.629999995	855.7115712	14.97705	12.54902	14.3294	13.16123	15.24324	13.88543	14.85768	13.5668	0	15.22561	13.96775	11.79978	15.03892	14.0949	14.16863	13.08146	13.94709	14.7182	14.55304	15.03712	13.5113	13.82336	14.70424	14.04578	14.17096	15.2632	13.70327	14.13199	15.28195	14.82745	14.37886	17.37785	16.02719	14.51293	14.95089	15.3397	12.28415	13.8269	12.14431	0	14.08115	13.9898	14.1345	12.12989	11.68688	13.58697	13.68241	13.89641	14.61952	13.88313	13.61173	15.01772	14.93679	15.49295
A0A669BE33	A0A669BE33_ORENI	cyld	innate immune response [GO:0045087]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]; Wnt signaling pathway [GO:0016055]	Deubiquitinating enzyme CYLD (Ubiquitin carboxyl-terminal hydrolase CYLD) (Ubiquitin thioesterase CYLD) (Ubiquitin-specific-processing protease CYLD)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell projection [GO:0042995]; microtubule organizing center [GO:0005815]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; spindle [GO:0005819]	cell projection [GO:0042995]; microtubule organizing center [GO:0005815]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; spindle [GO:0005819]; thiol-dependent ubiquitin-specific protease activity [GO:0004843]; innate immune response [GO:0045087]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]; Wnt signaling pathway [GO:0016055]	thiol-dependent ubiquitin-specific protease activity [GO:0004843]	GPASDKSSSSQSKPK	4.800000191	1491.871465	0	13.46914	11.98292	0	13.26371	0	11.69291	0	0	0	11.14845	0	0	14.67503	12.63587	0	0	13.00787	13.27347	0	14.193	13.7982	0	13.41237	0	14.27458	14.29466	0	0	12.34151	16.04286	23.33976	17.76181	14.33784	13.64045	0	0	12.77341	0	0	14.45965	0	0	0	0	13.2738	0	12.58548	0	9.624564	0	0	0	12.77999
A0A669B2F3	A0A669B2F3_ORENI	LOC100701346	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; apoptotic process [GO:0006915]	"Diablo homolog, mitochondrial"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; apoptotic process [GO:0006915]		NQIDISVLRTSK	4.110000134	1373.247044	0	0	0	16.02094	0	15.98179	16.05763	15.17984	14.09485	16.6076	0	15.33061	0	0	0	0	0	0	15.9745	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.29329	15.37962	14.85951	15.38037	0	0	0	0	0	0	0	16.00622	0	0	0	14.29182	0	0	0	0	0
A0A669E129	A0A669E129_ORENI	DGKQ	glycerolipid metabolic process [GO:0046486]; intracellular signal transduction [GO:0035556]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]	Diacylglycerol kinase (DAG kinase) (EC 2.7.1.107)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; diacylglycerol kinase activity [GO:0004143]; NAD+ kinase activity [GO:0003951]; glycerolipid metabolic process [GO:0046486]; intracellular signal transduction [GO:0035556]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]	ATP binding [GO:0005524]; diacylglycerol kinase activity [GO:0004143]; NAD+ kinase activity [GO:0003951]	PSTAPFEDMADSGRPRPADPDAAESR	1.519999981	2760.2606	15.57829	16.92023	16.41197	0	19.24326	14.08822	15.92605	15.24652	15.69822	16.25899	0	13.77028	0	14.7805	13.03657	0	16.50487	14.80363	14.8687	14.7638	14.17978	16.5588	15.87097	16.39023	15.61549	13.51682	12.74742	15.22878	0	0	0	0	0	16.08627	0	0	0	14.96755	0	0	0	0	0	14.5392	0	0	13.28283	13.3685	0	0	0	0	0	17.3121
I3J2P5	I3J2P5_ORENI		actin filament organization [GO:0007015]; female gamete generation [GO:0007292]	Diaphanous-related formin 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]; small GTPase binding [GO:0031267]; actin filament organization [GO:0007015]; female gamete generation [GO:0007292]	actin binding [GO:0003779]; small GTPase binding [GO:0031267]	MSISFFYCQYEKLSTMHK	10.31999969	2314.240621	0	11.67322	12.69967	0	0	13.0325	0	0	0	0	0	9.871574	0	0	0	0	13.04723	10.0007	15.49658	0	0	12.26074	12.73044	13.49396	0	14.0428	14.46008	0	12.89488	18.40266	0	13.82571	0	0	0	0	9.468274	13.34711	11.30339	9.903668	12.08217	12.56007	0	0	0	0	11.53492	0	11.70043	0	0	0	11.86416	13.67865
A0A669DXP1	A0A669DXP1_ORENI		actin cytoskeleton organization [GO:0030036]	Diaphanous-related formin 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]; small GTPase binding [GO:0031267]; actin cytoskeleton organization [GO:0030036]	actin binding [GO:0003779]; small GTPase binding [GO:0031267]	HLALLAR	14.5	794.7208154	14.78602	14.08645	15.04869	13.79531	14.52495	0	14.04736	12.54663	11.71506	15.01869	15.96858	15.16182	0	13.81765	15.28302	15.29251	0	13.60303	15.20228	0	15.11256	11.58801	14.71012	13.65841	0	11.16637	0	13.83012	14.78595	0	16.05573	15.93201	16.68975	15.5371	16.33863	14.99254	14.9633	13.83184	0	9.951004	14.18783	15.5806	13.88517	16.00247	15.51167	15.29148	16.34793	15.71022	16.06444	16.56297	16.10744	13.95986	13.75243	15.28919
A0A669BZM9	A0A669BZM9_ORENI	dhfr	glycine biosynthetic process [GO:0006545]; tetrahydrofolate biosynthetic process [GO:0046654]	Dihydrofolate reductase (EC 1.5.1.3)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		dihydrofolate reductase activity [GO:0004146]; NADP binding [GO:0050661]; glycine biosynthetic process [GO:0006545]; tetrahydrofolate biosynthetic process [GO:0046654]	dihydrofolate reductase activity [GO:0004146]; NADP binding [GO:0050661]	GKQNVVIMGK	5.78000021	1088.7462	0	16.15847	13.44929	13.39663	0	14.51063	0	12.64562	13.89549	13.91849	16.50043	16.35923	13.54591	14.98504	15.95072	14.75647	0	0	0	0	14.82318	15.61193	15.48634	0	13.02025	17.0143	0	0	0	0	0	0	16.50427	0	0	0	0	0	0	0	0	0	0	0	0	0	16.23602	0	0	0	0	0	0	19.46912
A0A669DI33	A0A669DI33_ORENI		axon guidance [GO:0007411]	Dihydropyrimidinase like 5b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	"cytoplasm [GO:0005737]; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [GO:0016810]; microtubule binding [GO:0008017]; axon guidance [GO:0007411]"	"hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [GO:0016810]; microtubule binding [GO:0008017]"	MAANMGSMR	12.86999989	984.5065434	12.96465	12.98118	12.88007	14.10509	0	14.28066	13.72408	0	12.60091	13.41151	15.75893	14.32329	13.19612	0	14.85549	14.42809	13.19893	10.09101	15.00693	0	14.67064	14.25925	14.12072	15.54608	14.87805	14.5239	14.49139	13.79593	13.61905	11.92616	13.94555	14.02868	0	14.96271	13.05432	14.30007	0	12.96776	13.02059	14.86243	14.8248	13.87421	0	11.11579	12.7949	14.13366	14.38536	12.3978	13.17879	15.69683	15.10527	14.72539	14.23194	12.81811
A0A669BHI6	A0A669BHI6_ORENI	LOC106097885		Dimer_Tnp_hAT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein dimerization activity [GO:0046983]	protein dimerization activity [GO:0046983]	LFSVAGHIVNKK	5.659999847	1312.360063	0	12.60075	11.6827	0	9.778201	0	12.57573	16.56383	0	9.452627	13.86626	0	12.10066	13.37851	13.51235	13.16425	0	13.72064	12.82302	13.68575	0	14.71574	11.93903	10.16444	0	0	0	0	0	14.55696	15.15573	16.07784	16.85773	15.36256	12.90396	11.47367	9.442091	14.93795	11.06893	0	0	10.89044	12.24485	0	13.93969	0	0	14.20391	13.937	12.66663	14.18206	13.89746	15.79007	13.27366
A0A669CLU1	A0A669CLU1_ORENI			Dimethylaniline monooxygenase [N-oxide-forming] (EC 1.14.13.8)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]	"endoplasmic reticulum membrane [GO:0005789]; flavin adenine dinucleotide binding [GO:0050660]; N,N-dimethylaniline monooxygenase activity [GO:0004499]; NADP binding [GO:0050661]; NADPH oxidase H202-forming activity [GO:0106294]"	"flavin adenine dinucleotide binding [GO:0050660]; N,N-dimethylaniline monooxygenase activity [GO:0004499]; NADP binding [GO:0050661]; NADPH oxidase H202-forming activity [GO:0106294]"	QEAMAQRYVTSQR	2.940000057	1583.029876	13.28106	0	0	0	0	11.03639	0	0	15.22531	0	13.72859	0	15.72641	12.06829	15.36774	15.00603	0	0	16.51505	0	0	0	0	13.64622	0	0	14.9727	14.802	0	0	0	0	13.25064	12.45833	0	0	0	0	0	0	0	9.237684	14.32542	14.90885	16.11275	0	0	0	0	15.20517	0	0	0	0
A0A669E163	A0A669E163_ORENI	LOC100711249		Dipeptidase (EC 3.4.13.19)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	anchored component of membrane [GO:0031225]	anchored component of membrane [GO:0031225]; metal ion binding [GO:0046872]; metallodipeptidase activity [GO:0070573]	metal ion binding [GO:0046872]; metallodipeptidase activity [GO:0070573]	NQGLIMVNLHNTFVSCR	1.970000029	2018.909093	9.384261	11.41162	14.69735	0	12.33403	10.55459	12.9069	0	13.90323	15.64708	13.89024	13.31141	13.72369	13.60832	0	14.58511	16.24791	11.71759	11.89418	11.99022	0	14.95588	0	0	0	15.4042	0	12.81994	11.73735	0	16.28505	0	13.80353	13.33428	13.13886	11.45286	11.70714	13.55571	13.23539	17.05283	10.56338	15.21167	0	15.0799	12.69965	13.53262	0	0	14.66551	15.19666	15.37799	14.61413	15.017	12.99337
I3JQP9	I3JQP9_ORENI	LOC100703810	cell adhesion [GO:0007155]	Dipeptidyl peptidase 4 (EC 3.4.14.5) (Dipeptidyl peptidase 4 membrane form) (Dipeptidyl peptidase 4 soluble form) (Dipeptidyl peptidase IV) (Dipeptidyl peptidase IV membrane form) (Dipeptidyl peptidase IV soluble form) (T-cell activation antigen CD26)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	apical plasma membrane [GO:0016324]; cell junction [GO:0030054]; integral component of membrane [GO:0016021]; lamellipodium membrane [GO:0031258]; membrane raft [GO:0045121]	apical plasma membrane [GO:0016324]; cell junction [GO:0030054]; integral component of membrane [GO:0016021]; lamellipodium membrane [GO:0031258]; membrane raft [GO:0045121]; dipeptidyl-peptidase activity [GO:0008239]; serine-type endopeptidase activity [GO:0004252]; cell adhesion [GO:0007155]	dipeptidyl-peptidase activity [GO:0008239]; serine-type endopeptidase activity [GO:0004252]	SLSEFHMPTMKYGTLK	3.130000114	1886.531037	12.09262	12.34037	14.20744	13.14123	0	0	0	13.74795	12.22649	14.43196	14.4955	13.7601	0	10.36898	0	13.25932	11.09105	13.33709	6.368937	10.53328	12.08973	11.41806	7.137294	13.63375	9.273283	14.09814	0	0	13.12496	0	14.76706	0	13.73796	9.456676	12.95376	0	13.92251	0	0	10.71409	0	10.10694	12.41932	14.78379	0	0	10.20901	12.9748	0	14.38953	0	8.969226	0	14.19699
A0A669CME1	A0A669CME1_ORENI			Disco-interacting protein 2 homolog Bb	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EGTVVGVAVSK	10.47000027	1045.641475	0	0	0	15.46635	16.19529	0	0	15.4307	0	0	15.98375	0	0	0	0	0	14.72584	14.98156	0	0	0	15.26866	13.91758	0	0	0	0	0	0	15.59093	19.38122	0	18.67128	0	0	0	0	0	0	16.687	15.83323	15.36764	0	0	0	0	15.68083	0	13.75801	14.74703	0	0	0	0
A0A669F3X4	A0A669F3X4_ORENI			Discoidin domain receptor tyrosine kinase 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of plasma membrane [GO:0005887]	integral component of plasma membrane [GO:0005887]; ATP binding [GO:0005524]; protein tyrosine kinase collagen receptor activity [GO:0038062]	ATP binding [GO:0005524]; protein tyrosine kinase collagen receptor activity [GO:0038062]	QVWQKMLEK	12.39000034	1205.962703	9.318512	13.07005	10.37751	13.04735	0	12.96963	12.45302	0	14.31554	14.10188	14.72431	17.62822	0	11.46019	0	10.81105	0	0	14.11528	15.84308	15.12973	0	0	0	13.8014	14.34008	12.79508	0	14.96955	0	12.15049	14.5915	15.51272	13.83256	10.6261	12.71606	12.72468	9.765795	9.775456	0	5.405748	0	13.42991	12.62444	12.53435	0	0	11.30637	0	0	9.199532	14.36731	13.16263	13.82973
A0A669AX19	A0A669AX19_ORENI		regulation of apoptotic process [GO:0042981]	"Discs, large homolog 5b (Drosophila), tandem duplicate 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		regulation of apoptotic process [GO:0042981]		HSMADMK	1.070000052	852.3443888	0	11.63335	14.88102	14.6179	0	14.44831	13.85016	16.0727	0	0	13.96888	0	14.97662	14.19449	14.97089	15.21456	14.40654	0	15.04025	14.53954	14.6035	15.43043	15.03346	15.87036	16.41945	18.25522	16.13677	15.91871	16.8654	0	15.43836	15.04528	0	0	14.2	15.03661	0	15.9504	15.52194	14.28297	0	15.28994	14.672	0	14.8806	16.97492	16.83502	13.72023	14.70477	0	15.37469	16.76373	16.57384	16.68471
A0A669EAS2	A0A669EAS2_ORENI	adam10	membrane protein ectodomain proteolysis [GO:0006509]; Notch signaling pathway [GO:0007219]	Disintegrin and metalloproteinase domain-containing protein 10 (EC 3.4.24.81) (Kuzbanian protein homolog)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; metalloendopeptidase activity [GO:0004222]; SH3 domain binding [GO:0017124]; membrane protein ectodomain proteolysis [GO:0006509]; Notch signaling pathway [GO:0007219]	metalloendopeptidase activity [GO:0004222]; SH3 domain binding [GO:0017124]	TNPSTCSSTR	13.5	1110.814462	11.97006	0	12.68003	13.86053	13.98616	14.78252	6.251108	13.07228	14.0822	0	0	14.74719	0	17.07742	18.05156	0	13.19727	9.260216	15.10398	12.4778	18.03482	12.69875	0	12.93151	0	13.14326	13.36475	0	0	11.93603	15.7993	0	17.50121	11.36076	18.66815	9.732824	14.40931	0	0	10.80406	0	10.78316	17.41637	14.2778	0	13.27457	13.37492	12.57409	13.27598	13.55373	0	12.52223	14.90031	0
A0A669CBX9	A0A669CBX9_ORENI			Dmx-like 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TLATGFEVDGGKLR	2.390000105	1463.75453	13.84069	15.68021	0	16.02178	12.18907	13.30027	14.97421	12.98496	13.17442	11.94555	0	13.36688	0	0	14.19159	14.99267	0	0	0	0	16.60189	0	15.22957	11.97025	0	0	13.07892	14.14527	0	0	0	15.94121	14.16536	0	0	0	0	0	13.71315	0	0	0	14.76585	0	14.63028	14.94376	15.73395	0	0	16.16732	14.41524	0	0	0
I3J4Z3	I3J4Z3_ORENI		protein folding [GO:0006457]	DnaJ heat shock protein family (Hsp40) member A2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		heat shock protein binding [GO:0031072]; metal ion binding [GO:0046872]; unfolded protein binding [GO:0051082]; protein folding [GO:0006457]	heat shock protein binding [GO:0031072]; metal ion binding [GO:0046872]; unfolded protein binding [GO:0051082]	IMIRQLAPGMVQQMQSVCTDCNGEGEVISEK	4.579999924	3524.874917	10.68737	11.42426	10.70214	11.5261	0	0	0	0	10.22467	12.41278	9.058933	11.46711	11.20326	10.50687	11.77976	10.45223	0	11.8356	0	0	13.1038	0	0	0	0	0	0	0	0	0	13.43893	0	0	0	0	0	0	0	0	11.47652	12.09167	0	0	0	0	12.87925	11.33295	13.05973	0	16.10282	14.16454	0	0	0
I3J9K2	I3J9K2_ORENI		protein folding [GO:0006457]	DnaJ heat shock protein family (Hsp40) member B13	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		unfolded protein binding [GO:0051082]; protein folding [GO:0006457]	unfolded protein binding [GO:0051082]	VLSGEGMPLSK	9.760000229	1116.486498	13.74068	12.94398	14.70323	0	13.28269	15.47103	0	0	10.22496	13.73099	12.59869	14.67753	13.88387	12.99043	14.93132	9.678321	12.91231	14.97546	0	13.67908	15.28212	12.90187	14.2372	12.95018	14.31374	11.47936	14.20238	12.63666	11.91397	8.470074	14.69276	0	12.49199	0	0	0	0	0	0	14.00961	12.65937	0	14.38243	12.47818	0	0	14.26718	0	0	0	0	13.05641	0	0
A0A669C583	A0A669C583_ORENI	dnajc2		DnaJ homolog subfamily C member 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]	cytosol [GO:0005829]		QAARSSEQASGGAGGGK	3.299999952	1519.755008	12.79542	12.41457	12.814	14.6797	0	14.03356	13.27671	12.02933	0	12.66953	0	0	13.72371	0	15.1208	0	0	0	0	0	0	0	0	0	14.94975	0	0	0	0	0	0	0	0	0	0	16.32566	0	0	0	14.53261	0	0	0	14.76129	13.95057	0	13.5205	0	0	14.54799	0	0	0	13.71112
A0A669DZ77	A0A669DZ77_ORENI		protein glycosylation [GO:0006486]	Dolichol-phosphate mannosyltransferase subunit 1 (EC 2.4.1.83)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum [GO:0005783]	endoplasmic reticulum [GO:0005783]; dolichyl-phosphate beta-D-mannosyltransferase activity [GO:0004582]; protein glycosylation [GO:0006486]	dolichyl-phosphate beta-D-mannosyltransferase activity [GO:0004582]	GLLMLFATT	10.13000011	980.2999333	15.05293	14.38584	12.97807	14.08772	12.25811	14.63305	0	0	13.22183	14.29511	14.39117	15.95448	13.35747	8.38568	15.15802	15.81301	0	13.89256	17.252	14.81412	0	0	0	15.10468	0	0	15.07346	13.96102	13.50298	15.36701	0	18.83996	0	0	13.2284	14.72882	13.88616	14.77613	15.52798	12.80906	11.27811	15.13955	0	0	16.73899	14.42354	13.39466	11.21265	14.50318	0	14.30268	13.8874	12.52899	12.91657
A0A669C7B1	A0A669C7B1_ORENI	LOC100694244		Dolichyl-phosphate-mannose--protein mannosyltransferase (EC 2.4.1.109)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum [GO:0005783]; integral component of membrane [GO:0016021]	endoplasmic reticulum [GO:0005783]; integral component of membrane [GO:0016021]; dolichyl-phosphate-mannose-protein mannosyltransferase activity [GO:0004169]	dolichyl-phosphate-mannose-protein mannosyltransferase activity [GO:0004169]	NQDWQNEEMLYKSGIYVNPAK	5.820000172	2542.968499	0	11.68811	11.22097	16.99175	0	0	0	7.995523	11.7516	0	0	0	11.74969	9.520207	0	0	0	0	8.82256	0	0	0	0	10.23272	13.69352	0	0	12.97728	0	0	0	0	12.22999	0	0	0	13.09293	0	0	0	0	0	0	17.2764	0	0	0	0	0	0	0	11.58686	0	0
I3KG91	I3KG91_ORENI	dop1b	Golgi to endosome transport [GO:0006895]; protein transport [GO:0015031]	Dopey_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]; integral component of membrane [GO:0016021]	cytosol [GO:0005829]; integral component of membrane [GO:0016021]; Golgi to endosome transport [GO:0006895]; protein transport [GO:0015031]		EMLGEETITSSGLSGSQLASK	6.380000114	2126.011253	12.80058	12.40689	12.18018	14.49318	12.41677	12.36546	14.0368	11.49484	13.99226	8.853447	13.4271	0	0	0	0	0	0	14.91959	12.98743	13.04848	0	0	0	14.78327	13.1675	0	11.73821	10.99464	0	0	0	0	15.2127	0	12.93299	13.32001	14.95598	12.45119	0	0	0	13.81068	13.46443	0	14.50939	12.29437	15.01647	11.81077	12.96939	0	13.77858	13.05118	0	0
I3JSD3	I3JSD3_ORENI		brain development [GO:0007420]; chemical synaptic transmission [GO:0007268]; multicellular organism growth [GO:0035264]; regulation of calcium ion-dependent exocytosis [GO:0017158]	"Double C2-like domains, alpha"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]; synapse [GO:0045202]	membrane [GO:0016020]; synapse [GO:0045202]; calcium ion binding [GO:0005509]; calcium-dependent phospholipid binding [GO:0005544]; brain development [GO:0007420]; chemical synaptic transmission [GO:0007268]; multicellular organism growth [GO:0035264]; regulation of calcium ion-dependent exocytosis [GO:0017158]	calcium-dependent phospholipid binding [GO:0005544]; calcium ion binding [GO:0005509]	HKTAVMK	3.900000095	831.2738351	0	0	15.3892	0	0	0	0	15.26727	15.08235	0	0	15.83981	0	0	0	0	0	13.60527	14.95575	14.6237	0	0	0	0	0	0	15.03204	15.87278	0	0	0	15.77314	13.46964	0	0	0	0	0	15.03136	14.32244	0	15.7561	0	15.51332	0	0	0	0	0	16.32386	0	0	0	15.14382
I3J267	I3J267_ORENI	dmrta2	"regulation of transcription, DNA-templated [GO:0006355]"	Doublesex- and mab-3-related transcription factor A2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; metal ion binding [GO:0046872]; sequence-specific DNA binding [GO:0043565]; regulation of transcription, DNA-templated [GO:0006355]"	metal ion binding [GO:0046872]; sequence-specific DNA binding [GO:0043565]	DRTMLHK	7.949999809	917.0695755	16.63804	0	16.52184	16.03486	0	0	16.08859	0	0	0	16.30611	16.43274	16.83309	0	15.99463	0	16.5845	0	0	15.75994	0	0	15.82209	0	0	0	0	0	0	0	13.36284	14.64159	15.49299	0	0	15.58569	16.10594	16.82259	0	0	0	0	16.12171	16.0939	0	0	16.17136	0	0	14.43777	0	0	16.65614	0
A0A669BXT5	A0A669BXT5_ORENI		cell adhesion [GO:0007155]; central nervous system development [GO:0007417]	Down syndrome cell adhesion molecule like 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; cell adhesion [GO:0007155]; central nervous system development [GO:0007417]		VQLLIEDKEGIK	15.06000042	1385.097276	17.04396	0	15.92884	0	15.64988	16.26688	0	16.92169	16.54401	0	17.59719	0	0	0	0	0	0	0	0	0	0	0	0	0	19.87953	0	19.06648	0	0	0	0	0	0	0	19.59536	0	0	0	0	0	0	0	0	0	20.30626	0	0	0	15.67351	14.23371	0	0	0	0
A0A669BJ13	A0A669BJ13_ORENI	dr1	negative regulation of transcription by RNA polymerase II [GO:0000122]	Down-regulator of transcription 1 (Negative cofactor 2-beta) (Protein Dr1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	negative cofactor 2 complex [GO:0017054]	negative cofactor 2 complex [GO:0017054]; general transcription initiation factor activity [GO:0140223]; protein heterodimerization activity [GO:0046982]; negative regulation of transcription by RNA polymerase II [GO:0000122]	general transcription initiation factor activity [GO:0140223]; protein heterodimerization activity [GO:0046982]	LENLGIPEEELLRQQQELFAK	4.619999886	2496.59976	9.281314	0	0	10.04634	0	10.74682	0	11.97372	0	0	0	0	13.50409	12.89045	16.87575	12.14936	0	12.36686	0	0	14.62877	14.80375	0	0	8.094173	10.07189	0	0	0	0	0	0	0	7.407351	11.52703	0	0	9.942434	0	11.59906	0	0	0	0	17.92838	4.32021	0	0	12.43708	14.279	0	0	0	0
A0A669DKN3	A0A669DKN3_ORENI		pre-miRNA processing [GO:0031054]; rRNA catabolic process [GO:0016075]	Drosha ribonuclease III	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ribonuclease III activity [GO:0004525]; RNA binding [GO:0003723]; pre-miRNA processing [GO:0031054]; rRNA catabolic process [GO:0016075]	ribonuclease III activity [GO:0004525]; RNA binding [GO:0003723]	SESSSGLKK	3.339999914	921.4520379	0	14.96713	0	14.67942	13.12835	0	0	13.69844	13.40431	11.71319	0	13.99916	0	0	0	0	0	0	11.21733	15.35858	0	0	0	0	13.49143	0	15.72585	0	15.45568	0	14.43441	0	0	16.34259	13.46357	15.21482	14.57293	13.00549	0	14.22511	15.51751	14.81525	15.15577	16.35192	0	14.1327	0	0	10.97106	13.49673	0	15.74658	0	0
A0A669EII1	A0A669EII1_ORENI	LOC106097938		Dual specificity protein phosphatase (EC 3.1.3.16) (EC 3.1.3.48)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]; protein tyrosine phosphatase activity [GO:0004725]; protein tyrosine/serine/threonine phosphatase activity [GO:0008138]	protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]; protein tyrosine/serine/threonine phosphatase activity [GO:0008138]; protein tyrosine phosphatase activity [GO:0004725]	MSSCMVKSR	8.399999619	1086.396245	13.30371	13.31311	0	0	0	0	0	0	13.2356	10.07002	14.7482	0	12.75798	12.37834	15.25519	0	0	14.15547	0	0	0	0	0	13.70823	0	0	15.44156	0	15.11668	0	0	0	0	0	0	14.04656	12.76468	15.31084	0	0	0	0	0	0	13.96833	14.33526	0	0	0	14.26733	0	13.49614	0	0
A0A669DZQ7	A0A669DZQ7_ORENI	dyrk2		Dual-specificity kinase (EC 2.7.12.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine/tyrosine kinase activity [GO:0004712]; protein threonine kinase activity [GO:0106311]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	ATP binding [GO:0005524]; protein serine/threonine/tyrosine kinase activity [GO:0004712]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	LLDGSK	2.569999933	633.3643751	13.97207	14.5443	13.20467	12.34262	0	0	13.80137	13.84519	13.48445	13.52977	14.69766	14.93166	14.45827	15.15071	15.51116	0	13.75789	14.22385	15.0844	14.26897	15.19718	0	14.46418	15.01532	0	14.35958	13.48202	13.93272	12.65423	15.07034	0	0	17.50875	14.98334	13.30477	0	14.148	0	15.33825	0	14.23624	0	0	0	13.62487	0	14.23274	13.75373	15.2914	0	15.37624	0	0	0
A0A669AUW6	A0A669AUW6_ORENI	LOC100689885		Dynactin subunit 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	dynein complex [GO:0030286]	dynein complex [GO:0030286]		GPPGEQR	1.139999986	741.0661098	14.60709	14.39159	14.05154	13.57065	0	0	0	0	0	13.7624	14.34528	10.30219	15.05886	12.39226	0	13.41775	14.77078	0	0	13.60336	12.67699	0	14.94021	13.48525	15.28571	15.51396	14.75071	13.85439	14.54202	11.40105	0	0	16.10579	15.51427	0	13.05927	14.10439	14.35654	13.96202	0	10.76401	12.71497	14.98782	13.95441	14.26851	0	0	13.53202	0	15.06849	0	0	13.83122	15.22187
I3JQK6	I3JQK6_ORENI	DCTN6		Dynactin subunit 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; dynactin complex [GO:0005869]	cytoplasm [GO:0005737]; dynactin complex [GO:0005869]		ASHTAS	6.630000114	572.6195674	15.78205	0	14.58079	15.15785	16.04315	16.01902	13.36697	0	13.50226	0	15.16188	9.339472	15.37502	0	10.27038	13.9482	12.42634	13.91319	13.80216	13.49996	13.89427	14.73814	0	14.51998	15.01064	13.35334	0	15.26677	0	13.98603	0	0	0	0	0	14.74489	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.51065	0	13.99399
A0A669BJQ7	A0A669BJQ7_ORENI	opa1	apoptotic process [GO:0006915]; mitochondrion organization [GO:0007005]	"Dynamin-like 120 kDa protein, form S1 (EC 3.6.5.5) (Dynamin-like 120 kDa protein, mitochondrial)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]	integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; lipid binding [GO:0008289]; apoptotic process [GO:0006915]; mitochondrion organization [GO:0007005]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]; lipid binding [GO:0008289]	KIDQLQEELLR	1.340000033	1384.12485	0	7.617364	13.56684	12.76783	0	0	0	0	0	0	0	0	6.862907	0	9.27875	0	10.96057	0	0	0	0	13.75597	0	9.653499	13.56026	0	13.33526	12.70905	0	0	18.6748	11.85088	0	0	0	7.392622	0	9.427121	0	10.9081	0	10.68264	12.23595	0	10.8424	12.55735	13.61768	0	0	12.24608	0	0	0	10.10592
A0A669CYF4	A0A669CYF4_ORENI	DNAH10	microtubule-based movement [GO:0007018]	Dynein axonemal heavy chain 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; microtubule [GO:0005874]	"cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; microtubule [GO:0005874]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]; microtubule-based movement [GO:0007018]"	"ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]"	FLAMGQGQEKVALHLLEK	12.27000046	2027.206402	11.91379	0	11.94306	13.33258	0	0	10.51476	14.30673	0	12.00531	17.50338	14.45018	0	11.66915	13.06681	14.62435	0	0	14.26799	15.19841	13.56496	12.95639	16.85258	0	14.08632	13.99339	15.0741	0	14.98313	0	15.61563	0	0	14.67331	14.16192	11.44656	14.95499	13.04457	14.87855	13.58102	14.92313	12.50436	13.91421	13.9786	10.90612	12.53645	11.57442	11.31617	0	14.49582	0	0	17.92388	13.70724
A0A669EYZ2	A0A669EYZ2_ORENI	DYNC1I1	microtubule-based movement [GO:0007018]	Dynein cytoplasmic 1 intermediate chain 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasmic dynein complex [GO:0005868]	cytoplasmic dynein complex [GO:0005868]; microtubule-based movement [GO:0007018]		MDDTMSDK	5.400000095	942.4860122	14.14167	11.64459	12.90331	14.36809	14.85132	13.10251	15.11087	14.35135	0	13.46168	0	0	0	0	0	14.10739	10.83304	0	14.97418	0	0	0	0	0	14.88247	0	15.08045	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.95489	0
A0A669DLK1	A0A669DLK1_ORENI	LOC100694500	microtubule-based movement [GO:0007018]	Dynein light intermediate chain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoplasmic dynein complex [GO:0005868]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; cytoplasmic dynein complex [GO:0005868]; microtubule [GO:0005874]; ATP binding [GO:0005524]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]	KMATSGR	3.140000105	767.4987038	0	0	0	16.0952	19.99253	0	0	0	0	19.81321	0	0	16.0286	0	0	0	0	0	0	0	0	18.6095	0	16.36283	18.46681	19.39503	0	0	17.2307	18.40571	17.41171	16.48271	15.96533	15.93075	17.07719	15.12891	14.79498	18.63904	19.7079	19.26102	17.90272	18.40921	16.10833	0	0	17.23623	0	17.47323	18.91419	0	0	0	0	0
I3JI84	I3JI84_ORENI	GAS8	cell motility [GO:0048870]	Dynein regulatory complex subunit 4 (Growth arrest-specific protein 8)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; motile cilium [GO:0031514]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; motile cilium [GO:0031514]; microtubule binding [GO:0008017]; small GTPase binding [GO:0031267]; cell motility [GO:0048870]	microtubule binding [GO:0008017]; small GTPase binding [GO:0031267]	QRDAIMDVQQR	1.230000019	1375.603018	0	9.754976	0	0	0	0	0	0	0	0	0	0	0	0	9.243638	10.50022	0	0	10.78126	0	10.02692	0	14.38188	0	0	0	13.87645	11.57036	0	0	0	0	0	0	14.18608	10.27746	0	12.73013	13.80374	11.22686	16.68792	0	0	0	0	0	12.86619	0	0	14.90443	13.8921	0	0	0
I3J424	I3J424_ORENI		microtubule-based movement [GO:0007018]	"Dynein, axonemal, heavy chain 11"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; integral component of membrane [GO:0016021]; microtubule [GO:0005874]	"cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; integral component of membrane [GO:0016021]; microtubule [GO:0005874]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]; microtubule-based movement [GO:0007018]"	"ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]"	DCSGLESAMKMLTIAGPFLEK	1.470000029	2329.789092	12.86288	15.60639	11.89077	14.02713	0	0	9.671739	14.58425	12.70406	13.23788	0	14.56162	15.64894	16.55799	0	0	14.36607	0	0	16.91987	0	0	13.35555	18.12661	13.1194	15.07193	0	17.96609	15.68511	19.79389	15.31954	16.51466	0	0	0	0	0	0	12.08946	13.93174	14.63742	12.87779	15.27734	14.26057	13.00546	12.54168	12.13839	10.7513	14.71461	11.92985	13.11095	17.85854	18.90759	0
A0A669BHB3	A0A669BHB3_ORENI		microtubule-based movement [GO:0007018]	"Dynein, axonemal, heavy chain 12"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; microtubule [GO:0005874]	"cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; microtubule [GO:0005874]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]; microtubule-based movement [GO:0007018]"	"ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]"	MASSSSTVPIYDSK	4.539999962	1488.886445	0	0	0	0	15.94325	0	0	0	0	9.236138	0	0	0	0	13.73736	0	0	10.35167	0	0	9.21307	0	0	13.90054	11.7874	0	0	0	0	0	0	0	0	0	0	0	0	0	10.17426	0	13.22548	0	0	0	0	0	12.22291	9.695502	0	0	0	0	0	0
I3KVC4	I3KVC4_ORENI		microtubule-based movement [GO:0007018]	"Dynein, axonemal, heavy chain 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; microtubule [GO:0005874]	"cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; microtubule [GO:0005874]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]; microtubule-based movement [GO:0007018]"	"ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]"	HSSMLVGKTGSAK	3.359999895	1302.353678	12.1908	10.83939	14.11966	12.77963	12.36994	0	0	0	12.28084	11.02719	0	0	0	0	0	0	0	0	9.754629	0	0	13.11224	0	17.31346	0	16.80474	0	12.65572	0	0	12.59961	0	13.07494	5.916614	16.32781	0	12.69038	13.48365	13.86238	0	14.26254	0	0	13.01277	0	11.01689	9.952611	9.701143	0	0	0	15.55227	0	0
I3KQK5	I3KQK5_ORENI		microtubule-based movement [GO:0007018]	"Dynein, axonemal, heavy chain 5 like"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; microtubule [GO:0005874]	"cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; microtubule [GO:0005874]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]; microtubule-based movement [GO:0007018]"	"ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]"	ISMSPCCK	6.179999828	997.7778134	13.09946	10.77428	13.80533	13.55982	0	14.97205	12.81343	13.88853	12.22231	15.31318	12.61712	16.96628	12.62006	13.18234	14.73957	14.10091	0	12.20159	0	0	12.56232	0	14.05413	13.3178	0	10.41373	15.12149	0	13.79337	13.77969	14.83221	16.91771	15.00576	14.33272	13.89574	11.90215	13.07899	13.86336	14.31812	14.53293	14.18281	13.02621	15.3554	10.47322	13.4139	12.25681	0	11.93341	13.9116	0	13.52019	13.04122	0	0
I3JVV3	I3JVV3_ORENI		epithelial cilium movement involved in extracellular fluid movement [GO:0003351]	"Dynein, axonemal, heavy polypeptide 9 like"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; extracellular region [GO:0005576]; microtubule [GO:0005874]	"cilium [GO:0005929]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; extracellular region [GO:0005576]; microtubule [GO:0005874]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]; epithelial cilium movement involved in extracellular fluid movement [GO:0003351]"	"ATP binding [GO:0005524]; ATP-dependent microtubule motor activity, minus-end-directed [GO:0008569]"	ISNVEAIQALMGK	6.150000095	1389.517069	12.56794	0	11.70947	10.62481	0	10.60199	12.25075	9.762003	0	0	12.83985	0	0	0	0	12.99879	0	0	10.41211	17.96709	13.42577	0	14.94326	0	0	14.60657	12.83263	0	0	0	0	0	0	0	0	0	0	0	0	10.18524	10.35024	11.34458	9.227141	12.8199	12.62344	11.13371	0	11.78805	0	0	0	0	0	13.71155
A0A669D6E9	A0A669D6E9_ORENI	DST	intermediate filament cytoskeleton organization [GO:0045104]	Dystonin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell projection [GO:0042995]; cytoplasm [GO:0005737]; membrane [GO:0016020]; microtubule [GO:0005874]	cell projection [GO:0042995]; cytoplasm [GO:0005737]; membrane [GO:0016020]; microtubule [GO:0005874]; actin binding [GO:0003779]; calcium ion binding [GO:0005509]; microtubule binding [GO:0008017]; intermediate filament cytoskeleton organization [GO:0045104]	actin binding [GO:0003779]; calcium ion binding [GO:0005509]; microtubule binding [GO:0008017]	AEMAEYAGDLEK	9.920000076	1341.531085	12.25143	11.35562	0	14.11354	13.91963	0	11.66345	0	0	15.33173	14.79348	0	0	15.79205	12.46293	7.901571	0	9.239894	0	12.67193	0	0	14.04565	0	13.15264	13.66787	13.17938	0	0	13.21283	17.67455	15.40425	15.11502	15.19352	12.13117	0	14.78739	0	14.27162	7.155947	14.2923	0	14.87415	10.67409	13.08789	0	14.30492	13.19388	15.01406	0	0	14.14202	14.93317	15.00839
A0A669B4K1	A0A669B4K1_ORENI	LOC100703700		Dystrobrevin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	AMLATMCGGKIVDK	8.069999695	1511.637815	15.98797	14.73652	14.37115	15.56248	15.15115	0	0	0	0	13.18878	11.9481	0	0	0	0	16.7314	0	0	13.42777	0	0	0	0	12.28068	0	0	0	0	15.71523	13.39553	16.04996	0	0	0	15.79477	13.4075	0	0	14.35627	0	0	14.11636	0	0	0	15.91371	0	0	12.78558	13.97303	0	0	0	0
A0A669CCN1	A0A669CCN1_ORENI	ufl1	protein ufmylation [GO:0071569]	E3 UFM1-protein ligase 1 (E3 UFM1-protein transferase 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]	endoplasmic reticulum membrane [GO:0005789]; UFM1 ligase activity [GO:0061666]; protein ufmylation [GO:0071569]	UFM1 ligase activity [GO:0061666]	QASILTESTAPSK	9.850000381	1331.375275	13.77137	13.9796	14.33143	13.04837	13.40964	12.16259	9.881576	0	13.02638	0	9.466042	10.76218	14.21435	13.61743	15.09406	11.53381	10.95109	12.02743	12.16364	0	0	15.16814	0	0	12.92605	0	6.925433	14.47488	0	0	20.98577	21.1466	20.58985	13.10141	13.31752	15.96686	12.01785	8.796337	14.22279	12.66657	12.55398	0	9.300053	11.78893	0	12.33011	14.80608	13.60238	0	0	13.77075	0	13.77495	14.46026
I3JB88	I3JB88_ORENI	rnf20	histone monoubiquitination [GO:0010390]	E3 ubiquitin protein ligase (EC 2.3.2.27)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]; histone monoubiquitination [GO:0010390]	metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]	LLLDMYR	17.68000031	921.6564373	0	0	0	0	0	13.00653	20.05238	16.74793	15.84828	0	0	15.35209	16.70964	15.23243	0	15.75949	0	0	14.8125	17.72642	0	17.21451	0	0	0	0	0	15.29826	19.02155	16.47526	0	0	0	16.37429	0	17.08274	19.15562	17.77703	0	0	0	0	17.08735	16.13403	15.47078	0	19.08139	0	15.85946	0	18.12084	20.37947	16.12264	16.88127
A0A669CSY4	A0A669CSY4_ORENI	LOC100692645	cell surface receptor signaling pathway [GO:0007166]; regulation of signaling [GO:0023051]	E3 ubiquitin-protein ligase CBL (EC 2.3.2.7)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; aspartyltransferase activity [GO:0047690]; calcium ion binding [GO:0005509]; phosphotyrosine residue binding [GO:0001784]; ubiquitin-protein transferase activity [GO:0004842]; cell surface receptor signaling pathway [GO:0007166]; regulation of signaling [GO:0023051]	aspartyltransferase activity [GO:0047690]; calcium ion binding [GO:0005509]; phosphotyrosine residue binding [GO:0001784]; ubiquitin-protein transferase activity [GO:0004842]	GGFDLPSPGGGRGAGLIGLMK	6.070000172	1956.540119	0	17.31541	0	15.86987	16.07287	0	16.14627	15.50428	0	15.2852	0	0	15.49266	0	0	14.50546	0	14.93232	0	0	0	0	0	0	0	0	15.27266	17.27294	0	0	0	16.57146	0	13.67843	17.24643	15.84445	15.79327	14.79899	0	15.45926	16.92278	0	18.67705	15.60857	16.29138	0	15.83552	15.15474	17.66109	15.75592	17.67046	0	18.23556	17.43273
I3K279	I3K279_ORENI	LOC100692412		E3 ubiquitin-protein ligase Midline-1 (EC 2.3.2.27) (RING finger protein Midline-1) (RING-type E3 ubiquitin transferase Midline-1) (Tripartite motif-containing protein 18)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	HEWIGK	4.449999809	768.7758514	14.09994	0	10.94798	15.34938	13.42483	13.73315	15.13392	13.87573	0	0	16.38352	16.48638	16.6606	0	16.10485	17.12685	15.39584	0	0	14.22076	13.7947	16.75978	0	0	0	15.06144	15.18324	14.8013	0	15.82699	0	0	0	16.30817	16.02304	15.40607	14.21919	0	0	0	15.15265	15.37206	16.12774	15.61623	0	13.85207	9.431085	0	15.05494	0	0	0	13.21412	14.83163
A0A669B7U4	A0A669B7U4_ORENI	DTX1	Notch signaling pathway [GO:0007219]	E3 ubiquitin-protein ligase (EC 2.3.2.27)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]; Notch signaling pathway [GO:0007219]	ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]	GWSCHPAMK	2.599999905	1087.940852	14.33035	10.11682	14.0224	13.18848	0	10.87347	0	14.79308	10.18027	14.83855	10.69497	13.55349	0	0	0	0	12.87705	14.69203	11.3111	0	0	0	0	0	14.10159	0	0	0	14.26926	0	0	0	0	0	15.87412	12.9236	0	0	14.32231	15.69634	0	12.67067	0	0	0	0	13.26179	13.68924	0	0	12.40415	0	0	14.95517
A0A669B2A8	A0A669B2A8_ORENI	LOC100697163	ubiquitin-dependent protein catabolic process [GO:0006511]	E3 ubiquitin-protein ligase (EC 2.3.2.26)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ubiquitin protein ligase activity [GO:0061630]; ubiquitin-dependent protein catabolic process [GO:0006511]	ubiquitin protein ligase activity [GO:0061630]	TDSNGR	2.74000001	646.485471	13.67548	13.1804	13.05526	0	15.35981	14.33648	16.1611	12.9618	14.11365	14.64039	16.03426	15.66071	14.10568	15.18572	14.0521	15.42868	15.72793	16.05557	0	16.24732	0	17.10027	17.47109	16.67496	0	15.74642	14.08346	10.46813	14.86216	13.18349	17.22937	17.31864	0	14.33469	15.30334	0	0	0	0	15.11552	15.41225	15.85035	16.88024	15.44148	0	16.16497	15.42814	0	15.30562	17.81422	17.05868	16.35441	16.78171	0
I3J1N4	I3J1N4_ORENI			EF-hand calcium binding domain 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]	calcium ion binding [GO:0005509]	MSKISAMNK	13.53999996	1040.166126	14.89478	13.81814	15.26558	0	14.25291	15.99291	14.64613	12.52426	14.28364	0	16.48738	0	0	0	0	15.69398	15.67786	15.78762	16.13561	15.30879	17.33013	0	15.87442	15.88482	15.23024	0	15.87864	16.34488	15.03173	15.10338	15.73848	15.99235	13.15583	0	0	0	0	0	0	16.0262	0	0	15.8024	0	0	16.97986	15.62381	0	0	16.14909	17.32535	0	0	17.15932
I3JVX9	I3JVX9_ORENI	LOC100694510		EF-hand domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]	calcium ion binding [GO:0005509]; GTPase activity [GO:0003924]; GTP binding [GO:0005525]	AEEDEEEK	2.470000029	978.1041236	12.36017	14.73605	14.26818	13.798	0	15.28907	14.14768	13.61595	9.864738	13.89969	0	9.182732	14.53468	12.32357	14.96475	16.66218	14.3597	0	0	0	0	0	12.06692	0	13.66039	0	14.13226	0	10.4432	13.4903	14.24234	0	15.12093	0	0	11.03762	0	14.32241	14.72873	0	0	18.23147	0	0	12.70636	13.29279	0	13.71698	15.53109	0	0	16.16881	15.68126	0
I3KR45	I3KR45_ORENI			EFR3 homolog B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				PAVTEAPR	23.42000008	840.0391148	15.222	12.77394	14.93981	13.40518	0	16.78039	14.53928	15.83809	14.39581	16.09607	16.93412	0	14.83633	15.79244	16.22411	17.11347	0	0	17.31321	16.79445	0	0	16.49261	0	0	16.94786	0	0	0	0	0	0	0	0	0	0	15.14729	14.69912	14.64994	0	0	0	15.24277	0	14.50446	0	0	0	0	0	16.67218	0	0	0
A0A669CRI2	A0A669CRI2_ORENI	ccbe1		EGF-like domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]	calcium ion binding [GO:0005509]	QNQDPLDMGSGEDSK	11.84000015	1621.922675	0	0	0	0	15.28689	15.88475	19.08476	15.26396	17.11034	0	15.89717	0	14.22373	0	14.23953	12.60583	15.52655	15.18681	0	16.79335	17.41681	14.94765	16.09354	16.05403	15.1364	16.08945	17.03536	15.04051	16.13846	0	17.77454	17.74904	13.7118	15.60586	14.68857	0	16.4383	15.26768	15.97041	14.10873	17.32831	0	0	0	0	0	0	16.64568	18.88583	0	18.96982	20.05657	16.31057	18.34931
A0A669D5N0	A0A669D5N0_ORENI	synrg		EH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SPPSPAPEQPFR	17.86000061	1309.202442	0	10.87472	13.75499	5.151983	7.525056	0	11.96203	14.4068	0	12.28112	12.50494	0	0	12.4401	0	0	0	0	9.169992	10.21784	0	18.79846	0	12.33051	0	12.63019	0	18.83069	0	0	9.961695	0	13.59297	0	0	0	11.28535	0	0	11.36369	0	15.03765	11.17936	0	12.43923	0	0	0	12.34748	0	18.18772	0	0	0
I3JCP4	I3JCP4_ORENI		cilium assembly [GO:0060271]	EH-domain containing 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endosome membrane [GO:0010008]; plasma membrane [GO:0005886]	endosome membrane [GO:0010008]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; GTP binding [GO:0005525]; cilium assembly [GO:0060271]	ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; GTP binding [GO:0005525]	LLEAVEDMLANDIARLMAMVR	3.74000001	2389.969747	0	10.97554	12.99961	0	12.68272	0	11.95491	14.14616	0	0	0	12.55518	13.99994	12.23102	17.66428	0	12.71896	13.53977	0	14.16311	9.350108	11.09183	15.15977	0	12.25268	0	10.88243	10.01001	15.14737	0	13.41256	0	0	0	12.06182	14.01726	0	0	12.43813	0	0	10.538	12.27184	0	12.24088	11.72349	8.726269	4.700121	12.76765	0	0	0	12.46401	0
I3KAR6	I3KAR6_ORENI			ELKS/RAB6-interacting/CAST family member 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; presynaptic active zone [GO:0048786]	cytoplasm [GO:0005737]; presynaptic active zone [GO:0048786]		GTLAGEIR	8.319999695	816.2926667	14.01247	0	15.77563	0	17.51834	14.29648	16.41067	16.90483	14.91453	18.58064	15.71692	18.3825	16.27265	17.73908	15.05606	16.28723	16.43743	15.76951	16.60959	0	0	0	0	13.08287	0	0	0	17.86051	0	0	17.71317	0	0	0	0	0	0	0	0	15.15917	16.1471	15.63667	0	18.04237	17.72408	16.83282	0	0	16.98298	0	15.92028	0	0	0
I3JFN2	I3JFN2_ORENI			ELM2 and Myb/SANT-like domain containing 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		DFFLVQKLVR	1.24000001	1265.243777	15.46012	0	12.12426	12.69496	13.46262	13.55646	0	13.49404	12.72056	13.91771	0	12.18605	0	0	15.04303	14.89334	0	11.52491	13.83586	9.666966	0	12.75652	15.91535	14.51669	0	14.47573	11.37158	13.42332	15.03617	13.35829	18.4836	18.55835	18.41475	15.61846	15.62515	11.38219	14.30894	13.47042	0	0	0	0	15.00226	11.83453	13.99415	14.87922	14.80343	15.8983	0	15.21904	12.2038	13.15702	12.20219	10.62497
A0A669FCG6	A0A669FCG6_ORENI	LOC100710831	apoptotic process [GO:0006915]; cell-cell adhesion [GO:0098609]; cell migration [GO:0016477]; cytoskeleton organization [GO:0007010]; phagocytosis [GO:0006909]	ELMO domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; SH3 domain binding [GO:0017124]; apoptotic process [GO:0006915]; cell migration [GO:0016477]; cell-cell adhesion [GO:0098609]; cytoskeleton organization [GO:0007010]; phagocytosis [GO:0006909]	SH3 domain binding [GO:0017124]	QEMASSLAQK	1.75	1107.552491	12.54374	0	0	11.29112	0	12.9846	13.78347	7.416161	0	13.79661	14.03371	11.87172	14.9022	15.1522	13.2865	13.13197	0	12.41567	14.06675	12.07776	0	14.18249	0	11.28738	12.64828	9.262541	14.95257	14.85841	12.57112	7.246708	20.0931	17.13313	22.15902	0	0	0	11.16136	12.21859	0	13.05494	0	11.70241	14.20673	12.96442	0	15.12262	16.68503	0	0	12.11942	13.79618	15.08015	13.11997	14.90461
I3KE31	I3KE31_ORENI	EML6		EMAP like 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				CNPMVMDK	5	1009.398148	0	13.55724	16.50597	14.85832	13.38332	14.77901	14.71794	10.81616	15.63946	13.1514	16.43608	15.50109	0	15.1913	0	0	14.81195	14.14927	15.40485	16.39548	0	0	12.95086	0	15.71877	0	0	12.56858	14.92513	0	0	15.14884	0	14.76534	0	13.86298	0	0	15.40948	16.63281	15.35137	0	15.85924	0	15.63181	16.72449	13.68632	0	15.43086	0	0	17.11217	16.14524	15.45238
I3KEI9	I3KEI9_ORENI			EPS8 like 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]		LAFNLLAK	14.81999969	890.2315786	16.8917	11.33782	15.91269	15.46187	0	0	14.53363	0	11.53637	17.16771	16.26701	0	0	0	16.00387	17.36563	0	16.04818	0	0	17.55625	0	0	17.56452	18.08342	17.85569	0	0	0	0	0	16.76484	13.86836	16.45033	0	0	0	14.60621	0	16.22965	13.59203	0	15.94882	15.9879	15.30917	0	0	0	0	0	0	16.88906	0	0
A0A669B962	A0A669B962_ORENI	kdelr3	protein retention in ER lumen [GO:0006621]; protein transport [GO:0015031]	ER lumen protein-retaining receptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	COPI-coated vesicle membrane [GO:0030663]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	COPI-coated vesicle membrane [GO:0030663]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; ER retention sequence binding [GO:0046923]; protein retention in ER lumen [GO:0006621]; protein transport [GO:0015031]	ER retention sequence binding [GO:0046923]	GKMTLPMPV	6.159999847	988.7566934	10.64489	13.75727	14.76999	12.75009	0	11.72635	9.284008	8.207356	14.2714	13.93009	0	13.77986	14.54278	12.75295	15.34446	14.69357	0	18.95342	0	0	0	13.44755	16.53762	0	0	12.99281	11.24443	13.06485	13.63979	0	17.34355	0	0	16.40224	15.00796	11.49178	0	14.39833	9.087486	0	14.5149	6.895146	0	13.95143	13.08393	16.53682	12.53381	12.57584	11.46784	0	0	12.9053	0	0
A0A669CVE9	A0A669CVE9_ORENI			ER membrane protein complex subunit 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	EMC complex [GO:0072546]	EMC complex [GO:0072546]		LFGIDSK	5.860000134	779.2005164	17.25647	15.06608	15.69611	0	16.23955	16.91968	0	15.37963	0	0	16.83036	17.21562	16.49785	16.29315	16.24336	17.01758	15.45967	15.86161	16.86292	15.70398	16.40431	17.52461	15.45728	17.11964	17.74735	15.97371	0	0	16.78998	0	17.35354	17.11043	16.7808	15.67145	15.96318	17.22473	15.54451	16.19011	0	17.04894	16.13333	0	16.15999	0	16.58938	0	0	16.59641	0	16.75806	0	17.49251	0	0
A0A669DFN9	A0A669DFN9_ORENI	emc10		ER membrane protein complex subunit 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GALLLKPGR	8.619999886	925.158102	15.6763	0	16.32967	13.50753	0	14.72289	15.99661	14.38552	0	15.59674	16.47149	15.63426	13.80992	15.41184	13.60386	14.31756	0	13.35358	13.31009	5.412289	14.05917	11.45863	15.10042	14.82782	14.37232	0	0	0	13.48718	9.46828	13.95267	16.39749	14.15714	14.86702	15.22018	14.20458	14.18464	15.60006	14.18231	14.96855	14.10441	17.10872	15.69072	16.27028	14.02197	0	0	0	0	0	14.81796	15.27884	13.25244	13.86627
A0A669F3U8	A0A669F3U8_ORENI			ER-alpha (Estradiol receptor) (Estrogen receptor) (Nuclear receptor subfamily 3 group A member 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; estrogen receptor activity [GO:0030284]; sequence-specific DNA binding [GO:0043565]; steroid binding [GO:0005496]; zinc ion binding [GO:0008270]	DNA-binding transcription factor activity [GO:0003700]; estrogen receptor activity [GO:0030284]; sequence-specific DNA binding [GO:0043565]; steroid binding [GO:0005496]; zinc ion binding [GO:0008270]	KNILVMAILK	7.619999886	1142.365864	11.61788	0	0	12.45953	0	15.60739	0	12.01718	12.62082	14.25383	9.989146	9.740705	11.88267	0	12.83142	14.97737	13.52491	13.76613	0	0	0	0	14.44822	0	10.60136	0	15.73578	0	0	0	17.35615	0	14.16418	13.7591	13.88607	0	0	0	0	0	0	0	0	0	0	15.79015	16.76904	0	17.639	0	0	0	0	0
I3KUS9	I3KUS9_ORENI	ercc4	DNA repair [GO:0006281]	ERCC4 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; endodeoxyribonuclease activity [GO:0004520]; single-stranded DNA binding [GO:0003697]; DNA repair [GO:0006281]	endodeoxyribonuclease activity [GO:0004520]; single-stranded DNA binding [GO:0003697]	TKALVQDLK	28.79999924	1014.629002	20.08192	20.42807	18.45721	18.84244	19.52609	0	19.53234	20.70956	19.19275	17.23156	18.92813	19.83885	18.91352	14.88882	19.21258	20.39666	18.93197	15.45392	17.63929	16.85262	17.24912	17.54557	15.349	14.08513	16.33474	20.68381	15.89632	19.37573	21.04754	20.15167	20.08944	19.762	0	17.60308	0	17.35355	16.6086	15.31791	20.05149	20.07686	19.0733	15.88036	15.66787	19.95453	17.78301	20.07928	18.70372	16.8471	10.87429	17.60283	16.06183	20.4223	18.99902	0
I3KB71	I3KB71_ORENI	LOC100703163		ETS domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	LLDAEEVARLWGLR	9.340000153	1640.202474	0	17.79932	15.89256	15.46275	15.48688	18.30487	0	11.41825	17.07096	13.77278	15.41565	12.99149	15.78772	14.86644	14.598	0	14.76704	16.25953	0	0	16.18822	0	0	0	0	0	16.15951	0	18.2782	15.67115	14.23196	0	17.16847	14.94552	18.57495	17.94183	17.57913	0	18.33741	16.4909	0	15.53135	0	0	0	17.83615	18.18466	16.28687	0	15.89041	15.66202	0	0	0
A0A669DUT8	A0A669DUT8_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	EWS RNA-binding protein 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]; regulation of transcription, DNA-templated [GO:0006355]"	metal ion binding [GO:0046872]; RNA binding [GO:0003723]	GGWGGDRGGFR	2.410000086	1122.059159	15.06891	0	18.20435	13.15201	14.86196	0	18.88423	11.96703	13.14614	14.50587	0	0	0	15.97261	0	18.09038	9.529078	13.76925	19.10882	15.46442	0	15.21362	0	15.75547	13.8708	15.98846	15.84037	12.85634	13.42072	14.68565	15.80865	0	0	14.32768	0	0	14.05038	13.29526	16.31689	12.48936	13.94808	15.41364	16.13297	15.79451	0	14.89078	14.77259	13.70513	15.63142	15.23675	15.63311	0	0	0
I3J8A4	I3J8A4_ORENI	LOC100689762	protein ubiquitination [GO:0016567]; regulation of translational initiation [GO:0006446]	Ectoderm-neural cortex protein 2 (Kelch-like protein 25)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Cul3-RING ubiquitin ligase complex [GO:0031463]	Cul3-RING ubiquitin ligase complex [GO:0031463]; protein ubiquitination [GO:0016567]; regulation of translational initiation [GO:0006446]		DAAAEFLEKNLHASNCLGMMLLSDAHQCK	5.110000134	3305.923439	6.520509	10.50493	8.344771	9.331179	0	12.2704	0	11.46245	14.86255	13.6314	8.991982	0	13.65144	13.84309	13.48976	10.65871	13.96745	13.09894	13.91315	12.42171	0	13.86841	12.0719	0	15.29941	12.07329	18.72716	0	0	14.17473	0	0	0	12.46629	0	0	12.88941	0	0	10.23037	0	0	0	12.34519	0	11.31372	0	13.93083	0	14.08698	0	13.33616	13.21271	14.10837
A0A669CPT5	A0A669CPT5_ORENI			Ectonucleotide pyrophosphatase/phosphodiesterase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]; nucleic acid binding [GO:0003676]	hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]; nucleic acid binding [GO:0003676]	SFIMPHRPDHTESCASGTDLK	4.179999828	2401.493792	11.43478	9.189023	0	12.20501	13.24586	0	13.18337	0	14.44804	0	8.037173	13.21307	13.67866	11.59403	9.891471	12.38952	7.61359	11.36931	19.20446	0	15.82783	0	0	7.936642	12.4572	13.51421	0	10.70504	12.15348	14.03826	0	14.33083	12.85968	13.52626	0	0	11.47727	12.46809	12.74031	0	0	9.574338	0	0	0	6.192616	0	0	0	0	0	0	13.79383	0
A0A669DKZ1	A0A669DKZ1_ORENI		chemotaxis [GO:0006935]; immune response [GO:0006955]; regulation of angiogenesis [GO:0045765]; regulation of cell migration [GO:0030334]	Ectonucleotide pyrophosphatase/phosphodiesterase 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; lysophospholipase activity [GO:0004622]; metal ion binding [GO:0046872]; nucleic acid binding [GO:0003676]; nucleotide diphosphatase activity [GO:0004551]; phosphodiesterase I activity [GO:0004528]; polysaccharide binding [GO:0030247]; scavenger receptor activity [GO:0005044]; chemotaxis [GO:0006935]; immune response [GO:0006955]; regulation of angiogenesis [GO:0045765]; regulation of cell migration [GO:0030334]	lysophospholipase activity [GO:0004622]; metal ion binding [GO:0046872]; nucleic acid binding [GO:0003676]; nucleotide diphosphatase activity [GO:0004551]; phosphodiesterase I activity [GO:0004528]; polysaccharide binding [GO:0030247]; scavenger receptor activity [GO:0005044]	IEDVHLLVDR	8.550000191	1209.642284	0	0	13.39008	0	13.51474	0	14.08076	0	13.82959	14.02811	10.78857	0	0	15.02488	8.535131	0	16.15719	0	0	12.8173	12.95161	14.71737	0	12.44751	14.00917	0	0	0	0	14.89278	0	0	17.43858	16.13807	15.14459	0	13.29766	0	0	12.12609	0	0	8.253672	0	14.69098	0	15.092	0	13.9068	0	14.6835	0	12.91356	15.2692
A0A669BBR3	A0A669BBR3_ORENI	tufm		Elongation factor Tu	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]; GTPase activity [GO:0003924]; translation elongation factor activity [GO:0003746]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]; translation elongation factor activity [GO:0003746]	GQRFTLR	5.579999924	877.741089	18.07188	16.72388	14.4042	0	15.98347	16.66951	15.5025	16.08652	14.93837	0	14.71502	16.44341	12.48309	14.05206	16.74257	0	15.06798	0	0	15.1309	0	0	0	0	0	0	0	0	0	17.16906	0	0	0	0	0	0	0	0	0	0	14.92872	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669EK95	A0A669EK95_ORENI			Elongation factor like GTPase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	LPSPLEMAAER	3.380000114	1213.843037	9.405171	12.3125	8.254369	12.03934	0	16.64231	0	8.686279	0	14.07102	12.5367	0	0	13.13521	0	0	0	15.84821	10.61058	0	10.89484	14.7873	0	0	15.53586	14.12545	17.86521	11.4296	0	12.91883	14.58209	14.84865	0	12.84124	0	0	16.12982	9.093323	12.08805	0	14.25323	0	0	10.07527	13.01729	0	12.45208	0	11.99813	0	0	0	0	0
A0A669EX74	A0A669EX74_ORENI	ELOVL1	"fatty acid elongation, monounsaturated fatty acid [GO:0034625]; fatty acid elongation, saturated fatty acid [GO:0019367]; long-chain fatty-acyl-CoA biosynthetic process [GO:0035338]; unsaturated fatty acid biosynthetic process [GO:0006636]; very long-chain fatty acid biosynthetic process [GO:0042761]"	Elongation of very long chain fatty acids protein 1 (EC 2.3.1.199) (3-keto acyl-CoA synthase ELOVL1) (ELOVL fatty acid elongase 1) (ELOVL FA elongase 1) (Very long chain 3-ketoacyl-CoA synthase 1) (Very long chain 3-oxoacyl-CoA synthase 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	"endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; 3-oxo-arachidoyl-CoA synthase activity [GO:0102336]; 3-oxo-cerotoyl-CoA synthase activity [GO:0102337]; 3-oxo-lignoceronyl-CoA synthase activity [GO:0102338]; fatty acid elongase activity [GO:0009922]; very-long-chain 3-ketoacyl-CoA synthase activity [GO:0102756]; fatty acid elongation, monounsaturated fatty acid [GO:0034625]; fatty acid elongation, saturated fatty acid [GO:0019367]; long-chain fatty-acyl-CoA biosynthetic process [GO:0035338]; unsaturated fatty acid biosynthetic process [GO:0006636]; very long-chain fatty acid biosynthetic process [GO:0042761]"	3-oxo-arachidoyl-CoA synthase activity [GO:0102336]; 3-oxo-cerotoyl-CoA synthase activity [GO:0102337]; 3-oxo-lignoceronyl-CoA synthase activity [GO:0102338]; fatty acid elongase activity [GO:0009922]; very-long-chain 3-ketoacyl-CoA synthase activity [GO:0102756]	MLQEIQEMGSHAK	10.38000011	1528.713734	14.75117	15.44739	17.03204	0	15.49268	13.78795	15.60062	15.50226	16.08935	16.60471	15.17934	16.69184	14.28696	14.93048	0	0	0	0	0	0	0	0	0	16.91937	0	0	0	0	0	0	16.15463	0	14.83932	0	0	0	0	0	0	15.89919	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3IWZ6	I3IWZ6_ORENI	LOC100696514	actin nucleation [GO:0045010]; actin polymerization or depolymerization [GO:0008154]; protein homotetramerization [GO:0051289]	Ena/VASP-like protein (Ena/vasodilator-stimulated phosphoprotein-like)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; lamellipodium [GO:0030027]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; lamellipodium [GO:0030027]; actin binding [GO:0003779]; SH3 domain binding [GO:0017124]; actin nucleation [GO:0045010]; actin polymerization or depolymerization [GO:0008154]; protein homotetramerization [GO:0051289]	actin binding [GO:0003779]; SH3 domain binding [GO:0017124]	VSEQSICQARASVMVYDDTSK	5.769999981	2389.62114	0	11.05105	8.980274	10.92947	0	10.82453	11.8372	0	12.47692	0	0	14.49289	13.83623	12.04661	13.52794	13.4208	14.04813	13.44189	0	17.96552	0	12.18097	0	17.95469	13.27498	14.3361	8.50785	0	14.72176	10.62945	11.87599	10.77781	7.515145	14.23369	14.44397	0	9.123963	12.40342	12.88146	14.2052	12.14999	0	11.55721	0	0	0	0	14.00955	0	14.17266	0	13.20323	12.91707	11.59502
I3KN98	I3KN98_ORENI	LOC100702570	DNA catabolic process [GO:0006308]	Endo/exonuclease/phosphatase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		deoxyribonuclease activity [GO:0004536]; endonuclease activity [GO:0004519]; DNA catabolic process [GO:0006308]	deoxyribonuclease activity [GO:0004536]; endonuclease activity [GO:0004519]	MSLSLLLLLALLVDVTDTKAGSDFR	19.54999924	2706.764208	12.75055	0	10.26111	7.977839	0	14.29517	0	0	6.471235	13.92686	14.31522	11.41153	12.896	0	4.159477	0	10.41852	0	12.85102	0	0	14.26781	15.12739	0	12.22076	8.071733	13.76874	11.77218	0	0	0	14.23662	9.866069	10.90157	11.53941	12.79429	13.87396	12.28665	0	10.98745	12.14721	0	13.38677	13.40433	0	13.26128	13.49722	0	6.122823	12.75215	13.5173	9.124069	13.00437	0
I3KMH6	I3KMH6_ORENI	NTHL1	"base-excision repair, AP site formation [GO:0006285]"	Endonuclease III-like protein 1 (EC 3.2.2.-) (EC 4.2.99.18) (Bifunctional DNA N-glycosylase/DNA-(apurinic or apyrimidinic site) lyase) (DNA glycosylase/AP lyase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]; nucleus [GO:0005634]	"mitochondrion [GO:0005739]; nucleus [GO:0005634]; 4 iron, 4 sulfur cluster binding [GO:0051539]; class I DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0140078]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; oxidized pyrimidine nucleobase lesion DNA N-glycosylase activity [GO:0000703]; base-excision repair, AP site formation [GO:0006285]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; class I DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0140078]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; oxidized pyrimidine nucleobase lesion DNA N-glycosylase activity [GO:0000703]"	ATKNPEETR	2.869999886	1045.953842	15.18719	0	0	14.4483	0	15.24518	0	0	0	0	0	0	0	13.18185	0	13.30995	13.86382	0	0	0	14.25738	0	0	15.63815	0	13.23073	14.15247	14.14078	13.55454	0	17.94076	0	0	12.90588	0	0	0	13.46159	0	0	0	0	0	0	0	0	0	0	14.43412	0	0	0	0	13.84947
A0A669B774	A0A669B774_ORENI	bcap29	endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; intracellular protein transport [GO:0006886]; protein localization to endoplasmic reticulum exit site [GO:0070973]	Endoplasmic reticulum transmembrane protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; intracellular protein transport [GO:0006886]; protein localization to endoplasmic reticulum exit site [GO:0070973]		SQSEADVMK	3.75	1009.524277	13.1724	13.67814	13.05387	10.89811	14.58193	12.32418	13.5716	13.65285	0	15.63321	14.38854	13.43924	0	10.14667	13.89081	12.08098	12.05545	11.50031	11.8868	14.30571	0	0	14.66871	13.3049	13.69366	13.79908	17.7047	0	0	12.03086	0	10.69247	15.45993	0	0	12.80122	10.22073	12.87159	13.44952	0	0	0	0	13.31673	12.55417	12.95456	11.22517	9.864487	0	14.48488	11.43821	12.80699	14.38689	13.80927
A0A669CQ96	A0A669CQ96_ORENI	LOC102081144	mRNA processing [GO:0006397]	Endoribonuclease	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; ribonuclease activity [GO:0004540]; mRNA processing [GO:0006397]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; ribonuclease activity [GO:0004540]	TVAPFVNAK	14.30000019	947.508366	0	12.39315	14.17353	12.45662	13.54806	13.01903	0	0	0	0	0	13.27366	12.59153	14.65424	13.33447	13.87291	12.00594	10.74374	0	14.26182	12.47384	14.33604	13.90958	16.00565	13.49696	14.63441	12.43555	12.10747	12.85209	12.10909	14.19523	7.399833	13.60759	12.65762	12.13587	10.95994	0	0	7.468053	13.3053	10.06436	14.8347	12.48839	13.2382	11.93366	12.80247	14.22388	0	0	0	11.37717	12.90778	0	15.09854
A0A669CFE6	A0A669CFE6_ORENI	ece1		Endothelin-converting enzyme 1 (EC 3.4.24.71)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	SLLNNYMMMK	1.50999999	1260.673585	11.89616	10.50358	12.13964	0	10.75971	11.54013	12.26902	11.93218	0	11.94616	0	12.34983	12.67105	11.70226	18.38735	0	0	13.94814	12.32609	14.67056	11.14476	10.73671	11.65755	0	0	0	13.49822	0	0	0	0	0	11.88563	0	0	6.235888	0	17.43544	0	0	11.59888	0	12.25761	0	0	0	14.22179	0	13.64748	0	12.54447	11.78256	0	12.31834
A0A669EP15	A0A669EP15_ORENI	edc4		Enhancer of mRNA-decapping protein 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	P-body [GO:0000932]	P-body [GO:0000932]		DVTQCR	17.69000053	776.9014428	0	0	15.31554	0	12.42317	0	0	0	0	0	0	16.54827	15.0228	0	0	0	0	15.98693	19.40735	0	0	0	15.75516	0	0	0	0	0	0	15.26549	0	16.37667	0	0	0	0	0	0	0	16.36824	0	0	0	0	0	0	0	0	0	0	0	18.72979	0	0
A0A669CYH8	A0A669CYH8_ORENI	enkur		Enkurin domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				IIYIPK	3.039999962	746.1072	13.63336	0	11.5709	14.61517	13.31192	13.32535	14.75712	9.132176	14.96975	13.69007	0	15.42423	13.01295	14.89148	0	14.54507	14.21376	13.63748	0	14.0162	13.24496	14.70064	13.15278	16.37884	14.15917	0	14.36976	15.33713	7.571364	0	15.98706	16.34677	21.31101	16.67666	0	15.80407	15.2797	9.554695	13.38721	0	13.96267	12.8138	0	0	0	0	14.13001	0	0	15.06939	13.68396	14.99446	0	0
A0A669ESZ0	A0A669ESZ0_ORENI	LOC100703423	fatty acid beta-oxidation [GO:0006635]	Enoyl-CoA hydratase (EC 4.2.1.17)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial fatty acid beta-oxidation multienzyme complex [GO:0016507]	mitochondrial fatty acid beta-oxidation multienzyme complex [GO:0016507]; 3-hydroxyacyl-CoA dehydrogenase activity [GO:0003857]; enoyl-CoA hydratase activity [GO:0004300]; NAD+ binding [GO:0070403]; fatty acid beta-oxidation [GO:0006635]	3-hydroxyacyl-CoA dehydrogenase activity [GO:0003857]; enoyl-CoA hydratase activity [GO:0004300]; NAD+ binding [GO:0070403]	GLYPAPLK	6.099999905	856.7665803	0	14.80334	15.27699	0	14.88282	0	15.59255	15.10685	15.76546	16.21399	12.94036	16.2088	0	17.15169	14.54012	16.19871	14.98592	14.5927	16.48899	15.42605	0	13.4399	17.52742	0	17.34904	16.67025	16.29531	17.02358	15.89193	0	16.75552	16.58915	0	0	0	0	0	0	0	0	0	16.36736	0	0	0	0	0	0	0	0	16.46981	0	16.27735	0
A0A669F0L3	A0A669F0L3_ORENI	EPX	defense response [GO:0006952]; response to oxidative stress [GO:0006979]	Eosinophil peroxidase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		heme binding [GO:0020037]; peroxidase activity [GO:0004601]; defense response [GO:0006952]; response to oxidative stress [GO:0006979]	heme binding [GO:0020037]; peroxidase activity [GO:0004601]	EGGEFMM	12.86999989	815.7332885	16.27461	12.05321	13.03807	0	14.59943	12.23988	14.49355	13.72653	14.12277	15.81187	11.36681	14.30199	14.2162	14.98276	13.67067	14.75872	15.53937	15.14885	0	0	0	0	0	0	0	16.26083	15.47887	14.21552	14.24223	0	17.20646	0	0	13.91834	0	0	0	0	15.41463	16.67127	15.86985	0	0	0	0	0	0	0	14.5667	14.70688	16.15655	0	14.88563	0
A0A669AX34	A0A669AX34_ORENI	LOC100708995	ephrin receptor signaling pathway [GO:0048013]	Ephrin RBD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	anchored component of membrane [GO:0031225]	anchored component of membrane [GO:0031225]; ephrin receptor binding [GO:0046875]; ephrin receptor signaling pathway [GO:0048013]	ephrin receptor binding [GO:0046875]	TCNTQK	13.69999981	751.4451615	16.57082	16.90036	16.94773	17.32276	17.99562	17.70768	18.30784	19.17051	18.46214	19.2538	19.12899	19.27786	16.90707	18.54176	18.20236	20.35841	20.94032	20.11403	19.12863	19.70332	19.15216	19.64504	20.61771	20.2282	18.44377	20.12495	20.18906	18.99283	18.64826	18.85558	18.00232	18.06058	16.06727	18.3128	18.944	17.18131	17.25023	15.75333	16.99628	17.69392	18.86515	17.17995	17.89634	18.48077	0	17.0703	16.97927	16.90342	18.46314	17.68687	18.35397	18.62243	20.25797	20.00191
A0A669DRG0	A0A669DRG0_ORENI	gne	UDP-N-acetylglucosamine metabolic process [GO:0006047]	Epimerase_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]; UDP-N-acetylglucosamine metabolic process [GO:0006047]"	"hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]"	VEGMDMK	8.069999695	809.5039491	15.2062	14.68822	14.45494	14.15856	13.90717	15.51162	13.81509	14.24089	14.63992	14.24771	0	13.40623	13.52568	13.76241	14.72374	14.84862	14.50604	15.09328	14.31378	10.37549	14.27052	12.75708	14.91067	13.27945	14.72805	11.62353	14.65316	14.66388	12.71484	15.51728	14.80603	13.51111	16.41734	14.97311	13.03594	15.92457	15.52857	16.22412	15.03994	16.69306	14.69226	14.38505	15.54852	12.54041	12.67483	14.94641	0	15.15794	15.09821	15.67107	14.49155	13.76566	0	13.46424
A0A669EMH9	A0A669EMH9_ORENI		intermediate filament cytoskeleton organization [GO:0045104]	Epiplakin 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; intermediate filament cytoskeleton organization [GO:0045104]		DPYTGETISLFQALK	2.799999952	1683.580441	11.83047	11.66593	12.79194	10.27106	12.73401	13.49954	13.75758	14.95076	9.520002	14.639	14.71573	11.89497	9.195761	15.39258	15.76272	10.27642	0	10.18889	13.92553	0	16.5684	12.152	15.01489	14.26554	0	0	0	0	12.06469	0	0	16.22212	15.5031	12.29782	0	0	11.77744	11.93517	14.67485	12.44865	13.92243	0	12.45335	0	13.75279	14.2022	0	0	10.63433	0	13.47727	0	0	14.152
A0A669F5M8	A0A669F5M8_ORENI	LOC100711364	aromatic compound catabolic process [GO:0019439]; response to toxic substance [GO:0009636]	Epoxide hydrolase (EC 3.3.2.9)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]	endoplasmic reticulum membrane [GO:0005789]; cis-stilbene-oxide hydrolase activity [GO:0033961]; aromatic compound catabolic process [GO:0019439]; response to toxic substance [GO:0009636]	cis-stilbene-oxide hydrolase activity [GO:0033961]	QVAVLNK	11.71000004	771.5433653	16.01287	0	17.4261	16.55396	17.25366	15.72531	16.05649	16.57957	15.73248	16.0422	18.41389	15.79757	16.72323	16.37588	16.89531	16.64583	17.4616	15.88982	16.95051	18.19553	17.07327	16.60804	18.08916	17.83956	18.76914	16.78674	17.59219	17.85241	18.02726	19.87314	19.71203	16.89857	18.71388	18.43335	18.22677	17.152	17.9985	18.47911	18.28002	19.90439	16.05041	17.30896	18.25424	17.791	18.72449	17.21885	17.43562	17.51511	17.59413	17.32314	16.56877	16.81248	18.43863	16.11907
A0A669CZC0	A0A669CZC0_ORENI			Erythrocyte membrane protein band 4.1 like 4B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]	cytoskeleton [GO:0005856]		VYLCSAL	17.18000031	824.6194699	15.79784	0	0	12.39126	0	0	0	15.76173	14.59654	15.83049	16.3659	0	18.76972	15.32772	0	0	0	0	17.04966	17.70792	0	15.04142	18.20387	0	0	0	16.13132	0	10.85032	15.5016	17.99623	18.10339	17.67028	16.03259	14.50337	0	15.43806	16.28743	0	0	16.64724	15.97707	16.14546	15.60492	14.7654	14.23081	16.7386	0	0	0	0	0	15.44928	17.9664
I3JMN3	I3JMN3_ORENI	LOC100706201		Erythropoietin receptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane signaling receptor activity [GO:0004888]	transmembrane signaling receptor activity [GO:0004888]	AGSTLQDAR	11.05000019	917.1516308	13.87031	10.66524	13.23843	14.23052	10.6498	15.18149	15.59201	14.65376	11.63612	11.72879	13.03889	13.94586	9.897929	15.88128	12.57922	11.06349	0	13.99113	15.08961	11.11858	8.247323	15.70642	10.95668	13.76148	10.27798	0	14.53097	12.73836	0	14.80149	0	13.46513	9.601141	12.97822	12.43957	12.85232	12.02009	12.36021	10.86776	15.85689	14.25903	12.21389	11.83291	0	15.05313	0	11.65061	0	16.02143	14.99301	0	12.57328	14.8708	7.224126
I3KUG7	I3KUG7_ORENI	LOC100697652		Essential for reactive oxygen species protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]		GYMTVEDQSSNLLHLK	6.010000229	1834.641109	0	13.80061	11.88398	14.82723	14.18255	11.9094	0	13.48429	0	0	0	15.35435	14.81224	3.9524	13.87236	14.31177	0	15.04746	0	0	14.72981	0	11.10578	0	0	0	0	15.29095	0	0	0	0	0	13.64069	8.580617	0	0	0	10.86776	0	14.82559	12.82286	0	13.93275	15.06796	14.54319	0	0	14.06919	11.07077	0	0	14.49349	0
A0A669D6U6	A0A669D6U6_ORENI	LOC102075990	regulation of ion transmembrane transport [GO:0034765]	Ether-a-go-go-related gene potassium channel 1 (Potassium voltage-gated channel subfamily H member 2) (Voltage-gated potassium channel subunit Kv11.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; voltage-gated potassium channel activity [GO:0005249]; regulation of ion transmembrane transport [GO:0034765]	voltage-gated potassium channel activity [GO:0005249]	TQAEFPLSKPG	17.12000084	1170.133866	14.95028	0	0	0	0	0	0	14.43893	0	15.77075	0	0	0	0	0	0	14.85133	0	17.34128	17.67336	0	0	0	0	0	15.21181	0	16.07171	0	0	17.57702	0	0	16.7712	15.29106	15.34127	14.32829	16.85773	0	16.46178	15.95283	16.40513	16.9512	16.08793	16.67157	0	17.58198	17.35299	17.47021	17.71335	0	17.69209	14.6056	17.86045
A0A669FC80	A0A669FC80_ORENI	eef2k		Eukaryotic elongation factor 2 kinase (EC 2.7.11.20)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516]; elongation factor-2 kinase activity [GO:0004686]	ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516]; elongation factor-2 kinase activity [GO:0004686]	YRYNAVTGEWVQDQIHMK	4.730000019	2252.880598	0	0	0	0	15.60441	0	15.00164	15.26211	17.79082	15.31065	16.7301	14.64261	16.96554	0	13.34242	16.04686	0	14.23182	0	0	0	0	18.39679	0	0	15.80081	0	0	0	0	0	0	15.14371	0	0	0	0	14.33362	0	15.49547	0	0	0	13.11463	0	0	15.49158	17.05664	16.19754	0	0	0	0	0
A0A669D4U9	A0A669D4U9_ORENI		formation of translation preinitiation complex [GO:0001731]	Eukaryotic translation initiation factor 2D (Ligatin)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; translation initiation factor activity [GO:0003743]; formation of translation preinitiation complex [GO:0001731]	translation initiation factor activity [GO:0003743]	LEPLFLNANK	7.840000153	1157.718646	13.06893	13.03863	12.74803	0	14.20592	13.12299	13.43732	14.02308	14.34056	15.29598	11.42903	0	0	13.28693	13.74154	12.06668	12.0876	0	14.08201	12.94654	0	8.731885	19.0718	14.24147	13.17007	17.66131	0	0	11.00961	14.0461	14.82731	15.15124	10.42378	15.3156	12.62529	8.395919	13.95108	13.09878	0	12.22676	12.99397	12.32863	0	13.90212	13.66301	14.46295	2.384244	11.34491	0	0	13.16745	11.26251	0	12.88285
I3JVW1	I3JVW1_ORENI	eif3a EIF3A EIF3S10	formation of cytoplasmic translation initiation complex [GO:0001732]	Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 subunit 10) (eIF-3-theta)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; translation initiation factor activity [GO:0003743]; formation of cytoplasmic translation initiation complex [GO:0001732]	translation initiation factor activity [GO:0003743]	GLDDDRGPR	7.800000191	999.7733404	11.98463	14.99763	11.63558	13.58037	11.88433	11.49291	0	13.81206	14.42088	17.64067	12.79654	14.48221	0	0	14.27286	0	10.98589	14.63891	12.77686	0	14.27336	0	0	14.68704	14.30891	9.881348	0	13.24554	13.27373	13.29551	0	13.52343	0	14.3621	12.16962	13.50503	13.11787	0	13.69761	13.48709	15.07677	14.58621	13.68577	0	10.84489	10.47568	0	12.30744	13.31726	13.74898	0	14.2634	13.32381	12.76935
I3J5H9	I3J5H9_ORENI	eif3b EIF3B EIF3S9	formation of cytoplasmic translation initiation complex [GO:0001732]	Eukaryotic translation initiation factor 3 subunit B (eIF3b) (Eukaryotic translation initiation factor 3 subunit 9) (eIF-3-eta)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; translation initiation factor activity [GO:0003743]; translation initiation factor binding [GO:0031369]; formation of cytoplasmic translation initiation complex [GO:0001732]	translation initiation factor activity [GO:0003743]; translation initiation factor binding [GO:0031369]	QPFKDFGNMR	9	1255.434495	12.60252	14.15883	0	15.5257	14.82198	14.95539	0	15.37874	0	15.98419	0	14.00169	0	16.45396	0	0	0	0	0	14.88562	15.56199	0	0	0	0	16.91214	17.72843	0	0	18.25525	0	0	15.8232	17.31277	0	0	0	0	0	0	15.60752	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DT35	A0A669DT35_ORENI	EIF3C EIF3S8	formation of cytoplasmic translation initiation complex [GO:0001732]	Eukaryotic translation initiation factor 3 subunit C (eIF3c) (Eukaryotic translation initiation factor 3 subunit 8)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; translation initiation factor activity [GO:0003743]; translation initiation factor binding [GO:0031369]; formation of cytoplasmic translation initiation complex [GO:0001732]	translation initiation factor activity [GO:0003743]; translation initiation factor binding [GO:0031369]	GKFTMFSQYFGIK	4.170000076	1565.628746	12.41746	12.16456	14.23017	14.45978	0	0	0	0	15.02292	11.91956	12.6899	0	0	0	13.88177	0	0	0	0	12.25943	13.14681	15.17484	0	13.06804	0	0	14.08344	11.35548	14.21393	13.72541	15.54763	0	13.89523	11.95799	14.22108	0	15.15292	12.56639	0	13.20609	13.56964	12.8161	0	0	0	0	14.99685	11.99226	12.7917	0	0	0	0	13.81192
A0A669E3U3	A0A669E3U3_ORENI	EIF3G EIF3S4	formation of cytoplasmic translation initiation complex [GO:0001732]	Eukaryotic translation initiation factor 3 subunit G (eIF3g) (Eukaryotic translation initiation factor 3 RNA-binding subunit) (eIF-3 RNA-binding subunit) (Eukaryotic translation initiation factor 3 subunit 4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; translation initiation factor activity [GO:0003743]; formation of cytoplasmic translation initiation complex [GO:0001732]	translation initiation factor activity [GO:0003743]	EPIMSFTVSR	3.569999933	1165.937103	0	0	0	18.42775	17.09453	16.66602	17.25058	0	0	15.48579	15.84998	17.02207	0	0	0	0	0	0	17.28695	0	17.46187	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669BGG7	A0A669BGG7_ORENI	eif3h EIF3H EIF3S3	formation of cytoplasmic translation initiation complex [GO:0001732]	Eukaryotic translation initiation factor 3 subunit H (eIF3h) (Eukaryotic translation initiation factor 3 subunit 3) (eIF-3 gamma) (eIF3 p40 subunit)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; isopeptidase activity [GO:0070122]; metallopeptidase activity [GO:0008237]; translation initiation factor activity [GO:0003743]; formation of cytoplasmic translation initiation complex [GO:0001732]	isopeptidase activity [GO:0070122]; metallopeptidase activity [GO:0008237]; translation initiation factor activity [GO:0003743]	VDDMSQDIVK	6.5	1150.276804	16.67335	0	15.2722	18.0277	12.56771	11.94466	0	16.01653	15.02761	0	14.02048	13.81833	12.89752	16.01008	0	0	14.85974	0	11.82785	13.83418	14.13505	0	0	0	0	0	0	0	0	14.39501	0	0	14.55098	15.04907	0	0	0	16.05917	13.72433	0	0	0	0	14.94656	15.13576	0	0	14.2836	0	0	0	0	0	0
A0A669DD13	A0A669DD13_ORENI	EIF3K EIF3S12	formation of cytoplasmic translation initiation complex [GO:0001732]; regulation of translational initiation [GO:0006446]	Eukaryotic translation initiation factor 3 subunit K (eIF3k) (Eukaryotic translation initiation factor 3 subunit 12) (eIF-3 p25)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; nucleus [GO:0005634]	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; nucleus [GO:0005634]; ribosome binding [GO:0043022]; translation initiation factor activity [GO:0003743]; formation of cytoplasmic translation initiation complex [GO:0001732]; regulation of translational initiation [GO:0006446]	ribosome binding [GO:0043022]; translation initiation factor activity [GO:0003743]	KYTQVK	8.239999771	767.4371655	0	13.73216	14.74215	15.05837	14.01505	13.78394	15.77887	13.58049	14.04214	14.51569	15.68278	15.17127	14.51621	0	14.21306	13.31566	14.71118	0	12.39207	0	0	15.04067	14.29535	13.69626	0	11.85898	14.60847	0	15.40067	14.73598	13.55802	0	19.8142	15.52328	0	16.14742	13.78413	13.67287	15.14723	14.76513	15.23168	14.43659	15.24034	15.80838	15.59088	14.89368	0	14.81602	14.62091	16.04561	14.03022	14.33127	14.13806	14.64762
I3JVH2	I3JVH2_ORENI	eif3l EIF3EIP EIF3L EIF3S6IP	formation of cytoplasmic translation initiation complex [GO:0001732]	Eukaryotic translation initiation factor 3 subunit L (eIF3l) (Eukaryotic translation initiation factor 3 subunit 6-interacting protein) (Eukaryotic translation initiation factor 3 subunit E-interacting protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; translation initiation factor activity [GO:0003743]; formation of cytoplasmic translation initiation complex [GO:0001732]	translation initiation factor activity [GO:0003743]	MYQYQMLRVK	2.140000105	1359.792271	13.19445	0	0	0	0	0	11.50346	12.18306	11.88978	13.48947	0	0	13.07318	9.792893	0	0	0	10.99134	0	0	0	0	13.88226	0	15.43482	13.46259	9.950675	13.52323	0	0	0	0	0	0	10.37409	11.78808	0	12.30123	0	0	11.81471	0	13.97141	0	0	11.8284	0	0	0	0	0	0	12.19959	0
A0A669BGE1	A0A669BGE1_ORENI	EIF4G1		Eukaryotic translation initiation factor 4 gamma 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		mRNA binding [GO:0003729]; translation initiation factor activity [GO:0003743]	mRNA binding [GO:0003729]; translation initiation factor activity [GO:0003743]	GPSPGMGMGIVGPR	1.399999976	1311.815627	0	13.49446	13.15722	10.92372	10.95489	13.21177	11.47631	0	0	11.67171	0	0	13.34376	8.343355	12.67858	0	15.31703	11.79661	16.33049	0	0	11.57001	13.63104	0	0	0	0	13.95737	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DUN8	A0A669DUN8_ORENI	LOC100700271	mRNA transport [GO:0051028]; positive regulation of translational elongation [GO:0045901]; positive regulation of translational termination [GO:0045905]; protein transport [GO:0015031]	Eukaryotic translation initiation factor 5A (eIF-5A)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; nuclear pore [GO:0005643]	endoplasmic reticulum membrane [GO:0005789]; nuclear pore [GO:0005643]; ribosome binding [GO:0043022]; translation elongation factor activity [GO:0003746]; mRNA transport [GO:0051028]; positive regulation of translational elongation [GO:0045901]; positive regulation of translational termination [GO:0045905]; protein transport [GO:0015031]	ribosome binding [GO:0043022]; translation elongation factor activity [GO:0003746]	RFTNGDQFMVSVLK	2.130000114	1658.867967	0	0	14.7723	0	0	14.66384	15.69531	0	14.1767	0	14.53592	14.33977	0	0	0	14.63043	14.69622	13.02208	0	0	0	0	0	0	0	14.85397	15.26678	14.10607	16.63618	15.81817	17.10341	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.89314	0	14.90968	0	18.70806	0	0	0	15.65007
A0A669DF21	A0A669DF21_ORENI			Eukaryotic translation initiation factor 5B (Translation initiation factor IF-2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]; GTPase activity [GO:0003924]; translation initiation factor activity [GO:0003743]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]; translation initiation factor activity [GO:0003743]	ASIDALK	4.570000172	716.9980042	13.59623	15.1834	15.69696	15.19028	16.32541	16.50373	15.96733	0	14.38411	15.01898	13.16226	14.58733	14.75189	14.92039	15.56726	15.58854	0	0	16.905	0	0	0	0	0	0	0	0	0	0	0	16.64364	0	0	0	0	16.8222	0	0	0	16.8628	0	17.07037	15.70659	15.93439	0	0	0	0	0	16.60258	0	0	0	0
A0A024FS29	A0A024FS29_ORENI	neu3d	lipid catabolic process [GO:0016042]	Exo-alpha-sialidase (EC 3.2.1.18)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		exo-alpha-(2->3)-sialidase activity [GO:0052794]; exo-alpha-(2->6)-sialidase activity [GO:0052795]; exo-alpha-(2->8)-sialidase activity [GO:0052796]; lipid catabolic process [GO:0016042]	exo-alpha-(2->3)-sialidase activity [GO:0052794]; exo-alpha-(2->6)-sialidase activity [GO:0052795]; exo-alpha-(2->8)-sialidase activity [GO:0052796]	GCGHSATAHLQK	1.899999976	1266.514303	13.89721	0	0	0	0	0	15.6716	11.65093	4.240036	12.95222	0	0	11.5259	13.98048	14.57041	0	0	0	0	14.07561	0	0	0	9.399088	0	0	0	14.00494	0	0	13.93408	0	0	0	0	0	0	0	0	0	0	0	0	11.27205	0	18.06368	0	0	15.40943	12.43204	14.35338	0	11.40093	0
A0A669F4J9	A0A669F4J9_ORENI		exocytosis [GO:0006887]	Exocyst complex component 3-like 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	exocyst [GO:0000145]	exocyst [GO:0000145]; exocytosis [GO:0006887]		NLPVRLK	14.57999992	838.5071055	17.57403	15.26887	0	17.53946	15.91344	16.73016	16.23068	0	15.03209	0	16.65164	15.37964	0	15.89519	0	16.37492	0	0	0	0	0	0	0	16.74264	0	16.49598	17.26258	13.86998	17.22315	17.14371	0	17.81582	15.03735	17.12545	0	0	16.57734	14.22095	13.47687	16.43575	11.19884	12.81361	15.21999	16.60914	17.43538	0	0	0	0	0	0	16.50011	15.36325	14.627
A0A669EA02	A0A669EA02_ORENI		vesicle docking involved in exocytosis [GO:0006904]	Exocyst complex component	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	exocyst [GO:0000145]	exocyst [GO:0000145]; vesicle docking involved in exocytosis [GO:0006904]		SANVWAFL	1.159999967	906.8709864	14.66661	14.80332	14.43559	14.94371	10.46865	14.01708	13.51355	0	14.75928	0	13.52008	16.4414	13.4312	14.97718	16.68714	15.5891	0	14.45533	15.22642	15.53011	0	0	17.81828	0	17.42322	0	0	0	0	0	0	0	16.03249	0	16.66474	0	0	14.91208	0	15.24527	0	15.33635	0	0	0	16.18177	0	0	17.09912	0	15.66102	16.26386	16.43893	17.59199
I3K0H9	I3K0H9_ORENI	exoc4	Golgi to plasma membrane transport [GO:0006893]; protein targeting to membrane [GO:0006612]; vesicle docking involved in exocytosis [GO:0006904]; vesicle tethering involved in exocytosis [GO:0090522]	Exocyst complex component Sec8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	exocyst [GO:0000145]	exocyst [GO:0000145]; Golgi to plasma membrane transport [GO:0006893]; protein targeting to membrane [GO:0006612]; vesicle docking involved in exocytosis [GO:0006904]; vesicle tethering involved in exocytosis [GO:0090522]		EADLDFASICLS	12.72999954	1339.976591	0	13.42334	13.36709	15.23564	15.98386	12.471	0	13.78884	0	0	0	10.99823	0	14.3252	0	12.64817	13.85991	10.56472	11.29433	0	14.5871	14.34005	0	0	0	11.15848	13.46138	13.32927	12.26438	0	17.48771	15.3924	15.081	0	0	15.29394	16.21047	0	0	0	12.87745	0	15.7898	0	0	0	16.45226	14.31965	15.22985	0	15.09728	0	0	0
I3JRL9	I3JRL9_ORENI		DNA repair [GO:0006281]	Exonuclease 1 (EC 3.1.-.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; 5'-3' exodeoxyribonuclease activity [GO:0035312]; DNA binding [GO:0003677]; endonuclease activity [GO:0004519]; metal ion binding [GO:0046872]; DNA repair [GO:0006281]	5'-3' exodeoxyribonuclease activity [GO:0035312]; DNA binding [GO:0003677]; endonuclease activity [GO:0004519]; metal ion binding [GO:0046872]	KESSSSPPK	9.550000191	947.3659396	16.36029	15.20132	15.13985	0	15.7048	15.88864	15.4923	15.45237	13.021	15.79787	16.19903	17.22732	15.10312	0	14.3193	0	15.85581	15.46614	15.36775	0	15.28049	0	0	15.47721	0	15.7063	16.87153	15.44829	17.63448	15.78858	0	15.61274	15.89351	14.89931	15.05894	15.12931	15.51889	15.34824	15.32267	15.98	12.92911	17.07117	16.83406	15.6174	16.48183	0	17.63581	0	16.3043	13.9311	0	17.94952	16.83694	16.62253
I3JUZ4	I3JUZ4_ORENI	rexo1		Exonuclease domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	IGDEPYNPSENASLSSCKTDTSK	10.07999992	2500.974767	12.32016	0	10.64375	0	12.32798	9.252608	0	17.98817	8.307647	13.90189	11.64462	10.64771	8.975904	8.316874	17.28619	0	0	0	11.77705	0	0	0	11.99658	0	10.37254	0	9.899634	6.825881	0	0	11.16355	0	0	0	6.715473	0	9.644045	13.85055	0	12.83353	12.37426	0	14.07484	11.93841	11.20291	0	10.98481	9.313745	0	0	0	0	10.63611	0
I3K2H0	I3K2H0_ORENI		endoplasmic reticulum-plasma membrane tethering [GO:0061817]; lipid transport [GO:0006869]	Extended synaptotagmin-like protein 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; lipid binding [GO:0008289]; endoplasmic reticulum-plasma membrane tethering [GO:0061817]; lipid transport [GO:0006869]	lipid binding [GO:0008289]	DNFMGGMMK	4.239999771	1060.04882	14.39995	0	13.67076	13.43157	0	10.84902	15.59448	10.99689	11.89796	13.7501	0	0	13.79976	0	0	0	13.43372	14.94129	13.77099	0	0	13.76401	16.97129	0	0	11.72206	0	16.91931	0	0	16.91383	14.9125	0	11.10605	13.38835	0	11.99619	0	0	0	15.66765	10.91889	0	15.02957	0	14.06352	0	12.73907	18.53196	0	13.0785	14.8296	0	11.51667
A0A669BMU9	A0A669BMU9_ORENI		endoplasmic reticulum-plasma membrane tethering [GO:0061817]; lipid transport [GO:0006869]	Extended synaptotagmin-like protein 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; plasma membrane [GO:0005886]	endoplasmic reticulum membrane [GO:0005789]; plasma membrane [GO:0005886]; lipid binding [GO:0008289]; endoplasmic reticulum-plasma membrane tethering [GO:0061817]; lipid transport [GO:0006869]	lipid binding [GO:0008289]	DNLMGGMVKGK	5.329999924	1162.934037	11.74423	0	13.61547	13.27753	6.842404	17.36609	11.97493	0	0	0	13.293	11.40289	17.70056	0	12.68268	0	14.15355	12.23809	0	13.78242	13.52859	0	0	0	12.6362	0	10.87092	14.14509	10.30363	10.40471	12.32078	0	0	0	12.33524	17.88397	13.88436	12.15238	13.31252	13.68056	14.13937	8.87326	11.63096	16.13761	0	13.06634	0	10.57339	13.25054	0	12.72649	13.70852	0	14.50816
A0A669CJW2	A0A669CJW2_ORENI	eya3	DNA repair [GO:0006281]; multicellular organism development [GO:0007275]	Eyes absent homolog (EC 3.1.3.48)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	nucleus [GO:0005634]; transcription regulator complex [GO:0005667]; metal ion binding [GO:0046872]; protein tyrosine phosphatase activity [GO:0004725]; DNA repair [GO:0006281]; multicellular organism development [GO:0007275]	metal ion binding [GO:0046872]; protein tyrosine phosphatase activity [GO:0004725]	GNVGGLLNPMKR	2.859999895	1272.622066	14.25132	15.69633	13.36072	0	0	15.55711	15.36461	15.12339	15.68031	0	14.8952	15.4389	16.56911	14.52213	0	15.43461	15.86517	16.98151	0	0	0	0	14.82691	0	13.62175	0	0	0	15.37186	14.69832	0	0	15.42711	0	0	0	15.2643	0	0	0	18.18441	15.0256	0	0	14.01399	0	0	0	16.94427	0	0	0	16.09149	0
I3JYV6	I3JYV6_ORENI	fcho2	clathrin-dependent endocytosis [GO:0072583]	F-BAR domain only protein 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	clathrin-coated pit [GO:0005905]	clathrin-coated pit [GO:0005905]; clathrin-dependent endocytosis [GO:0072583]		NIENTSVESLIQK	1.399999976	1475.650687	10.28644	0	12.61564	16.84563	0	14.40487	16.3042	9.719834	0	0	0	0	0	0	0	0	0	0	0	0	0	16.78347	0	0	0	0	0	0	0	0	0	20.16442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669F7N7	A0A669F7N7_ORENI	LOC100706459		F-BAR domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				FCTAKPPGSVSPAKR	4.539999962	1603.384752	14.09435	15.81728	15.40079	13.01534	14.4618	13.70728	14.79699	16.14245	15.31781	15.18822	15.26442	14.92479	14.85444	10.42973	14.77188	0	0	0	14.0315	16.36441	14.55128	0	0	0	16.25179	0	17.52842	0	0	0	16.04493	0	15.5442	16.08654	16.18827	0	0	0	0	0	0	16.11979	0	0	0	0	15.47414	0	0	0	17.48416	17.95582	0	18.24824
I3JF91	I3JF91_ORENI	mical2	actin filament depolymerization [GO:0030042]; positive regulation of transcription via serum response element binding [GO:0010735]	F-actin monooxygenase (EC 1.14.13.225)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; actin binding [GO:0003779]; FAD binding [GO:0071949]; metal ion binding [GO:0046872]; monooxygenase activity [GO:0004497]; NADPH:sulfur oxidoreductase activity [GO:0043914]; actin filament depolymerization [GO:0030042]; positive regulation of transcription via serum response element binding [GO:0010735]	actin binding [GO:0003779]; FAD binding [GO:0071949]; metal ion binding [GO:0046872]; monooxygenase activity [GO:0004497]; NADPH:sulfur oxidoreductase activity [GO:0043914]	DNVGKLFENFIQASTCK	9.340000153	1969.844405	14.75045	0	14.44092	12.68	13.1248	14.99126	13.77413	13.21592	9.242783	0	13.23312	13.82382	0	0	14.36331	0	14.36796	14.42943	16.20583	16.98576	0	0	0	0	0	0	0	11.26663	0	0	0	0	0	0	15.77735	0	0	0	0	0	0	15.18259	0	0	0	0	0	0	0	0	0	0	0	0
I3JME6	I3JME6_ORENI			F-box and WD repeat domain containing 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				FPLSAPGGDHVAQLPSTTQK	4.760000229	2048.049783	12.49863	12.67348	0	14.29024	14.90962	17.22591	13.0816	10.40286	12.20861	13.05579	14.02572	13.8255	18.50138	9.72487	9.579768	14.16592	8.999396	13.85657	12.51207	13.87331	11.10807	0	0	13.80921	12.81032	0	13.02093	11.56997	14.24838	0	12.73206	0	0	0	0	0	14.95793	0	12.94533	0	15.58077	0	13.07613	13.9729	11.74341	11.86236	0	0	15.4309	0	11.30161	15.51072	0	14.52109
A0A669EG70	A0A669EG70_ORENI	fbxo11	protein ubiquitination [GO:0016567]	F-box domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ubiquitin ligase complex [GO:0000151]	ubiquitin ligase complex [GO:0000151]; zinc ion binding [GO:0008270]; protein ubiquitination [GO:0016567]	zinc ion binding [GO:0008270]	MVAEESGPGAQNSPYQLR	7.360000134	1933.918382	0	9.409225	0	13.12559	0	0	0	0	12.94476	15.36668	0	0	15.91739	0	12.18665	13.86057	13.61643	13.5967	0	10.32153	13.69518	14.75076	10.66515	0	15.23312	0	0	0	13.272	19.40865	0	15.37306	0	7.931822	12.76358	0	12.49438	13.24096	10.55178	19.05423	11.92797	13.84064	11.19077	12.48771	16.22613	13.56881	13.67798	10.04914	0	14.07783	15.02652	10.07533	15.40253	15.96392
A0A669CNT5	A0A669CNT5_ORENI	LOC100710117	cell adhesion [GO:0007155]	F-spondin (Spondin-1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; metal ion binding [GO:0046872]; cell adhesion [GO:0007155]	metal ion binding [GO:0046872]	LTFYGNWSEK	12.57999992	1245.374731	12.58865	12.524	10.605	14.34942	12.44582	12.25472	0	0	0	9.201079	0	0	14.95541	11.6493	12.987	12.17176	14.83289	15.31672	0	9.911845	16.93719	15.29028	14.88803	0	0	13.77761	14.35216	0	0	0	18.38164	18.17087	0	0	0	0	0	0	13.92742	0	0	13.15553	0	0	14.11855	0	0	12.57399	0	0	0	14.40688	0	16.93529
A0A669DJH1	A0A669DJH1_ORENI	LOC100691621		F5/8 type C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; metallocarboxypeptidase activity [GO:0004181]; zinc ion binding [GO:0008270]	metallocarboxypeptidase activity [GO:0004181]; zinc ion binding [GO:0008270]	LYVMEISDNPGK	2.880000114	1383.108148	0	12.91422	12.65869	0	14.81969	0	0	13.5296	13.15298	0	13.90038	15.25409	0	13.11035	12.89047	0	12.18453	18.21732	0	14.27501	0	0	12.09219	0	13.74763	14.33868	11.12343	0	0	0	18.64186	14.15004	15.77503	13.7282	13.01668	14.54914	13.48905	13.88643	14.60266	16.04939	0	0	0	15.70646	17.66765	0	13.10466	0	0	14.54778	11.31087	0	0	0
A0A669BZN6	A0A669BZN6_ORENI		interstrand cross-link repair [GO:0036297]	FA complementation group L	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Fanconi anaemia nuclear complex [GO:0043240]	Fanconi anaemia nuclear complex [GO:0043240]; metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]; interstrand cross-link repair [GO:0036297]	metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]	AEDSAGRQHILTVK	9.930000305	1520.220518	12.04248	15.0212	0	14.55795	13.9444	0	14.63557	0	0	17.03608	12.46566	15.65713	14.00268	0	0	0	14.43882	0	14.2554	0	15.01758	13.61523	0	14.25259	0	0	0	0	0	0	15.02768	0	14.57122	0	13.85236	0	0	0	15.75668	0	0	0	0	0	0	0	0	15.90454	0	15.04098	16.86539	15.58308	0	0
A0A669BQL7	A0A669BQL7_ORENI		DNA repair [GO:0006281]; DNA replication [GO:0006260]	FACT complex subunit SSRP1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]; nucleus [GO:0005634]	chromosome [GO:0005694]; nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA repair [GO:0006281]; DNA replication [GO:0006260]	DNA binding [GO:0003677]	QTSKECEAK	3.970000029	1080.133545	13.45721	15.33681	0	0	14.70169	15.15685	15.99494	13.66299	0	15.63195	16.65137	13.26893	12.91722	13.55804	14.55755	14.95062	14.27506	11.66194	14.71621	15.90308	15.69332	15.49834	13.39228	0	15.25453	15.09595	0	15.11517	15.68868	16.27364	15.38072	11.65453	15.14273	15.667	15.42321	15.23522	15.87124	11.60762	14.91791	0	12.80283	13.4488	15.58817	15.91272	0	16.29341	14.75871	0	15.73444	16.16018	15.95435	16.50273	16.63714	13.7247
A0A669CRU7	A0A669CRU7_ORENI			FAD synthase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	LAMVPR	2.660000086	686.7809162	0	13.26927	11.06377	15.10011	14.1229	13.17365	0	0	12.55145	14.47643	14.86621	15.09384	15.84654	0	0	16.7922	0	12.76964	0	14.7357	15.03484	15.41393	16.03274	15.67455	0	16.80857	15.41975	18.49969	11.16258	14.57445	22.20068	16.8883	17.04578	0	0	0	0	11.52565	0	0	9.928048	12.33883	10.51326	12.66001	17.46037	0	14.95038	13.29771	16.94757	0	0	0	0	0
A0A669E4G3	A0A669E4G3_ORENI	ldhd		FAD-binding PCMH-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		FAD binding [GO:0071949]; oxidoreductase activity [GO:0016491]	FAD binding [GO:0071949]; oxidoreductase activity [GO:0016491]	LPQIIVETK	1.529999971	1040.251301	0	14.00404	13.76517	15.34452	0	0	13.70532	15.7822	0	13.01968	0	15.12009	14.6701	8.139464	0	13.96173	0	13.00882	0	14.37651	11.67309	12.10275	0	0	0	12.27789	14.21821	13.68934	11.3677	8.903045	16.16681	17.49599	16.89182	11.07971	0	0	0	13.34269	12.39333	13.72918	12.04232	13.84424	0	0	13.25226	14.38311	14.06272	0	17.74962	0	0	15.14881	0	13.99271
I3KPT1	I3KPT1_ORENI			FAM178 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NNLDQILKEINSNK	8.260000229	1642.480977	0	0	15.97982	15.70585	14.69815	15.59522	15.16368	15.07484	13.78075	0	14.74423	14.80984	15.08757	13.19835	0	0	16.27748	15.74377	0	15.36497	15.90771	0	15.66924	14.64391	15.61649	15.39165	0	0	15.29258	16.30833	15.97111	0	17.3089	0	15.39331	15.31735	15.404	15.15394	15.97337	0	15.91018	16.14569	0	15.51595	0	0	0	14.9312	15.92878	14.61533	0	15.21697	16.3425	14.93203
I3KF86	I3KF86_ORENI	LOC100700510		FAM184 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DQEKLVQLHK	10.68999958	1233.273294	12.38409	8.613427	12.68047	9.787586	0	11.02334	0	0	12.08527	0	14.26263	11.17693	13.5816	0	18.19468	0	16.81753	15.21046	8.831879	17.36451	0	13.87272	0	0	0	0	0	0	12.9262	0	0	15.90975	0	15.14163	0	0	12.8978	13.15641	13.00964	11.95588	0	11.43976	0	0	0	0	13.30058	0	0	0	0	0	0	0
A0A669DS03	A0A669DS03_ORENI	lg7h3orf20		FAM194 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SHLNQPK	17.52000046	824.4291278	15.13693	14.31863	15.62308	14.7926	15.98792	16.49486	15.20831	15.2673	12.91356	16.29477	16.04567	16.21058	16.03017	15.18381	15.62247	0	0	15.27303	17.07761	0	0	18.00121	13.3196	0	0	0	0	16.462	17.41538	0	16.38124	0	19.22659	15.4549	0	0	17.91579	16.93532	0	0	0	0	13.80036	0	13.36448	0	17.73754	0	17.34805	16.10645	16.85479	0	17.23273	0
A0A669CTS3	A0A669CTS3_ORENI	inka2		FAM212 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; protein serine/threonine kinase inhibitor activity [GO:0030291]	protein serine/threonine kinase inhibitor activity [GO:0030291]	QTMSEEPSPSHMPSSR	6.449999809	1802.827704	12.63285	11.51379	12.51143	0	0	0	13.38014	12.60666	15.19379	0	15.20549	14.32646	11.995	0	13.83595	13.25587	13.37249	0	10.282	13.60011	0	14.16318	13.24658	14.22853	9.947299	12.93353	0	13.52924	0	14.24442	13.24189	0	15.95482	14.8835	12.69498	12.95353	0	0	0	14.87411	13.4067	13.99853	14.18134	13.59973	0	0	15.26254	13.46636	14.67005	0	0	15.43765	11.54432	11.73674
A0A669B863	A0A669B863_ORENI	shld2		FAM35_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GSVQSASSLEK	7.340000153	1093.526707	13.56741	0	0	0	0	14.91888	14.68264	13.98181	15.61807	15.64744	13.98306	13.68096	15.63028	0	14.18474	0	15.47069	0	0	0	0	16.06876	15.06315	15.87264	0	15.57883	0	0	15.98112	0	17.1101	17.2161	18.13909	0	15.2678	0	15.58186	0	14.67095	16.79491	0	15.49397	15.79956	0	0	0	0	15.99206	16.6263	0	15.37574	14.49051	0	15.54985
I3J7U5	I3J7U5_ORENI	LOC100699664		FAM83 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ALGGRSFGLR	4.489999771	1033.619581	12.61949	10.50091	11.04885	18.18011	0	13.06904	14.52625	13.93782	14.53469	12.80136	12.14128	11.92373	10.76961	17.61578	13.53335	12.37093	12.08986	11.59144	15.33352	0	15.18536	0	11.69845	0	0	13.99508	0	0	10.91482	14.13907	0	0	0	14.43437	0	0	0	0	0	0	0	13.2233	11.22499	13.13294	0	14.25731	12.45689	16.26266	0	0	0	0	0	0
A0A669EQG6	A0A669EQG6_ORENI		homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	FAT atypical cadherin 3b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	calcium ion binding [GO:0005509]	SPVGNEYR	3.329999924	921.6814151	13.55594	14.26751	13.62558	14.51607	9.182909	15.37354	12.21216	11.17472	0	0	0	15.22209	15.15759	14.7865	15.08372	0	0	13.78012	0	0	13.27373	0	15.00061	13.50754	14.25555	13.64237	14.05074	13.59736	14.79026	12.39567	15.92004	16.31527	0	0	0	14.78014	15.32921	0	14.0746	14.70253	18.00801	15.09865	0	0	0	12.49404	14.722	14.82019	14.35706	0	0	13.90929	0	14.89162
I3JR57	I3JR57_ORENI			FATP synthase c subunit lysine N-methyltransferase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; mitochondrial membrane [GO:0031966]	integral component of membrane [GO:0016021]; mitochondrial membrane [GO:0031966]; protein-lysine N-methyltransferase activity [GO:0016279]	protein-lysine N-methyltransferase activity [GO:0016279]	IVTAKHGFR	10.55000019	1029.000833	13.8072	14.2045	14.41439	13.64719	0	0	12.6641	16.31277	13.7475	13.43619	13.35657	0	0	12.92182	15.27126	0	15.91352	10.17762	0	0	13.71695	0	15.33158	0	13.29354	7.577189	13.65522	0	11.83037	0	0	0	0	15.93927	14.95065	0	13.41986	14.55033	0	0	0	15.31259	0	0	0	0	0	0	14.49139	0	16.00078	0	14.12881	14.4124
A0A669B2T2	A0A669B2T2_ORENI	LOC100691947		FERM domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; actin binding [GO:0003779]	actin binding [GO:0003779]	AALAQQAADQMK	24.72999954	1260.605911	15.07817	15.4224	14.36226	18.10408	11.05429	15.65456	16.83652	16.97482	17.97984	17.59742	13.24722	0	0	15.94639	15.59422	0	0	15.31658	0	15.6667	16.71902	16.6418	16.57602	16.43966	15.59461	17.52997	0	16.50958	13.90741	0	0	0	0	0	0	15.64592	14.85707	14.71943	16.1274	14.134	14.29353	16.28653	0	0	15.79484	15.79193	11.17462	15.01614	15.84481	16.25236	0	15.46855	15.79243	0
A0A669D755	A0A669D755_ORENI	LOC102077743		FH2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AEPATPSK	10.05000019	801.2656593	13.91869	14.23186	0	16.40274	14.53717	16.03082	15.27083	16.12685	0	17.77304	18.06027	17.71189	15.22593	14.66171	13.90733	14.49053	16.38603	14.5589	14.41683	15.23425	13.92491	16.64915	18.50506	14.81417	15.62282	16.71472	15.06499	12.97228	14.65523	13.63107	15.27601	16.81153	18.71832	16.9102	0	15.83085	17.14022	15.74739	16.20933	15.64967	17.44085	16.16301	16.84913	16.39176	17.75711	13.79655	16.18311	17.24788	12.96362	17.10934	14.11487	16.00757	13.53955	0
I3KHB3	I3KHB3_ORENI	SNIP1		FHA domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QSAYLLGRQR	5.71999979	1186.956356	9.744901	0	0	13.32988	12.40208	0	12.98041	0	0	14.77022	13.42891	14.87655	0	12.63989	0	0	0	14.18919	12.5233	0	11.39882	0	10.85524	0	0	0	12.48676	14.64239	0	0	0	0	0	17.83528	0	11.18455	0	0	11.92132	0	0	13.21818	0	0	14.5939	12.93723	0	0	15.53465	0	15.7294	14.17596	14.23492	0
A0A669F624	A0A669F624_ORENI	FIG4	phosphatidylinositol dephosphorylation [GO:0046856]	FIG4 phosphoinositide 5-phosphatase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"phosphatidylinositol-3,5-bisphosphate 5-phosphatase activity [GO:0043813]; phosphatidylinositol dephosphorylation [GO:0046856]"	"phosphatidylinositol-3,5-bisphosphate 5-phosphatase activity [GO:0043813]"	GLEDSS	6.889999866	607.0136805	0	13.49835	15.23671	14.2621	14.52143	0	0	0	13.06456	0	0	14.55193	13.80076	12.65259	13.09472	0	14.21674	0	12.97146	0	0	0	13.70828	14.40049	14.26809	14.44584	13.9361	0	15.71278	15.58871	0	20.47154	0	15.36113	0	11.32161	0	10.63815	13.22198	13.87484	15.49094	0	15.31502	12.51413	13.08377	0	0	15.42955	0	0	13.50817	0	14.45017	0
A0A669D1A1	A0A669D1A1_ORENI	LOC100702416		FIIND domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]		EQADFDMKR	4.619999886	1136.72687	0	14.21672	0	0	12.0658	14.18061	14.439	0	12.16635	0	0	0	14.65282	0	0	17.41818	0	0	12.52965	14.43032	0	0	14.93575	11.81755	14.36636	15.79542	14.47262	12.72453	0	15.82313	11.97635	0	0	11.2815	14.3159	0	0	0	15.4331	0	0	0	0	0	0	13.77721	0	8.717836	0	0	0	13.92985	0	14.49236
A0A669FCN7	A0A669FCN7_ORENI			FIP-RBD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; small GTPase binding [GO:0031267]	small GTPase binding [GO:0031267]	SELNNVAPLGNSRVNSR	2.140000105	1827.177613	12.17742	0	0	0	0	9.20016	13.58187	0	11.92005	13.28339	15.01968	0	0	11.43884	0	14.83385	0	14.68289	0	13.48933	13.64779	0	13.51426	16.71416	14.80168	0	14.35391	0	13.99099	0	14.5051	16.15243	14.78004	0	12.52557	15.52757	16.12555	0	10.76689	14.55244	13.66413	0	11.94077	15.09152	14.37394	0	0	12.57535	0	0	14.20665	0	0	0
I3J654	I3J654_ORENI	hao1		FMN hydroxy acid dehydrogenase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		FMN binding [GO:0010181]; oxidoreductase activity [GO:0016491]	FMN binding [GO:0010181]; oxidoreductase activity [GO:0016491]	MEFTSRM	17.25	918.0853481	17.08541	0	20.08934	0	15.96795	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.33865	0	0	0	0	0	0	18.14758	0	0	0	0	0	0	0
I3KTT1	I3KTT1_ORENI			FSA_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SLVSSEPQHVTLIVFGIGMVNR	2.089999914	2379.007117	11.94341	0	7.585735	0	0	8.919492	0	0	15.35305	0	0	11.34176	11.81371	11.5734	14.1683	0	12.31554	12.16599	0	14.94274	11.11082	13.99393	10.71207	12.25015	0	15.9216	0	14.27241	11.71421	11.54737	0	14.02752	15.17326	0	0	12.65915	0	13.15638	12.86508	11.91036	5.099687	0	14.92398	13.5934	0	0	13.44914	12.26077	13.78869	0	14.33527	17.7777	13.26076	0
I3JFH5	I3JFH5_ORENI	LOC100707558	ion transport [GO:0006811]; regulation of ion transport [GO:0043269]	FXYD domain-containing ion transport regulator	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ion channel regulator activity [GO:0099106]; ion transport [GO:0006811]; regulation of ion transport [GO:0043269]	ion channel regulator activity [GO:0099106]	AAAAAKETPPEN	10.47999954	1166.530857	0	13.56965	14.01274	11.50139	14.11265	0	10.21912	13.6254	15.04124	0	14.03047	0	0	12.79367	17.88116	12.36458	18.06337	0	17.64093	13.31667	17.38193	0	11.73648	0	0	12.11495	0	11.97451	10.14587	0	15.51127	0	0	13.73997	14.3221	0	11.90781	12.99134	0	14.75148	0	0	0	0	0	13.83247	12.98261	10.94354	0	13.87158	0	0	0	0
I3J6Z5	I3J6Z5_ORENI		integrin-mediated signaling pathway [GO:0007229]	FYN binding protein b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; integrin-mediated signaling pathway [GO:0007229]		VQGNPEGK	7.130000114	829.1280119	0	0	0	16.31465	0	16.39	0	16.58529	16.52297	0	0	16.61266	0	0	0	16.32656	15.93236	16.77536	15.15339	15.87901	15.78293	15.98598	16.22759	0	0	16.32713	17.24497	16.95986	16.91923	0	16.24498	0	16.01702	15.88274	16.48859	0	0	0	16.42587	0	16.77818	16.20804	16.82898	16.71702	0	0	16.55518	16.48087	16.42558	15.95579	0	0	15.7665	16.86015
A0A669D3Z4	A0A669D3Z4_ORENI			"FYVE, RhoGEF and PH domain containing 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; guanyl-nucleotide exchange factor activity [GO:0005085]; metal ion binding [GO:0046872]	guanyl-nucleotide exchange factor activity [GO:0005085]; metal ion binding [GO:0046872]	RWMDILSR	13.78999996	1093.458514	11.98436	13.84672	14.62338	16.73235	12.75575	13.17354	14.61331	14.26216	13.85278	15.6397	0	10.73581	8.36065	16.3526	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.26224	0	0	0	0	0	0
I3K2J3	I3K2J3_ORENI	zfyve19		FYVE-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	KPAPPPAPKNR	6.96999979	1172.061047	0	0	13.24753	13.83231	13.48129	17.42492	14.36221	14.73984	0	13.60046	0	0	13.99613	0	12.5397	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.977	0	0	0	0	16.15496	0	0	0	0	15.50033	0	0
I3K5T0	I3K5T0_ORENI	LOC112841764		Fam20C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi apparatus [GO:0005794]	Golgi apparatus [GO:0005794]		DVATPAG	5.199999809	630.1405341	0	14.75931	14.98523	13.32953	0	13.70206	13.37513	10.31541	0	14.10733	14.19752	0	12.16372	0	11.41303	14.66903	12.84983	0	0	0	0	15.0081	14.84684	0	14.76836	15.11085	10.64061	10.20944	14.49383	13.5925	0	17.89656	16.54345	0	14.19582	0	15.29059	0	13.90232	0	13.35867	0	0	0	0	0	0	0	13.65543	0	0	0	14.03432	14.79048
A0A669BUF4	A0A669BUF4_ORENI			Family with sequence similarity 110 member A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LRPKGQVGLDFYQK	6.28000021	1649.451645	0	12.57471	12.86332	11.16024	0	0	14.19319	10.89168	13.11075	0	12.87581	13.16221	11.72701	13.42658	14.7113	14.58397	15.33144	13.00555	0	14.24001	0	10.46142	14.95963	14.86565	13.79421	14.7142	13.95631	14.90652	14.27173	11.51099	0	16.31534	11.96353	14.59415	0	13.17974	14.21003	15.09181	14.44987	14.44435	10.47136	13.28554	13.56268	12.04023	12.92836	13.26826	15.22489	0	0	0	14.65636	13.95255	13.06486	0
A0A669ENS9	A0A669ENS9_ORENI			Family with sequence similarity 114 member A1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VEQPVTTETVGR	3.210000038	1315.595808	0	0	11.48097	13.23391	13.33493	14.6484	0	14.54898	0	14.54136	13.33765	0	0	13.7246	0	11.15535	0	14.28711	15.42693	0	12.66062	0	0	0	0	13.47612	13.51285	10.11405	0	13.09931	23.34613	23.05972	21.72499	13.69752	13.44159	13.90529	12.41665	12.69686	0	12.25676	14.0382	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669F981	A0A669F981_ORENI			Family with sequence similarity 13 member A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DMAIPQK	10.68000031	819.7550281	13.90168	14.8843	14.09517	13.53238	14.59979	12.85809	0	13.99466	13.54121	13.53116	15.92713	12.17223	15.38764	17.13155	16.19104	13.55928	15.54002	14.14633	17.47857	14.60485	0	0	19.29816	14.91425	14.81854	0	13.24849	14.34515	0	15.56167	0	0	0	0	0	14.19704	0	14.98449	0	0	13.86894	0	14.56273	0	14.11211	0	13.22773	15.26992	0	14.40915	15.3015	15.29651	15.81773	0
I3JTU7	I3JTU7_ORENI			Family with sequence similarity 135 member A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LISSSGYK	12.75	855.2685519	0	0	0	0	0	16.0577	0	0	14.37212	14.86133	0	15.63772	0	17.73321	15.43427	15.43815	17.47348	15.41263	14.14134	17.08478	15.22173	16.71984	17.46135	15.10382	9.672261	16.85393	0	16.97897	16.49962	16.08385	16.63792	16.14535	0	16.8193	0	0	14.2249	15.76809	0	0	16.88752	18.01687	15.72298	0	0	0	17.49023	0	17.52176	0	0	16.0061	16.49287	0
A0A669BX81	A0A669BX81_ORENI			Family with sequence similarity 193 member A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				FDSLPRPHLQHSPNCAAEK	10.39999962	2203.406789	13.33565	0	15.32407	9.097547	15.56598	0	13.26843	0	13.50622	13.02318	14.21919	0	13.97131	12.61884	13.44032	0	12.11805	8.394305	12.11573	10.51636	12.19019	0	15.59085	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.26262	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KIH7	I3KIH7_ORENI		vasculature development [GO:0001944]	Family with sequence similarity 43 member B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		vasculature development [GO:0001944]		LTVGPQGIRMSADK	5.559999943	1489.09175	0	0	14.13061	14.78637	12.55842	12.21324	12.9865	14.13405	11.81759	15.03043	13.13927	13.66102	0	0	13.0148	13.08757	10.26495	12.22937	0	15.03019	12.22759	11.28228	0	14.13794	0	12.8367	14.45392	13.64468	15.43725	14.86899	13.29578	17.79326	0	15.178	12.65724	0	14.59862	0	0	14.50834	0	13.82404	0	0	0	12.23083	12.34401	12.61506	14.43869	0	0	0	0	14.38106
I3K8X8	I3K8X8_ORENI		regulation of actin filament polymerization [GO:0030833]	Family with sequence similarity 49 member Ba	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; small GTPase binding [GO:0031267]; regulation of actin filament polymerization [GO:0030833]	small GTPase binding [GO:0031267]	MSLFYASATPMLKTLSDATSK	20.93000031	2295.657153	12.52601	14.5558	0	13.79453	12.55542	11.82238	16.6109	9.608232	12.74272	12.72768	12.65024	0	0	0	0	17.75235	12.30574	12.38345	9.591226	13.84665	0	13.66411	13.80942	11.18108	12.8016	17.5564	0	13.86619	12.61125	14.09726	12.56852	0	13.26524	0	0	0	0	0	12.80056	10.59356	14.75751	0	12.84245	13.88452	0	0	0	0	0	0	0	0	0	0
I3KQH4	I3KQH4_ORENI			Family with sequence similarity 83 member C	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				FPEPASNGR	8.960000038	975.4831275	14.47049	13.98606	0	15.73715	0	14.61858	16.8106	13.02992	14.0579	0	14.78172	0	15.41299	0	10.7635	15.98124	13.19005	0	13.89684	14.86417	13.44585	11.96685	16.30476	0	14.33081	0	10.14573	14.50799	0	0	11.88874	13.83002	14.32256	0	0	13.23895	0	13.28902	14.33228	0	0	14.04394	0	0	14.23274	0	11.68291	13.19403	0	16.64463	14.27289	0	0	14.68645
I3JNQ3	I3JNQ3_ORENI	fan1	interstrand cross-link repair [GO:0036297]	Fanconi-associated nuclease (EC 3.1.4.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; phosphodiesterase I activity [GO:0004528]; interstrand cross-link repair [GO:0036297]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]; phosphodiesterase I activity [GO:0004528]	AGTAAR	16.63999939	547.441934	0	0	17.77341	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20.67799	18.81515	0	0	0	17.98321	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3JY31	I3JY31_ORENI	fanca	interstrand cross-link repair [GO:0036297]	Fanconi_A_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Fanconi anaemia nuclear complex [GO:0043240]	Fanconi anaemia nuclear complex [GO:0043240]; interstrand cross-link repair [GO:0036297]		QLVAEPSHVLGR	6.230000019	1304.653619	14.27384	12.71574	13.91628	11.90865	0	0	0	13.32633	0	15.02512	11.00026	14.84524	16.2548	0	13.5544	0	15.21442	13.79826	0	0	17.62597	0	0	0	0	0	0	0	0	14.08467	0	0	18.554	0	0	0	0	0	14.9683	12.83183	0	0	15.0798	14.07851	15.2377	0	0	0	15.4109	0	0	0	0	11.99823
I3JCV4	I3JCV4_ORENI	LOC100695939	actin filament organization [GO:0007015]	Fascin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; actin filament binding [GO:0051015]; protein-macromolecule adaptor activity [GO:0030674]; actin filament organization [GO:0007015]	actin filament binding [GO:0051015]; protein-macromolecule adaptor activity [GO:0030674]	VNASATSMKK	12.73999977	1052.835703	0	13.54014	11.32362	12.94955	11.65992	13.36067	13.95594	12.73724	14.52414	14.62244	14.47637	13.91429	13.22373	14.48068	14.26432	12.65279	11.27202	12.18147	9.580969	12.98911	13.04261	0	7.935217	13.5881	0	11.80401	11.25154	14.7164	8.008091	9.607474	13.12829	13.7359	0	12.5202	0	12.09631	0	12.64017	13.29544	17.00361	0	13.371	18.30908	14.23527	0	14.06752	13.87584	0	0	13.98222	15.21291	0	14.27925	13.28563
A0A669EZF8	A0A669EZF8_ORENI	FAR2	lipid metabolic process [GO:0006629]	Fatty acyl-CoA reductase (EC 1.2.1.84)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; peroxisomal membrane [GO:0005778]	integral component of membrane [GO:0016021]; peroxisomal membrane [GO:0005778]; alcohol-forming fatty acyl-CoA reductase activity [GO:0102965]; fatty-acyl-CoA reductase (alcohol-forming) activity [GO:0080019]; lipid metabolic process [GO:0006629]	alcohol-forming fatty acyl-CoA reductase activity [GO:0102965]; fatty-acyl-CoA reductase (alcohol-forming) activity [GO:0080019]	LIDSLEWMDDGIVR	4.139999866	1676.621431	13.21461	14.0586	12.63085	12.53091	0	0	13.81188	12.13344	14.13953	14.04316	0	0	14.15669	13.38465	0	0	0	13.03564	15.41318	0	14.03012	13.84533	0	0	0	15.0141	0	0	0	16.17884	0	15.82728	0	0	0	13.94459	0	13.65479	0	0	0	0	14.22953	12.85245	0	0	0	0	0	14.57641	0	0	0	0
A0A669E4N2	A0A669E4N2_ORENI	isca1	iron-sulfur cluster assembly [GO:0016226]	Fe-S_biosyn domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; iron-sulfur cluster binding [GO:0051536]; iron-sulfur cluster assembly [GO:0016226]	iron-sulfur cluster binding [GO:0051536]	MSASMVRATVR	3.839999914	1240.35165	9.266479	13.41996	0	0	13.66861	0	16.52625	14.01212	12.36708	17.51018	15.37407	14.15272	11.28021	0	16.38565	13.37693	15.33269	9.635882	15.12648	17.97229	0	13.61738	0	15.28491	0	0	0	15.55982	15.99341	14.55616	15.23771	15.86955	16.53053	9.363608	14.51888	0	13.30494	13.30777	13.89143	0	0	15.24576	17.10186	10.88591	12.64062	14.70898	0	0	0	0	0	0	17.244	0
A0A669BKQ2	A0A669BKQ2_ORENI	LOC100699058		Fe2OG dioxygenase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]	endoplasmic reticulum membrane [GO:0005789]; iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; procollagen-lysine 5-dioxygenase activity [GO:0008475]	iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; procollagen-lysine 5-dioxygenase activity [GO:0008475]	MLWFPDKLLVVTVATK	5.460000038	1877.095075	0	0	0	14.54169	0	13.83865	0	0	0	15.57274	16.29738	16.01994	0	14.11685	0	0	0	0	17.28736	13.77467	0	0	15.71845	0	0	0	15.8518	15.48064	0	0	15.22906	15.59474	14.8049	0	0	0	0	0	0	0	0	0	0	16.42847	0	0	0	0	0	15.04481	0	16.73948	0	0
I3KKP8	I3KKP8_ORENI			Fe_hyd_SSU domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AERPLLPEDDAR	19.20000076	1381.357	17.73276	0	17.93951	15.81618	12.77252	13.05239	16.60774	14.80744	15.85864	15.268	15.56825	14.1767	0	15.85514	15.8036	13.68047	16.83704	14.43239	0	18.17557	17.98749	15.18091	17.13654	16.33248	0	17.85956	18.45044	17.20533	16.56991	16.4519	16.31207	0	16.96685	0	0	0	0	0	0	18.68338	14.45161	0	15.19886	16.85115	15.26908	12.98903	0	15.02936	0	15.79267	0	0	17.45868	0
A0A669CHC9	A0A669CHC9_ORENI		cell adhesion [GO:0007155]; integrin-mediated signaling pathway [GO:0007229]	Fermitin family member 3b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cell adhesion [GO:0007155]; integrin-mediated signaling pathway [GO:0007229]		MAFVKTNHTK	13.60999966	1177.648616	0	0	0	0	0	0	0	0	12.37712	12.87706	12.82027	12.50749	11.86881	0	0	13.83926	12.89549	11.86021	16.94549	17.79245	10.72864	18.49685	14.69678	18.23407	0	12.09165	0	13.0764	13.28094	0	12.15438	13.62761	11.79265	14.31626	9.963043	0	0	13.90654	0	0	12.96916	13.52605	13.68047	13.56694	0	10.50723	12.24516	11.41811	14.1647	14.29071	0	13.51328	17.43527	13.70894
A0A669D237	A0A669D237_ORENI	LOC100704203		Fibrillar collagen NC1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		extracellular matrix structural constituent [GO:0005201]	extracellular matrix structural constituent [GO:0005201]	WASVPSLPEGVK	2.630000114	1268.515376	0	12.58677	12.07094	11.7586	0	0	0	10.49948	12.87226	0	13.21243	14.84681	0	0	0	15.27993	14.04646	0	0	0	0	0	0	18.92918	0	0	0	9.947394	0	9.889565	14.46438	15.74051	0	0	12.73879	12.9398	12.51247	0	12.74619	12.24165	12.98089	13.32216	6.809172	0	0	0	0	0	0	0	19.17022	15.33582	18.2034	0
I3JRC2	I3JRC2_ORENI	LOC100705391		Fibrinogen C-terminal domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ASSGIYTIQPNGAMNK	9.109999657	1652.316518	0	0	16.1232	14.97965	16.0155	16.04708	17.64442	0	0	0	16.19713	17.44803	0	13.63642	16.10079	15.16827	0	15.2529	17.50122	0	0	0	0	0	18.0016	19.13188	18.95934	0	0	16.33086	17.82121	18.73346	0	16.05424	14.93334	6.691239	16.59374	0	14.78665	16.12833	0	0	17.27638	16.40536	0	0	0	0	18.63712	0	17.14606	20.48997	18.59885	18.32977
A0A669DYA7	A0A669DYA7_ORENI		platelet activation [GO:0030168]; protein polymerization [GO:0051258]	Fibrinopeptide A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	fibrinogen complex [GO:0005577]	fibrinogen complex [GO:0005577]; signaling receptor binding [GO:0005102]; platelet activation [GO:0030168]; protein polymerization [GO:0051258]	signaling receptor binding [GO:0005102]	VPAITEIRGR	8.090000153	1111.852536	11.47891	0	0	13.19789	12.51842	12.04561	17.03622	10.10206	14.65869	13.36831	17.35908	15.18517	14.71381	10.84544	15.71945	12.42672	14.60756	0	14.02096	0	0	12.22622	14.60684	15.84147	0	14.34306	12.46053	11.9863	15.00185	15.92438	0	0	0	17.7143	14.28074	13.74117	14.63171	0	17.16084	14.6501	0	0	16.58421	13.51034	17.50846	13.19127	12.62204	11.49709	14.86859	0	17.55766	0	16.55309	0
I3IYQ8	I3IYQ8_ORENI	LOC100694765		Fibroblast growth factor (FGF)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		growth factor activity [GO:0008083]	growth factor activity [GO:0008083]	NPDDLSRK	5.710000038	944.2553364	13.95764	0	0	14.89612	12.5671	0	0	0	0	0	0	14.91659	0	0	0	12.6764	14.42118	13.75101	13.46564	0	16.78437	12.38965	12.77377	0	0	13.79307	15.38812	0	0	0	16.79984	0	0	0	0	0	13.69862	0	13.41181	0	0	17.19397	0	0	0	12.91167	0	0	13.58323	0	0	0	0	14.15013
I3KEC7	I3KEC7_ORENI			Fibroblast growth factor binding protein 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; growth factor binding [GO:0019838]	growth factor binding [GO:0019838]	KAPAEAHMK	5.820000172	997.6401802	12.98534	15.17593	15.77755	15.15946	13.52045	14.70152	15.61016	11.46646	15.8235	15.19266	15.60495	0	11.96944	15.67	15.82478	0	0	15.56838	0	0	0	0	0	0	0	17.76358	16.06693	0	16.27468	0	16.37702	0	0	0	0	14.89351	0	14.05177	0	15.89815	14.54867	15.76949	0	0	0	15.316	15.70852	16.54114	14.1765	14.12903	0	15.70391	0	16.10987
A0A669ED53	A0A669ED53_ORENI	FGFR1		Fibroblast growth factor receptor 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein tyrosine kinase activity [GO:0004713]	ATP binding [GO:0005524]; protein tyrosine kinase activity [GO:0004713]	VTVNPPLSR	6.929999828	982.8739869	0	0	14.96366	13.94587	0	0	0	0	13.21249	0	0	14.15958	0	14.28184	16.00457	13.50132	0	0	10.06388	0	0	14.07286	0	12.96354	10.37291	0	0	14.99262	10.68381	0	0	0	14.28243	0	0	17.68244	15.001	13.96155	0	15.93503	0	0	0	0	0	0	0	0	0	13.79927	0	14.14297	0	0
A0A669C8L8	A0A669C8L8_ORENI	FGFR1	positive regulation of cell population proliferation [GO:0008284]	Fibroblast growth factor receptor (EC 2.7.10.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; fibroblast growth factor-activated receptor activity [GO:0005007]; positive regulation of cell population proliferation [GO:0008284]	ATP binding [GO:0005524]; fibroblast growth factor-activated receptor activity [GO:0005007]	SDFNSQLAVHK	10.53999996	1246.045754	14.69583	0	10.45039	0	11.82255	13.71643	14.60506	0	0	0	12.83404	13.99516	0	16.08887	13.6032	0	14.69689	15.30572	13.74632	15.07621	15.08975	17.80105	16.5542	16.73458	17.47778	0	14.03828	0	14.28964	9.882331	14.85801	15.48678	15.60086	14.92479	15.3181	0	0	14.63525	14.22266	13.05894	0	13.52525	15.75428	16.35315	15.50604	0	0	0	0	0	0	0	0	0
I3IWR0	I3IWR0_ORENI			Fibronectin type III domain containing 3Ba	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		TRPLPPPPPPLECSAAGPQSLK	9.520000458	2307.908218	13.14365	0	14.28019	0	14.28015	14.95147	10.33197	8.833134	0	0	10.08812	11.99011	0	13.46362	11.94592	13.20295	14.19882	15.87777	11.49314	0	10.91391	14.44718	15.0094	12.835	11.46797	11.00395	13.8416	9.412848	14.3107	0	14.96762	14.40692	13.90475	15.53631	0	14.26344	11.85991	12.42322	16.48154	11.57162	13.9632	15.80518	0	9.73062	0	10.76486	0	0	0	0	0	0	14.10907	13.52659
A0A669DB71	A0A669DB71_ORENI	sel1l		Fibronectin type-II domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				WGFCETEEQAQQRLQAEETEK	5.320000172	2595.889159	0	0	0	0	0	0	0	0	0	0	0	0	0	17.65933	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20.66726	18.7552	0	0	0	20.39961	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KYE0	I3KYE0_ORENI	FLRT1		Fibronectin type-III domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LSLQDNALTHMPR	2.00999999	1512.640318	0	15.09186	14.31339	16.20158	15.80205	0	15.53581	0	0	15.19238	8.495477	14.26338	13.40006	0	0	14.48716	14.2225	0	14.57576	14.95074	14.77062	0	14.40011	0	15.83535	15.54088	15.45853	16.28866	15.65888	0	0	14.37757	19.32355	0	0	0	15.16404	0	0	15.96849	0	0	0	0	0	0	9.315063	0	15.94915	0	14.54814	17.73882	15.59462	16.34717
A0A669DRP3	A0A669DRP3_ORENI	fbln1	extracellular matrix organization [GO:0030198]	Fibulin-1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; calcium ion binding [GO:0005509]; peptidase activator activity [GO:0016504]; extracellular matrix organization [GO:0030198]	calcium ion binding [GO:0005509]; peptidase activator activity [GO:0016504]	TDCCKNGQK	3.269999981	1109.356395	11.58592	12.86912	0	0	13.4184	0	12.08649	13.33508	12.16514	14.00975	14.86373	0	0	12.20329	14.14876	0	13.55349	14.63753	14.38537	14.85062	14.18981	0	16.13676	14.72125	0	0	15.12166	15.02052	0	0	0	0	0	0	0	12.09108	0	12.70464	17.09214	0	13.79142	0	15.22093	8.814429	0	14.42387	0	0	0	13.43437	0	0	15.46825	14.58886
A0A669C9V6	A0A669C9V6_ORENI	FLNB	actin cytoskeleton organization [GO:0030036]; cell differentiation [GO:0030154]	Filamin B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]; actin cytoskeleton organization [GO:0030036]; cell differentiation [GO:0030154]	actin binding [GO:0003779]	AYGPGTR	3.210000038	719.4137029	13.31657	14.99609	13.92991	13.86812	13.29669	8.343197	0	14.63404	15.8779	12.25757	11.42898	13.08204	0	13.83988	13.36748	0	0	0	14.23632	11.71591	14.53172	15.566	15.28716	12.75348	12.7311	14.84063	14.12735	10.24242	12.11537	0	19.12182	19.0556	17.15432	14.01599	14.456	14.15244	0	13.02226	11.62254	0	9.761477	0	12.79326	14.99686	13.9868	14.45552	0	0	13.49357	0	14.85364	0	6.201526	14.78857
A0A669C664	A0A669C664_ORENI			"Filamin C, gamma b (actin binding protein 280)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]	actin binding [GO:0003779]	AKAYGPGIEPR	16.04000092	1159.292606	14.24651	14.14529	13.16156	14.04753	0	14.53022	0	12.10848	14.39822	14.92397	13.42942	0	11.43868	12.46363	14.56517	17.69381	14.05702	14.25667	15.35754	14.53738	12.91178	17.96034	14.10286	14.12411	14.6144	13.73395	12.60171	14.19993	13.19377	12.43076	12.22517	0	0	11.98006	13.31179	18.34802	11.98487	16.63578	14.53209	13.91215	5.731465	14.69898	14.13582	14.09697	15.98736	12.13603	0	0	19.18911	12.90567	13.37642	0	15.53274	14.55713
I3J5W1	I3J5W1_ORENI	LOC100690079		Flavodoxin_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MYDNGIFK	2.890000105	1001.45953	15.3969	13.16831	0	0	13.51342	0	0	0	15.13962	13.96071	0	16.48118	11.57432	0	0	14.47177	14.39223	15.19805	14.25604	15.88874	0	13.59074	0	0	14.83863	14.95673	14.58944	0	14.37178	0	13.35719	0	0	0	0	0	0	0	0	16.42521	17.21867	15.90812	15.57724	0	14.56459	0	14.04061	14.57523	15.72422	0	0	0	15.20582	0
I3K5M2	I3K5M2_ORENI	LOC100710257		Flotillin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endosome [GO:0005768]; membrane [GO:0016020]	endosome [GO:0005768]; membrane [GO:0016020]		EMLAAACQMFMGK	6.860000134	1503.370295	11.12217	13.81322	10.6609	12.88852	13.34781	11.91564	11.65383	0	12.78563	10.64414	14.69597	0	13.96949	13.35072	13.40921	15.57293	0	14.97625	0	13.03512	14.49098	13.25172	14.14841	12.37525	0	14.63653	0	0	12.86968	12.44084	0	16.88957	14.90581	0	11.15378	0	11.67495	0	13.58084	13.01053	12.99248	0	0	0	0	14.89374	14.98649	14.87282	0	14.11709	12.46891	13.23911	0	0
A0A669C3L1	A0A669C3L1_ORENI	kiaa0100		Fmp27_GFWDK domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QHGELLPAR	14.97000027	1021.630434	15.86429	16.22618	15.88415	0	16.37693	15.11794	0	13.61925	12.71814	0	15.86021	15.53759	11.51962	15.8879	0	16.62276	17.29531	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3K4M3	I3K4M3_ORENI			Folliculin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]; cytosol [GO:0005829]; lysosomal membrane [GO:0005765]; microtubule organizing center [GO:0005815]; nucleus [GO:0005634]; spindle [GO:0005819]	cilium [GO:0005929]; cytosol [GO:0005829]; lysosomal membrane [GO:0005765]; microtubule organizing center [GO:0005815]; nucleus [GO:0005634]; spindle [GO:0005819]; GTPase activator activity [GO:0005096]; guanyl-nucleotide exchange factor activity [GO:0005085]	GTPase activator activity [GO:0005096]; guanyl-nucleotide exchange factor activity [GO:0005085]	SHLMTAVR	2.829999924	930.8571973	12.81477	13.98505	11.80552	14.81904	14.30337	0	12.31223	14.1038	13.7428	15.37676	0	14.40069	14.45901	14.64345	13.55514	13.26365	13.20951	13.12544	11.66015	16.76458	13.01632	14.70375	14.96528	15.95869	13.37766	0	14.3946	13.39423	14.57485	14.38741	17.2765	15.3605	14.52063	0	14.55709	14.47272	13.54396	12.28376	14.33117	13.9755	15.67115	13.84494	13.85969	14.70413	14.78426	12.38671	14.65447	12.87001	13.61607	13.02571	14.08807	5.21012	15.27331	12.88668
A0A669D548	A0A669D548_ORENI		one-carbon metabolic process [GO:0006730]	Folylpolyglutamate synthase (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase) (Tetrahydrofolylpolyglutamate synthase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; metal ion binding [GO:0046872]; tetrahydrofolylpolyglutamate synthase activity [GO:0004326]; one-carbon metabolic process [GO:0006730]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; tetrahydrofolylpolyglutamate synthase activity [GO:0004326]	DAAAFLK	1.409999967	736.0034611	14.22468	15.54978	0	13.76482	14.72232	13.08642	13.98141	14.58212	15.47834	15.26294	15.90111	7.363386	13.18507	13.75545	13.4879	13.7153	14.60739	0	12.37904	13.99266	15.4903	15.67911	14.68943	0	13.32644	0	0	0	13.74112	14.55312	0	0	14.76845	15.61681	0	0	0	13.83795	0	0	0	0	15.91005	15.20776	13.06812	0	15.47593	13.51899	15.55955	0	15.40294	0	16.54218	0
I3JU38	I3JU38_ORENI	FOXN2		Fork-head domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	RAGSEGFHSDEDSDLWDER	4.820000172	2207.19255	15.76325	15.11295	13.71395	13.28564	15.02674	16.11545	0	0	16.88599	14.76448	17.07404	0	16.22354	0	15.51887	0	14.75621	16.10291	15.55929	14.44248	15.85982	14.53433	15.46577	0	18.17763	13.58004	15.96264	16.88217	0	0	0	0	17.09786	16.82018	15.0151	14.72189	14.43297	13.65105	14.03406	0	15.04646	14.294	15.68161	15.67361	12.75088	10.56669	13.4322	14.97135	13.34282	14.66108	14.60572	0	0	16.893
I3J5B4	I3J5B4_ORENI			Forkhead box K1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	GVKLSAIPATIR	4.650000095	1224.677462	9.133083	0	11.83348	12.17666	13.06446	10.09304	9.973227	14.41829	12.50441	0	0	0	0	0	0	0	0	0	0	0	0	18.10259	0	14.64973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.00354	0	0	0
A0A669BAD0	A0A669BAD0_ORENI	FOXP2		Forkhead box P2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; metal ion binding [GO:0046872]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; metal ion binding [GO:0046872]; sequence-specific DNA binding [GO:0043565]	GAVWTVDEVEYQR	3.559999943	1552.225858	11.59799	13.52702	14.68416	10.40468	0	14.78323	12.71363	15.66893	14.27372	15.01843	15.57713	12.18999	0	0	14.78265	14.31589	14.14377	14.44726	14.08008	14.71177	13.92225	15.25056	14.88726	10.06415	0	14.74065	0	8.792493	0	12.02868	14.81947	0	16.63454	0	13.59479	12.17406	15.89556	14.53552	13.58638	13.01629	13.79317	0	14.53461	13.60716	0	14.3507	11.2583	15.2612	13.37233	14.18324	15.25502	13.26136	17.0485	12.45422
I3JMN2	I3JMN2_ORENI			Formin 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DVKSSVSNR	3.200000048	991.1362513	13.36799	14.03466	12.09565	10.97532	0	0	15.73004	0	0	0	0	11.21615	0	0	13.27343	0	0	8.507183	13.42171	0	13.31081	0	0	13.55588	14.2257	0	12.20098	13.8265	11.00756	9.677607	15.4281	13.94183	11.9878	14.44147	0	12.09373	11.25598	12.63703	0	14.80176	0	15.62056	0	14.50185	11.28901	13.0436	0	0	0	0	0	0	12.94649	0
A0A669DMT9	A0A669DMT9_ORENI		endocytosis [GO:0006897]; signal transduction [GO:0007165]	Formin binding protein 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]; endocytosis [GO:0006897]; signal transduction [GO:0007165]		DALTKMK	2.440000057	822.1257447	13.56585	14.32677	14.20339	13.78133	11.00834	0	15.79828	12.8368	11.09835	15.27634	14.29769	13.30111	0	12.48053	14.96975	14.63009	0	13.47059	15.30001	0	15.81227	15.03551	0	14.39173	0	0	0	0	0	0	17.34819	16.02233	18.30318	0	0	14.77278	14.87408	0	17.01207	15.44615	13.97705	13.2989	0	13.96173	13.85246	13.10581	13.80194	16.8445	14.45299	13.86089	0	15.04119	12.76818	14.70127
I3JWC0	I3JWC0_ORENI			Formin binding protein 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LPGGAVGRR	7.860000134	882.430962	10.8005	13.11801	14.83428	14.55291	13.80466	12.41375	15.21469	14.96886	13.69818	14.64688	0	0	13.08836	14.14836	0	16.73778	0	13.72599	13.38842	12.27991	13.1305	14.62832	14.53584	14.47971	11.89023	13.24338	14.802	8.607952	0	14.57637	0	0	13.201	11.99502	14.25872	12.69146	14.27662	12.90593	14.51277	12.51114	9.174016	14.29275	14.07338	13.5842	15.18759	16.1267	14.51677	14.93553	15.80545	14.08395	0	0	0	12.14427
I3J414	I3J414_ORENI			Formin homology 2 domain containing 3b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GLTSPPEAETSK	6.400000095	1212.438868	11.55402	9.352361	0	9.338048	0	13.66838	17.09728	0	14.30904	13.20753	0	11.77216	13.42129	12.70427	0	13.33519	13.56604	12.85555	17.67836	12.80348	12.5676	0	13.05694	17.36534	11.57387	12.56425	0	9.410406	0	0	15.71033	15.25646	0	0	13.79369	13.52141	0	0	8.835999	0	0	14.0779	11.38607	12.99183	0	12.66235	16.82513	13.52594	13.69696	0	0	0	0	0
A0A669CQ22	A0A669CQ22_ORENI		actin cytoskeleton organization [GO:0030036]; regulation of cell shape [GO:0008360]	Formin-like 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]; small GTPase binding [GO:0031267]; actin cytoskeleton organization [GO:0030036]; regulation of cell shape [GO:0008360]	actin binding [GO:0003779]; small GTPase binding [GO:0031267]	GMEMTK	11.90999985	729.286305	13.20417	15.90313	15.58441	15.56656	13.43868	14.61683	0	13.95864	10.60979	13.74187	15.11691	15.20794	13.64357	13.10806	15.09818	13.69194	15.10361	14.54656	0	11.09309	0	14.54658	15.37772	0	13.07644	0	14.24323	0	13.8734	14.76639	16.40408	0	16.57402	0	14.39931	0	0	11.08365	13.74779	0	12.47832	15.37038	0	0	13.46224	14.8215	15.56161	12.34432	14.73623	0	14.28603	14.481	0	12.53144
A0A669ECJ7	A0A669ECJ7_ORENI		actin cytoskeleton organization [GO:0030036]; regulation of cell morphogenesis [GO:0022604]	Formin-like 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]; small GTPase binding [GO:0031267]; actin cytoskeleton organization [GO:0030036]; regulation of cell morphogenesis [GO:0022604]	actin binding [GO:0003779]; small GTPase binding [GO:0031267]	KVSGLK	7.25	631.8878943	15.89868	0	14.05229	15.86088	15.79203	16.32187	0	0	0	0	18.14387	0	16.69276	0	13.94978	0	15.32968	0	0	0	0	0	0	0	0	0	0	0	0	18.66221	0	0	0	16.88964	16.10994	0	0	0	0	16.76114	0	16.65631	0	16.84279	0	0	0	0	0	0	0	0	0	0
I3IUC7	I3IUC7_ORENI			Formyl peptide receptor 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; G protein-coupled receptor activity [GO:0004930]	G protein-coupled receptor activity [GO:0004930]	FHWPFGNFMCKLDATTVSLNMFASVYILVVISVDR	10.18000031	4093.484188	12.8205	11.47356	0	0	10.9218	13.35178	0	0	0	0	13.50941	10.87552	11.82333	8.408513	0	0	0	0	0	0	0	10.87759	0	0	0	0	14.0021	9.789067	0	0	14.12893	0	9.557501	0	0	8.787027	11.91531	0	13.27629	13.02081	0	11.12319	0	0	0	0	13.04582	13.64358	17.43185	9.782891	15.93629	0	12.33783	12.6267
I3J3D9	I3J3D9_ORENI	pfas	'de novo' IMP biosynthetic process [GO:0006189]; glutamine metabolic process [GO:0006541]	Formylglycinamide ribonucleotide amidotransferase (EC 6.3.5.3) (Formylglycinamide ribotide amidotransferase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; metal ion binding [GO:0046872]; phosphoribosylformylglycinamidine synthase activity [GO:0004642]; 'de novo' IMP biosynthetic process [GO:0006189]; glutamine metabolic process [GO:0006541]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; phosphoribosylformylglycinamidine synthase activity [GO:0004642]	HLAMMPHPER	11.92000008	1250.553132	15.85479	14.67193	13.84411	13.88846	14.41489	0	15.50125	14.59808	16.27754	14.49342	15.60393	12.73442	0	14.66588	0	14.54232	15.02679	15.75399	15.84441	14.11642	15.45298	0	14.54883	15.76553	16.62415	16.00122	14.18408	16.1102	15.36824	14.87697	0	0	0	0	0	15.11921	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.03656
I3JX78	I3JX78_ORENI	fyttd1	mRNA export from nucleus [GO:0006406]	Forty-two-three domain-containing protein 1 (UAP56-interacting factor)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nuclear speck [GO:0016607]	nuclear speck [GO:0016607]; mRNA binding [GO:0003729]; mRNA export from nucleus [GO:0006406]	mRNA binding [GO:0003729]	VDMSLDDIIR	2.369999886	1193.02433	13.32751	14.52573	13.23144	13.04857	15.39018	0	16.51649	0	15.84128	14.86622	0	16.30009	0	0	16.28152	0	12.71563	16.85216	0	17.33933	0	0	15.62719	18.00468	0	0	0	0	0	0	15.93715	0	0	14.89734	0	0	0	0	0	0	0	0	13.09848	0	13.64038	0	17.4816	0	0	16.17628	0	0	0	0
I3KW15	I3KW15_ORENI	ald	glycolytic process [GO:0006096]	Fructose-bisphosphate aldolase (EC 4.1.2.13)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		fructose-bisphosphate aldolase activity [GO:0004332]; glycolytic process [GO:0006096]	fructose-bisphosphate aldolase activity [GO:0004332]	LAIIENANVLAR	55.95000076	1296.345895	15.98767	14.18102	15.49408	13.31659	0	15.28428	16.3322	15.91419	14.07411	15.5851	14.76619	13.42854	15.46067	15.19573	12.55058	15.93712	0	0	15.75555	0	14.9695	12.7276	14.20505	13.97635	15.81239	16.95048	14.74109	0	15.01818	16.24597	17.06216	17.02791	15.14441	13.57106	0	15.73649	14.1755	16.71612	0	17.22945	0	17.24289	14.90679	0	0	16.04126	17.68903	15.42993	15.41438	16.95381	13.30154	0	18.11452	17.61634
A0A669EBG5	A0A669EBG5_ORENI	mrm2	RNA methylation [GO:0001510]	FtsJ domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		methyltransferase activity [GO:0008168]; RNA methylation [GO:0001510]	methyltransferase activity [GO:0008168]	DPYVKASQAQNFR	8.220000267	1524.609019	15.01804	0	0	14.70624	15.10925	14.45626	0	11.93089	13.51137	0	14.94177	14.97735	0	0	0	15.33102	14.21426	16.00157	12.935	12.32752	13.20762	14.71826	14.57343	13.56397	0	12.88904	13.25616	0	0	13.16953	17.0443	16.13618	17.20901	0	13.83019	14.41008	12.70777	13.15604	0	12.93209	11.61313	14.97958	0	13.67808	14.62238	0	12.85243	12.37802	14.83256	6.902016	13.97487	12.33942	0	10.66861
I3J111	I3J111_ORENI	fpgt		Fucokinase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"nucleotide binding [GO:0000166]; transferase activity, transferring phosphorus-containing groups [GO:0016772]"	"nucleotide binding [GO:0000166]; transferase activity, transferring phosphorus-containing groups [GO:0016772]"	ERLSS	5.760000229	591.1504221	14.06361	14.519	16.08629	0	14.51562	15.16246	16.0545	15.36493	13.06543	15.68994	15.32492	0	15.74486	14.85275	0	15.19705	15.32128	15.49806	14.90838	15.50629	14.0109	15.82286	13.11931	15.64404	15.66976	15.87389	16.0607	15.63932	15.0728	15.49131	16.38912	17.05552	16.6814	15.60451	15.69799	0	15.39972	15.03496	15.46388	14.70518	0	14.98381	15.80143	16.04754	14.94827	14.63223	14.94653	0	15.64685	0	0	14.64087	15.04731	15.95233
A0A669F8Z3	A0A669F8Z3_ORENI		protein glycosylation [GO:0006486]	Fucosyltransferase 9a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi cisterna membrane [GO:0032580]; integral component of membrane [GO:0016021]	Golgi cisterna membrane [GO:0032580]; integral component of membrane [GO:0016021]; fucosyltransferase activity [GO:0008417]; protein glycosylation [GO:0006486]	fucosyltransferase activity [GO:0008417]	TAKSPR	1.730000019	657.2668596	14.77895	15.99802	15.93319	13.69959	13.85691	15.34889	16.28283	15.50405	15.78209	14.86207	0	15.36702	17.42602	17.60321	17.09854	16.02239	16.97806	17.16411	14.52489	17.36563	16.09412	15.64045	15.89297	0	0	16.09447	0	14.24377	14.791	0	18.2449	0	17.60235	16.05705	0	15.13426	14.53252	14.71191	14.33416	16.3781	16.32709	15.76249	15.84088	13.83763	15.28909	15.00798	15.78342	16.43809	14.52023	16.2515	15.139	15.31708	13.09331	13.9138
I3KYC9	I3KYC9_ORENI	FH	fumarate metabolic process [GO:0006106]; tricarboxylic acid cycle [GO:0006099]	"Fumarate hydratase, mitochondrial (EC 4.2.1.2)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	tricarboxylic acid cycle enzyme complex [GO:0045239]	tricarboxylic acid cycle enzyme complex [GO:0045239]; fumarate hydratase activity [GO:0004333]; fumarate metabolic process [GO:0006106]; tricarboxylic acid cycle [GO:0006099]	fumarate hydratase activity [GO:0004333]	MASSDYRIER	6.429999828	1228.538224	12.52046	13.69153	13.09008	0	16.23622	0	0	12.82898	0	10.42646	11.97331	14.66272	12.79794	12.223	0	12.89279	0	11.56113	14.0162	0	13.39373	0	0	0	12.72672	14.2621	0	0	0	18.66964	17.25516	10.97162	8.467952	0	0	10.86261	10.70713	14.22276	0	0	13.8817	0	0	0	0	14.49874	9.933491	0	9.906517	13.75764	0	18.14263	0	15.07978
A0A669E8K6	A0A669E8K6_ORENI		cell morphogenesis [GO:0000902]	Furry homolog a (Drosophila)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cell morphogenesis [GO:0000902]		HQRSSSVPK	4.639999866	1025.500615	13.86721	14.09834	0	0	17.78261	14.44326	15.57922	15.97682	15.9992	0	15.42353	13.23356	13.40501	0	13.12119	12.82292	0	9.45287	15.3256	0	0	12.80436	14.83015	14.12704	13.96558	15.14513	13.54777	0	0	7.378663	10.27794	15.16438	15.14454	17.67036	0	18.4523	16.09382	6.566303	14.7434	9.581107	12.33509	15.04202	18.05227	16.60673	15.10306	0	15.03764	10.47888	17.41031	14.53121	15.01583	15.43967	15.94253	14.06087
I3K4B0	I3K4B0_ORENI		cell morphogenesis [GO:0000902]	Furry homolog b (Drosophila)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cell morphogenesis [GO:0000902]		GPVVMAPVNVDPESKPGEFVLK	6.789999962	2325.118002	12.56141	12.6687	14.04848	4.705976	12.64906	11.47085	0	11.16825	10.18106	13.5942	14.04656	0	0	10.95142	12.89013	0	0	14.99665	11.637	9.713358	0	11.7379	0	0	0	0	0	9.752773	0	0	0	0	0	0	0	0	0	0	13.35593	14.81417	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669BIE0	A0A669BIE0_ORENI		cell morphogenesis [GO:0000902]	"Furry homolog, like"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cell morphogenesis [GO:0000902]		EQSPHVVQSIISLIMGMK	6.980000019	2028.62298	12.99537	10.14343	11.92642	12.98085	13.79441	13.54258	12.67549	0	14.07682	0	15.29098	0	13.9394	18.02332	0	14.8634	0	13.27641	12.77147	0	12.68243	0	0	13.60561	11.8167	11.04205	0	11.16641	0	14.46628	11.46085	0	13.61872	10.04749	0	0	0	9.242099	12.31957	12.11343	12.16322	13.50363	0	0	12.88021	13.07799	13.73163	9.377273	13.07909	14.7154	16.09328	0	12.39882	9.645483
I3KKF0	I3KKF0_ORENI	GPR139		G protein-coupled receptor 139	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; neuropeptide receptor activity [GO:0008188]	neuropeptide receptor activity [GO:0008188]	LRGYSTGK	13.76000023	880.0758464	13.63334	13.03055	0	0	14.58711	13.79136	11.34031	15.82929	15.21971	12.89345	13.91091	15.35795	15.51201	13.47524	14.91185	15.47855	14.45103	13.74004	14.31054	15.04609	14.68975	12.98076	0	14.28038	16.01664	15.43679	14.80995	14.22256	17.92921	15.16054	0	0	0	0	15.5617	0	0	0	17.24994	14.67428	0	0	0	14.43997	14.55613	0	14.05824	0	0	0	15.1182	15.42731	15.22956	0
A0A669C7D5	A0A669C7D5_ORENI			G protein-coupled receptor 37 like 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; G protein-coupled receptor activity [GO:0004930]	G protein-coupled receptor activity [GO:0004930]	GAKDGGFR	10.06999969	806.5832276	10.74044	15.77864	14.37824	13.6219	13.80429	0	13.95863	10.7912	15.26568	15.92902	9.946119	13.63759	15.11123	15.41313	13.72404	0	13.67036	14.27791	14.65658	0	0	0	15.0506	13.74304	14.54065	14.98712	0	0	0	13.92624	17.05262	17.61619	17.37764	0	0	14.77908	14.73785	12.76515	14.67001	0	14.46787	16.06992	13.6375	13.38735	14.76152	14.42527	15.6145	14.01523	14.02991	15.33229	17.01026	15.84756	15.22736	0
I3J8Q0	I3J8Q0_ORENI	LOC100694101	cone photoresponse recovery [GO:0036368]; signal transduction [GO:0007165]	G protein-coupled receptor kinase (EC 2.7.11.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; G protein-coupled receptor kinase activity [GO:0004703]; rhodopsin kinase activity [GO:0050254]; cone photoresponse recovery [GO:0036368]; signal transduction [GO:0007165]	ATP binding [GO:0005524]; G protein-coupled receptor kinase activity [GO:0004703]; rhodopsin kinase activity [GO:0050254]	DTTSGYAGTPGFMAPELLQK	11.09000015	2083.296911	12.10491	14.5304	13.13261	14.60098	10.23928	0	14.51231	12.39356	16.98486	13.03923	13.78941	14.66442	17.21263	12.95925	14.75206	14.22904	12.31538	13.346	12.67561	0	0	0	14.80682	12.33446	0	12.12432	14.48207	0	12.58014	13.5192	15.52525	15.48099	0	0	0	0	12.88912	0	0	12.19388	11.49512	0	12.18145	0	0	12.76794	12.72007	10.77977	13.51454	0	15.44446	0	0	0
I3KJB6	I3KJB6_ORENI	gpkow		G-patch domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	ELIEDSRR	15.32999992	1018.377915	13.69459	14.01384	14.05464	18.63363	9.991339	15.52844	14.02028	0	9.793802	16.43874	8.920539	14.03531	12.97794	0	14.84196	15.88516	14.47573	16.32579	14.69867	0	0	15.13625	14.19492	14.9836	13.70824	14.04283	0	14.54812	0	15.92243	0	15.97011	13.911	14.80719	13.68524	14.05733	15.53602	14.57593	13.22382	13.79403	13.84406	14.32841	14.08322	14.27656	19.95	10.91034	15.14303	12.16655	12.97853	15.01285	15.97269	16.65334	11.37764	13.00451
A0A669CRA4	A0A669CRA4_ORENI	ccnb3	regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]; regulation of G2/M transition of mitotic cell cycle [GO:0010389]	G2/mitotic-specific cyclin-B3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein kinase binding [GO:0019901]; regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]; regulation of G2/M transition of mitotic cell cycle [GO:0010389]	protein kinase binding [GO:0019901]	TAFIDITNAHK	6.659999847	1231.27268	12.40197	0	12.99019	12.55961	0	13.53295	17.97734	10.56169	0	0	9.385399	0	19.26574	12.61388	0	14.47787	0	0	0	12.50981	18.63043	11.43083	15.05735	0	10.48672	17.21775	18.29053	0	13.30472	0	0	0	14.7787	0	0	10.91573	12.01315	0	13.52125	0	0	9.902214	0	14.39637	13.60311	12.46584	0	8.718881	0	12.71787	13.10544	0	0	14.02413
A0A669DAE3	A0A669DAE3_ORENI	gabra2	gamma-aminobutyric acid signaling pathway [GO:0007214]	GABA(A) receptor subunit alpha-2 (Gamma-aminobutyric acid receptor subunit alpha-2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chloride channel complex [GO:0034707]; cytoplasmic vesicle membrane [GO:0030659]; dendrite [GO:0030425]; postsynaptic membrane [GO:0045211]	chloride channel complex [GO:0034707]; cytoplasmic vesicle membrane [GO:0030659]; dendrite [GO:0030425]; postsynaptic membrane [GO:0045211]; chloride channel activity [GO:0005254]; extracellular ligand-gated ion channel activity [GO:0005230]; GABA-A receptor activity [GO:0004890]; gamma-aminobutyric acid signaling pathway [GO:0007214]	chloride channel activity [GO:0005254]; extracellular ligand-gated ion channel activity [GO:0005230]; GABA-A receptor activity [GO:0004890]	TVFGVTTVLTMTTLSISARNSLPK	1.480000019	2553.013395	11.05957	3.926805	10.49094	0	11.42505	0	11.18801	0	0	0	0	0	0	0	10.45931	0	19.13863	0	0	0	0	0	0	15.70859	0	0	0	14.46293	12.77021	0	12.76583	0	9.025523	0	14.19284	0	12.55032	13.72758	9.589178	12.82308	13.38921	0	0	10.08219	0	0	0	0	0	0	0	0	13.5679	0
I3J2H9	I3J2H9_ORENI	LOC100694214	negative regulation of transcription by RNA polymerase II [GO:0000122]	GATA-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]; negative regulation of transcription by RNA polymerase II [GO:0000122]	sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	AGEVKATIK	12.77000046	913.2976107	0	0	14.21879	11.96527	13.82178	12.22439	0	15.10696	0	14.45013	14.30315	14.20124	16.08955	12.74384	14.80674	0	16.00408	0	14.73015	14.58043	0	14.46524	15.14161	13.42669	15.69284	15.45031	14.90992	14.06736	16.53307	12.16394	0	0	16.82927	15.22139	0	0	14.69253	13.39902	13.60657	15.05802	14.72858	14.26427	0	13.31176	13.76311	0	14.43817	13.73036	0	13.39773	13.76244	15.31547	14.09711	0
A0A669C085	A0A669C085_ORENI	LOC100695949		GB1/RHD3-type G domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	HVIGLPR	5.570000172	792.523841	11.60418	13.4203	13.73654	14.52198	13.87227	14.36069	15.60549	17.773	13.02137	14.40586	14.45749	14.11133	14.98284	0	14.45134	15.37369	15.10317	15.11327	15.31944	0	15.75533	16.23633	16.4161	0	0	0	0	15.00546	0	0	16.86982	15.88369	16.18851	15.64297	0	16.67953	0	0	0	0	0	0	0	0	13.14833	15.23977	14.75903	16.75698	0	16.34911	0	15.97126	0	0
I3KG96	I3KG96_ORENI		positive regulation of kinase activity [GO:0033674]; regulation of translation [GO:0006417]	GCN1 activator of EIF2AK4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein kinase binding [GO:0019901]; protein kinase regulator activity [GO:0019887]; ribosome binding [GO:0043022]; positive regulation of kinase activity [GO:0033674]; regulation of translation [GO:0006417]	protein kinase binding [GO:0019901]; protein kinase regulator activity [GO:0019887]; ribosome binding [GO:0043022]	KMAAQIIGNMYSLTDQK	1.139999986	1943.67097	13.77937	16.14491	0	12.25666	15.048	17.53695	0	14.91291	11.3272	0	14.77812	13.9334	16.00657	15.34467	0	0	0	0	9.883103	0	0	0	0	0	16.50359	0	15.18497	16.66861	0	0	14.10096	0	16.17752	0	0	13.08925	14.59679	16.64662	14.53061	0	12.10626	0	0	0	0	0	16.09555	0	15.94923	14.26818	0	0	0	17.45057
I3JSR5	I3JSR5_ORENI	iba57	heme biosynthetic process [GO:0006783]	GCV_T domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		heme biosynthetic process [GO:0006783]		GALASASGLGVYAR	7.349999905	1293.662613	0	16.08024	0	15.51122	0	0	13.03783	0	12.20438	14.36205	0	8.989595	14.37705	13.75121	12.97707	16.56555	13.84319	15.36434	0	14.26049	18.43793	14.58431	15.50011	15.17022	0	14.64233	0	12.95653	0	14.16657	17.15045	13.80377	18.33563	0	0	15.07653	0	0	12.11165	15.0135	13.28749	0	12.07366	0	0	0	0	15.60274	14.71997	13.84554	15.73379	17.54972	0	0
A0A669CEY9	A0A669CEY9_ORENI	gmds	'de novo' GDP-L-fucose biosynthetic process [GO:0042351]; GDP-mannose metabolic process [GO:0019673]	GDP-D-mannose dehydratase (EC 4.2.1.47)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"GDP-mannose 4,6-dehydratase activity [GO:0008446]; 'de novo' GDP-L-fucose biosynthetic process [GO:0042351]; GDP-mannose metabolic process [GO:0019673]"	"GDP-mannose 4,6-dehydratase activity [GO:0008446]"	SSSFNTGR	5.260000229	856.372881	13.35298	15.4057	0	13.3635	13.39084	10.92595	13.93657	0	12.59295	0	11.47273	14.2996	15.20333	0	15.54201	15.57211	15.17349	15.24077	0	13.05584	12.66232	16.26261	0	0	10.12103	0	0	14.50113	14.69474	0	0	15.46403	14.07017	14.94795	0	14.41622	15.15399	0	12.24227	15.33835	0	14.32188	12.4958	0	0	0	0	15.13669	0	0	13.43378	0	14.61148	13.66361
A0A669DYA9	A0A669DYA9_ORENI	LOC100709652		GFO_IDH_MocA domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	TLPPGDHR	8.739999771	891.1675903	0	12.06555	14.7288	0	12.49156	14.59465	11.9076	15.33466	10.50941	15.38229	13.39731	12.78177	13.57144	12.69116	13.20212	0	0	0	12.27742	13.15943	0	0	12.94843	15.23184	13.89173	0	0	13.086	0	0	12.55591	0	0	16.39721	0	0	13.26762	0	13.95839	11.54843	12.90493	0	0	14.35519	14.56011	0	11.39935	0	15.39401	12.70819	11.42906	0	0	13.01521
A0A669EZ51	A0A669EZ51_ORENI			GH3 domain containing	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VSEALFLSALK	3.769999981	1177.778803	12.4547	0	13.28913	0	0	0	0	0	13.77715	14.72915	13.75427	14.93135	15.17333	15.08801	11.95565	0	13.44557	14.07955	0	0	0	0	14.7418	0	0	0	0	0	0	0	0	0	16.9079	0	0	0	0	0	0	0	0	0	0	0	0	0	16.20428	0	0	0	0	0	0	0
A0A669BHB6	A0A669BHB6_ORENI	gins1	DNA replication [GO:0006260]	GINS complex subunit 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	GINS complex [GO:0000811]	GINS complex [GO:0000811]; DNA replication [GO:0006260]		CVTAYLYDR	6.929999828	1156.846932	13.32993	14.43577	0	14.04868	16.12665	0	0	12.25028	0	0	13.12446	0	0	0	12.18095	13.00912	13.34171	10.5504	0	14.58817	12.16653	0	12.18779	13.40693	13.63366	13.97166	14.86508	0	13.57672	16.25062	17.71469	0	18.75238	0	12.26752	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.3949	15.05236	0	0
I3K8V8	I3K8V8_ORENI	gle1	poly(A)+ mRNA export from nucleus [GO:0016973]	GLE1-like protein (Nucleoporin GLE1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nuclear pore [GO:0005643]	nuclear pore [GO:0005643]; poly(A)+ mRNA export from nucleus [GO:0016973]		LREAELER	10.5	1014.437014	13.96565	0	0	15.51427	0	12.5054	15.42085	14.7235	14.58428	15.99142	15.95802	16.39852	0	0	0	0	0	0	0	15.44301	0	0	0	17.02042	16.1212	0	0	0	0	0	0	15.36462	0	0	0	15.94837	0	14.93363	0	15.86258	0	19.47517	0	0	17.63139	16.20599	16.68568	15.37871	0	0	0	16.16662	0	0
A0A669BYH6	A0A669BYH6_ORENI	LOC100702704		GLOBIN domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	hemoglobin complex [GO:0005833]	hemoglobin complex [GO:0005833]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; oxygen binding [GO:0019825]; oxygen carrier activity [GO:0005344]	heme binding [GO:0020037]; metal ion binding [GO:0046872]; oxygen binding [GO:0019825]; oxygen carrier activity [GO:0005344]	GKMSLSAK	6.929999828	819.6576959	14.48612	13.33815	17.67177	15.23757	16.12415	14.08004	16.01863	13.44392	13.07672	15.77668	0	15.1481	16.16879	0	0	15.46406	15.64654	0	0	15.53086	15.91764	0	0	0	0	16.23006	16.70589	16.59234	0	16.46672	16.04102	0	0	0	17.74867	16.77672	0	15.43069	15.10676	0	0	16.5628	0	15.55719	16.27267	0	18.49316	15.77885	16.64474	17.88944	17.00601	18.28511	13.35024	17.69461
A0A669CQI9	A0A669CQI9_ORENI	plekha8		GLTP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; lipid transfer activity [GO:0120013]	lipid transfer activity [GO:0120013]	MAGGAGNSQSLPYR	4.909999847	1425.397794	0	14.15863	14.71668	16.85624	0	13.17411	0	13.98612	0	14.56977	15.41162	0	16.03759	12.21665	0	0	15.85755	0	13.02972	14.74412	0	0	0	12.538	0	16.48893	15.26869	0	0	0	0	0	0	14.03765	0	0	14.08682	15.03608	0	0	0	0	0	14.18579	0	0	0	0	0	0	0	15.31076	0	15.98347
I3KWM4	I3KWM4_ORENI	ghrh		GLUCAGON domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; hormone activity [GO:0005179]	hormone activity [GO:0005179]	GVHGNVLRPRLLS	4.150000095	1414.05952	15.57886	13.33121	14.53382	15.49434	13.50887	10.22537	15.09304	15.04131	15.42809	13.25389	13.15848	0	16.4386	16.7571	13.91633	16.04457	15.22246	13.54165	13.61639	13.98915	15.11005	15.02833	15.9433	14.05304	0	14.18784	14.90938	15.47806	17.03623	16.07516	20.41674	17.60435	17.68245	0	14.77689	14.91927	14.39394	14.80076	15.23503	16.18222	12.78448	14.14673	14.01636	15.55911	14.72471	19.00199	19.50777	19.58653	16.35234	0	0	16.89111	15.54591	0
A0A669AZG7	A0A669AZG7_ORENI	LOC100702364 GMPR	purine nucleobase metabolic process [GO:0006144]; purine nucleotide metabolic process [GO:0006163]	GMP reductase (GMPR) (EC 1.7.1.7) (Guanosine 5'-monophosphate oxidoreductase) (Guanosine monophosphate reductase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	GMP reductase complex [GO:1902560]	GMP reductase complex [GO:1902560]; GMP reductase activity [GO:0003920]; metal ion binding [GO:0046872]; purine nucleobase metabolic process [GO:0006144]; purine nucleotide metabolic process [GO:0006163]	GMP reductase activity [GO:0003920]; metal ion binding [GO:0046872]	MFYGMSSDTAMK	7.630000114	1384.231865	14.81024	14.69826	14.15928	0	14.18784	0	14.67673	14.36211	0	15.17036	0	0	16.16126	0	0	14.25111	0	0	15.13516	14.04756	13.34007	0	15.30147	12.82261	14.61516	0	15.38972	14.77199	16.15419	0	14.08726	16.64214	14.18367	15.27627	15.02546	0	14.80724	14.14227	14.4558	14.32154	0	14.68516	14.90949	15.81919	11.58204	0	0	0	15.53174	15.94078	0	0	0	0
I3KDK3	I3KDK3_ORENI	tmed10		GOLD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]		SPMGTGRVPDQLVNLDMK	4.869999886	1990.528901	0	13.33792	10.9963	10.74362	0	11.05249	0	13.15386	0	0	13.3547	0	0	0	0	0	15.02812	0	0	0	0	0	16.70971	15.89617	15.12125	0	0	0	0	0	0	14.74878	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.64631	0	0	0	0	0	0
A0A669DVY1	A0A669DVY1_ORENI		GPI anchor biosynthetic process [GO:0006506]	GPI ethanolamine phosphate transferase 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; mannose-ethanolamine phosphotransferase activity [GO:0051377]; GPI anchor biosynthetic process [GO:0006506]	mannose-ethanolamine phosphotransferase activity [GO:0051377]	NGTKAPK	7.460000038	716.7550141	14.74555	12.6779	13.73681	12.87704	14.08365	13.81848	13.85724	0	14.59981	16.03514	15.07892	0	14.88398	14.79796	0	0	12.11577	14.42572	16.38488	0	14.43651	15.66976	0	11.05461	13.29558	10.3536	14.75918	13.71716	13.21357	13.25542	18.30279	17.51103	17.23052	15.76856	14.94504	0	14.32155	13.91329	14.14693	13.45518	14.53092	15.3533	14.26195	15.96205	14.27799	0	0	14.98546	15.28262	13.65041	0	0	15.34675	0
A0A669EEB6	A0A669EEB6_ORENI		lipid transport [GO:0006869]	GRAM domain containing 1A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; lipid transport [GO:0006869]		LIVDYSCALQKDILLQGR	1.070000052	2105.710781	0	0	0	0	0	14.36234	0	0	14.04163	13.69662	0	0	5.450712	0	0	0	0	0	0	14.6906	12.22355	0	0	0	0	0	10.20527	0	12.96346	0	0	19.98155	16.43118	15.51379	0	0	0	0	0	0	0	0	13.76403	0	0	0	0	14.59896	14.43401	0	0	0	13.59129	0
I3K9A3	I3K9A3_ORENI			GRAM domain containing 1c	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SEASLAAEYGPK	2.440000057	1223.780478	0	0	13.27226	12.83118	11.24232	12.91765	12.56216	0	0	0	14.89205	0	0	0	13.73027	12.76573	0	17.68549	12.17882	13.89253	0	0	10.90076	0	15.26962	14.65483	11.72125	12.12288	12.87441	0	10.89629	0	0	11.14689	13.44151	11.22833	0	0	0	0	0	12.31322	0	0	14.82469	0	0	0	0	0	0	0	0	0
A0A669CBF9	A0A669CBF9_ORENI		apoptotic process [GO:0006915]	GRAM domain containing 4a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; apoptotic process [GO:0006915]		QQKEVWSSR	6.539999962	1146.610668	14.2091	13.5738	13.85764	12.68838	10.24378	14.49377	15.04599	17.23012	16.85945	14.41518	0	13.25827	15.12967	12.66018	0	14.43746	0	14.99263	14.32301	14.20679	14.83758	13.36452	14.80801	14.15587	14.29993	15.838	13.44629	14.90337	13.95077	8.846243	14.49849	0	0	12.90596	0	0	15.22217	16.68013	0	14.30097	15.17534	12.4659	15.96117	13.88546	0	0	14.37264	0	0	14.93605	14.47431	15.32244	0	14.76162
I3KVB7	I3KVB7_ORENI			GRB10 interacting GYF protein 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SYLGDTVEAK	8.989999771	1083.130154	0	12.56485	0	8.56202	15.70578	11.53394	12.32245	0	0	0	0	13.39628	0	0	0	0	0	12.54535	13.61748	12.11397	10.01952	15.35384	15.47773	16.23319	0	0	7.126372	0	3.890977	12.05001	15.32308	0	15.82001	13.41167	12.12522	0	0	12.5631	14.59717	0	15.43816	14.9084	0	0	5.638634	0	0	0	15.02286	21.18185	14.05237	0	0	0
I3JDY0	I3JDY0_ORENI			"GRB2 associated, regulator of MAPK1-like"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TVVLCMVLR	9.199999809	1104.554723	11.71103	12.38084	0	0	0	0	0	13.53738	14.33786	17.66888	16.33641	11.98793	13.41821	14.85834	11.17799	12.10904	14.75472	15.36274	13.54937	15.17874	14.92798	18.68408	14.64895	0	0	0	14.09873	14.08373	14.80099	0	0	0	13.99322	11.82708	13.06278	10.6803	11.59696	17.46127	8.077934	0	14.39205	0	12.6758	18.23841	10.25714	0	0	0	15.94162	0	15.55702	11.90901	0	0
A0A669CXX0	A0A669CXX0_ORENI			GRIN_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QGTNPK	7.929999828	642.0171542	0	16.25042	16.24925	15.7796	16.14991	0	0	17.07151	15.12682	15.72578	15.98212	15.75819	16.91908	14.72819	0	0	16.5928	16.9783	16.49836	18.24609	16.65149	17.10516	16.55442	0	16.92883	17.25843	16.27725	16.72284	17.11769	16.85032	17.32294	16.25692	16.60584	13.98026	0	16.60246	16.83171	17.16981	16.75679	15.68278	0	16.73423	17.65724	16.6982	15.85989	16.92458	16.76956	0	15.47315	15.44928	0	16.61118	17.83743	16.45194
I3J9C3	I3J9C3_ORENI	GCC2		GRIP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EKVNSSMK	15.60999966	922.5018542	18.39222	17.0993	16.73432	17.35199	0	16.81434	16.98863	0	0	0	0	16.43095	14.7943	20.08937	0	0	17.38159	12.36904	0	16.86377	0	0	16.03614	0	0	0	0	19.93405	0	15.88359	15.51028	0	0	19.1639	15.26554	16.78363	0	13.91205	16.76167	0	0	0	0	15.01211	13.91027	15.35	0	11.28561	0	0	0	0	0	0
I3KFY8	I3KFY8_ORENI	LOC100697052	"7,8-dihydroneopterin 3'-triphosphate biosynthetic process [GO:0035998]; tetrahydrobiopterin biosynthetic process [GO:0006729]; tetrahydrofolate biosynthetic process [GO:0046654]"	GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"GTP cyclohydrolase I activity [GO:0003934]; 7,8-dihydroneopterin 3'-triphosphate biosynthetic process [GO:0035998]; tetrahydrobiopterin biosynthetic process [GO:0006729]; tetrahydrofolate biosynthetic process [GO:0046654]"	GTP cyclohydrolase I activity [GO:0003934]	VHIGYIPNK	7.079999924	1041.316285	0	0	14.53541	14.71521	0	15.02287	18.96955	0	11.69321	0	15.00032	0	13.9208	10.85909	0	13.24792	13.67326	10.34155	0	0	15.75216	0	0	0	0	0	0	0	0	12.21422	0	15.84605	0	13.50517	13.01492	15.82923	14.83092	0	0	15.40087	0	0	0	0	14.82054	14.55763	0	0	0	0	0	0	0	0
A0A669BMS1	A0A669BMS1_ORENI	LOC100709644		GTP-binding protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	DMEASVATVR	6.519999981	1095.647472	9.856539	0	16.43353	0	0	0	0	0	0	20.0426	0	15.23066	17.53762	0	0	17.52193	13.98484	0	18.03885	13.81442	0	0	14.19608	16.00921	0	14.62088	0	0	0	11.24251	0	19.43219	13.83669	0	0	14.70643	13.2139	13.61855	15.46297	0	14.40168	15.45146	0	0	15.98464	9.937343	0	0	14.82683	15.5013	14.71683	19.77637	11.21273	16.72008
I3J9U9	I3J9U9_ORENI	GTPBP8		GTP-binding protein 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]; metal ion binding [GO:0046872]	GTP binding [GO:0005525]; metal ion binding [GO:0046872]	TPGHTKK	21.45000076	768.4561984	17.35108	17.53524	16.9828	18.19588	18.91523	19.04091	17.78167	19.51273	18.79565	19.4408	19.34282	19.31189	19.02971	19.35407	18.80801	20.30469	19.87081	16.95006	0	18.55231	17.6228	18.94507	17.2917	16.41524	0	16.15689	16.02612	17.68467	19.20879	17.96158	18.0616	18.36476	17.40725	18.70395	19.3106	18.00499	18.43443	17.82101	17.71689	18.94016	18.58476	18.64842	18.9676	18.12325	18.81573	17.34272	17.57048	18.0803	17.55784	18.36242	19.3294	17.69197	0	16.47611
A0A669E136	A0A669E136_ORENI	gigyf2		GYF domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GDGGFYQRSFDDVEGFGR	1.340000033	2009.175046	0	9.294793	15.51337	0	9.839338	13.60415	13.77131	11.23224	0	0	11.00127	10.68459	12.79951	0	0	15.94025	0	12.2397	0	0	0	0	15.44457	0	0	0	11.5099	0	0	0	0	0	0	0	0	0	0	0	15.09692	0	0	0	0	13.66159	0	14.72134	0	8.744525	0	0	14.20087	11.86539	0	0
A0A669E1L8	A0A669E1L8_ORENI	F2R	blood coagulation [GO:0007596]	G_PROTEIN_RECEP_F1_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; thrombin-activated receptor activity [GO:0015057]; blood coagulation [GO:0007596]	thrombin-activated receptor activity [GO:0015057]	MAMVLVSRK	3.640000105	1035.449989	14.31273	14.06811	12.02427	10.24695	13.03662	13.02239	0	0	0	0	15.77731	14.87831	0	18.44093	0	13.80357	0	13.2603	17.29547	14.98396	12.83908	13.7853	13.77463	14.33139	0	0	11.84603	13.43731	13.34875	15.28532	0	0	12.88367	13.52968	13.96893	11.92726	12.68348	12.70052	11.32443	13.80844	13.86241	14.80057	0	15.18799	15.13039	0	14.22314	0	12.96982	0	16.12115	12.90025	0	9.65198
A0A669E9X8	A0A669E9X8_ORENI	LOC100689817		G_PROTEIN_RECEP_F3_4 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; G protein-coupled receptor activity [GO:0004930]	G protein-coupled receptor activity [GO:0004930]	LLQVLKK	8.840000153	841.8912058	12.39623	15.27629	0	15.02172	14.18195	0	0	0	0	14.79893	13.80659	14.18078	0	13.77836	0	0	14.88901	0	14.09043	14.74811	0	0	16.08759	13.67719	0	0	15.1832	0	13.18467	12.58992	14.6521	14.71665	0	0	15.73128	15.2286	0	0	14.78103	0	13.00662	0	15.19916	0	0	0	14.16599	13.71017	0	0	0	0	0	0
A0A669C5T6	A0A669C5T6_ORENI	ganab	carbohydrate metabolic process [GO:0005975]	Gal_mutarotas_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"carbohydrate binding [GO:0030246]; hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]; carbohydrate metabolic process [GO:0005975]"	"carbohydrate binding [GO:0030246]; hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]"	WISESGIIDIFIMLGPTPK	7.71999979	2134.266274	12.13782	12.11609	13.8857	0	17.05215	0	0	0	13.52896	9.959814	0	0	10.66754	0	0	0	13.21771	0	13.0285	12.84247	12.60633	14.18291	0	0	0	9.162088	0	0	12.74371	0	0	0	0	14.18321	0	0	16.04358	15.08241	11.56754	13.32757	13.29527	10.65301	11.36058	0	14.91479	12.07437	0	0	0	14.97882	0	15.63139	15.3252	0
I3JMR0	I3JMR0_ORENI		galactose metabolic process [GO:0006012]	Galactokinase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; galactokinase activity [GO:0004335]; galactose metabolic process [GO:0006012]	ATP binding [GO:0005524]; galactokinase activity [GO:0004335]	HVIEEIQRTVQAAK	2.940000057	1622.405723	15.9796	14.958	15.31	0	11.21245	15.02001	10.58262	0	0	14.00851	0	16.02332	16.13232	15.47476	15.78119	15.79536	7.565217	16.42598	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.88868	0	0	0
A0A669CC03	A0A669CC03_ORENI		galactose metabolic process [GO:0006012]	Galactokinase 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; galactokinase activity [GO:0004335]; galactose metabolic process [GO:0006012]	ATP binding [GO:0005524]; galactokinase activity [GO:0004335]	ATNPPK	3.720000029	625.7333643	0	0	14.20339	15.54028	17.16762	16.19922	14.94422	15.43322	0	0	15.4268	0	0	15.67104	0	0	12.6282	15.80303	17.69061	16.87086	13.75867	14.7925	0	15.4998	16.12466	0	15.71212	14.59526	0	16.9638	16.07035	0	17.11331	0	0	0	0	16.56241	0	0	0	0	16.8224	0	17.29405	15.45822	15.94819	0	0	16.91431	0	0	16.85143	0
I3JNZ7	I3JNZ7_ORENI	LOC100695382		Galectin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		carbohydrate binding [GO:0030246]	carbohydrate binding [GO:0030246]	SMELELK	3.289999962	865.7326073	0	3.063311	0	12.35005	0	0	15.60803	12.2502	13.53717	0	10.33318	0	13.89	0	0	0	0	4.194613	0	0	12.8064	15.67987	12.82272	0	0	13.39004	0	11.57203	0	0	0	0	14.07298	15.26301	16.09976	12.94578	11.23668	13.29161	13.04591	0	12.99446	13.9174	14.85305	11.57437	0	0	14.58596	0	12.54094	0	0	12.72372	13.82317	0
A0A669EB62	A0A669EB62_ORENI			Gametogenetin-binding protein 2 (Protein ZNF403)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SFEMAVEK	8.170000076	955.517254	15.35899	0	0	16.10703	16.56788	16.52434	16.03024	15.59074	15.30551	16.64872	16.36168	0	0	16.86367	0	0	0	0	0	0	0	0	0	0	16.77845	0	0	21.87686	0	16.06071	0	0	17.0102	0	0	15.45909	0	16.07879	0	18.24988	19.12881	21.03807	0	16.64866	0	17.8123	21.88269	0	0	0	0	0	18.63889	18.62726
A0A669D688	A0A669D688_ORENI	GABRA5		"Gamma-aminobutyric acid (GABA) A receptor, alpha 5"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chloride channel complex [GO:0034707]; postsynaptic membrane [GO:0045211]	chloride channel complex [GO:0034707]; postsynaptic membrane [GO:0045211]; chloride channel activity [GO:0005254]; extracellular ligand-gated ion channel activity [GO:0005230]; GABA-A receptor activity [GO:0004890]	chloride channel activity [GO:0005254]; extracellular ligand-gated ion channel activity [GO:0005230]; GABA-A receptor activity [GO:0004890]	DASISTISNSTAVQLKLPETK	10.68000031	2203.999332	0	10.50493	11.55485	0	0	12.2704	12.28973	0	0	11.40467	14.47337	8.547404	0	0	11.0605	0	13.89874	13.19468	0	0	0	10.3871	9.089411	0	0	12.07329	18.72716	0	0	14.35175	10.95442	8.576169	0	12.46629	9.370502	0	0	15.30968	0	10.23037	14.14145	0	14.19768	12.34519	0	11.31372	0	13.93083	0	14.08698	0	13.33616	0	0
I3JZG4	I3JZG4_ORENI		glutathione catabolic process [GO:0006751]	Gamma-glutamyltransferase 5a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; glutathione hydrolase activity [GO:0036374]; glutathione catabolic process [GO:0006751]	glutathione hydrolase activity [GO:0036374]	MNSEPKTTDEK	4.239999771	1295.503378	14.29766	15.28801	15.02697	13.93698	14.54436	14.10198	0	15.38976	14.8981	15.7801	15.63134	13.5076	7.949536	0	15.49727	16.33709	15.55771	15.49077	0	0	0	0	15.12103	13.46727	15.93913	13.87236	14.45059	15.08512	0	15.67433	18.50922	16.07829	0	15.32226	0	6.466347	14.45715	15.42893	0	0	15.62694	0	12.46399	12.39899	16.07618	16.64008	17.86264	17.47026	15.7263	16.00216	15.82393	15.96978	10.80474	16.09933
I3JD95	I3JD95_ORENI	sgcg		Gamma-sarcoglycan	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]; integral component of membrane [GO:0016021]; sarcoglycan complex [GO:0016012]; sarcolemma [GO:0042383]	cytoskeleton [GO:0005856]; integral component of membrane [GO:0016021]; sarcoglycan complex [GO:0016012]; sarcolemma [GO:0042383]		EQYVTTTEGSSTPRPVPDELYKIGIYGWR	9.859999657	3342.246808	0	12.67795	0	0	0	14.3521	13.51403	18.89305	12.97605	13.03211	0	0	12.57261	16.25732	15.38242	0	12.55355	18.95464	0	19.0617	12.34861	19.66661	18.06734	13.23031	0	0	14.78212	15.95819	0	13.19556	10.19496	16.24504	12.08352	0	12.08033	14.8699	0	0	0	0	14.33016	0	12.12906	15.64696	18.91611	12.8868	13.80168	14.3395	15.46064	14.5807	0	13.16376	15.78968	18.64551
A0A669CVH1	A0A669CVH1_ORENI	tubgcp2	microtubule nucleation [GO:0007020]	Gamma-tubulin complex component	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule [GO:0005874]; microtubule organizing center [GO:0005815]; spindle pole [GO:0000922]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; microtubule organizing center [GO:0005815]; spindle pole [GO:0000922]; gamma-tubulin binding [GO:0043015]; microtubule nucleation [GO:0007020]	gamma-tubulin binding [GO:0043015]	SIKHYFLMDK	19.92000008	1282.094494	0	14.51618	13.3547	14.57433	13.75913	0	0	15.44925	14.07557	16.31341	13.68744	15.51498	0	12.28849	0	13.6278	11.52648	13.83225	14.29761	14.2612	0	12.97451	0	0	15.89655	11.44764	0	12.9802	15.7352	14.41511	16.187	17.47551	15.44882	14.10521	0	14.54658	13.654	14.09614	13.64754	12.42195	13.12214	11.08896	13.89941	13.84715	13.20644	14.49712	13.92113	0	15.2195	14.025	15.87933	13.24199	13.80237	12.6843
A0A669BHL5	A0A669BHL5_ORENI	GJD4	cell communication [GO:0007154]	Gap junction protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	connexin complex [GO:0005922]; integral component of membrane [GO:0016021]	connexin complex [GO:0005922]; integral component of membrane [GO:0016021]; cell communication [GO:0007154]		KMMVEK	5.050000191	778.4647752	14.60941	12.46036	14.40581	11.97157	0	14.16748	14.66171	14.19648	14.4227	14.79589	14.64904	14.5873	13.02685	14.99831	14.37268	13.45075	14.0946	14.48085	15.2255	14.6154	13.66353	12.35557	13.20825	14.13701	11.02394	14.28666	14.19863	13.82486	16.0891	0	18.92501	18.36073	19.06475	13.80098	14.9162	0	13.17961	13.52762	14.91927	0	14.16817	13.92747	12.25745	14.58614	0	16.0397	13.55688	12.68634	11.82444	0	15.34171	12.9549	11.8816	15.04474
A0A669C7A4	A0A669C7A4_ORENI		regulation of fatty acid biosynthetic process [GO:0042304]; regulation of insulin secretion [GO:0050796]; response to glucose [GO:0009749]	Gastric inhibitory polypeptide (Glucose-dependent insulinotropic polypeptide)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; hormone activity [GO:0005179]; regulation of fatty acid biosynthetic process [GO:0042304]; regulation of insulin secretion [GO:0050796]; response to glucose [GO:0009749]	hormone activity [GO:0005179]	KTKPTDAGK	10.67000008	945.6658258	0	16.65465	0	17.04598	16.64358	16.89661	16.58899	17.73839	17.42851	17.80186	17.38817	0	17.44939	17.46116	0	16.45614	16.42527	18.17065	15.71913	15.5181	16.01151	0	16.67283	16.88641	16.47132	16.81622	17.00614	0	0	14.44752	0	15.22821	14.73149	0	0	15.80433	16.22969	16.19037	0	0	15.71828	16.41022	15.85141	16.57704	15.31088	15.51386	13.68689	14.45731	18.72579	16.71857	15.5423	14.61707	16.55537	14.61551
A0A669DQ48	A0A669DQ48_ORENI		cell surface receptor signaling pathway [GO:0007166]	Gastric inhibitory polypeptide receptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; G protein-coupled receptor activity [GO:0004930]; cell surface receptor signaling pathway [GO:0007166]	G protein-coupled receptor activity [GO:0004930]	DALLGK	8.569999695	613.490931	0	15.44167	10.61135	16.02822	0	16.17279	14.64377	15.09183	15.41379	0	0	0	0	15.68243	17.26152	15.24166	14.37259	16.00456	0	0	0	0	0	0	0	0	17.27812	0	0	0	0	0	0	16.642	0	0	0	15.56807	15.05202	0	0	0	0	0	16.60416	0	0	0	15.20148	14.33081	0	0	16.57323	15.39475
A0A669CK00	A0A669CK00_ORENI	flii		Gelsolin-like domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin filament binding [GO:0051015]	actin filament binding [GO:0051015]	SRNTCQMTSLQ	6.03000021	1324.384727	0	14.72079	0	10.02771	18.19099	1.887221	15.64725	17.0063	17.59328	14.00995	14.41774	0	13.65022	13.14082	14.14859	0	0	15.23092	15.15693	0	0	15.33271	0	0	0	0	0	0	0	0	0	0	0	16.02764	18.48163	0	0	14.99831	0	0	0	0	0	0	0	14.6286	16.61545	14.76931	15.41071	16.0077	0	17.03155	14.03523	16.18129
I3JLJ9	I3JLJ9_ORENI	ercc2	nucleotide-excision repair [GO:0006289]	General transcription and DNA repair factor IIH helicase subunit XPD (EC 3.6.4.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; nucleotide-excision repair [GO:0006289]	ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]	GAILLSVAR	1.860000014	900.0138604	15.76849	0	14.05548	15.85429	15.87596	14.81856	15.47894	16.00404	15.61541	16.1909	0	15.15963	16.67896	0	15.74982	12.72447	15.16787	16.07785	16.38275	16.0476	15.73286	15.0319	15.11299	15.10582	17.88989	16.27883	16.95658	15.39402	16.96067	16.90845	16.89444	16.58571	15.52132	0	0	0	0	0	0	0	0	17.44791	16.58875	16.04568	0	15.59234	0	0	14.44287	0	17.71644	17.92908	0	0
A0A669F4V3	A0A669F4V3_ORENI		transcription initiation from RNA polymerase II promoter [GO:0006367]	"General transcription factor IIA, 1-like"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	transcription factor TFIIA complex [GO:0005672]	transcription factor TFIIA complex [GO:0005672]; transcription initiation from RNA polymerase II promoter [GO:0006367]		AMEGLRK	10.75	818.4865527	16.71547	15.73676	14.67882	0	16.36484	0	13.81351	0	0	0	0	0	0	0	0	0	18.24428	0	0	0	0	0	20.69923	0	0	0	0	14.78455	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669CCH0	A0A669CCH0_ORENI		transcription initiation from RNA polymerase II promoter [GO:0006367]	General transcription factor IIF subunit 2 (Transcription initiation factor IIF subunit beta)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	transcription factor TFIIF complex [GO:0005674]	transcription factor TFIIF complex [GO:0005674]; DNA binding [GO:0003677]; transcription initiation from RNA polymerase II promoter [GO:0006367]	DNA binding [GO:0003677]	RATPQTPPTPR	1.49000001	1220.936642	6.054324	9.217508	0	9.943602	14.20524	12.36053	0	0	10.93178	10.59164	10.90406	0	14.10151	11.90231	17.31341	16.97729	17.66489	0	11.9961	0	0	10.76149	0	11.61663	12.10691	12.07617	14.41366	0	9.970237	9.834401	11.93745	14.66174	13.73386	16.34727	13.24445	0	10.0014	12.02948	13.24228	14.14236	14.46292	0	0	13.99288	0	10.66334	0	13.39917	11.81246	13.69533	0	11.03869	0	0
A0A669CA01	A0A669CA01_ORENI	uso1	intracellular protein transport [GO:0006886]; vesicle fusion with Golgi apparatus [GO:0048280]	General vesicular transport factor p115	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi membrane [GO:0000139]	Golgi membrane [GO:0000139]; intracellular protein transport [GO:0006886]; vesicle fusion with Golgi apparatus [GO:0048280]		LMDLLADSR	7.659999847	1050.170729	15.12536	13.10406	11.25738	13.1586	12.86802	14.1408	15.99675	15.43562	7.390077	11.41511	0	14.96726	15.06181	15.21586	13.38154	16.60626	0	6.552076	12.2857	14.00731	15.68799	13.16992	16.5143	0	0	0	0	0	15.7028	16.09588	17.51633	15.87911	14.38247	0	15.27716	0	0	0	0	15.38298	0	13.62165	0	0	0	16.35727	0	0	10.81136	16.66267	16.5818	0	0	0
A0A669CY83	A0A669CY83_ORENI	nagk		GlcNAc kinase (EC 2.7.1.59) (N-acetyl-D-glucosamine kinase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		N-acetylglucosamine kinase activity [GO:0045127]	N-acetylglucosamine kinase activity [GO:0045127]	SHFAGFCKK	3.109999895	1078.058313	0	0	14.11818	13.69161	11.99352	12.28128	14.62915	12.90997	12.61195	0	12.92134	14.57642	14.96926	15.00548	0	0	0	17.25091	12.73603	12.18358	13.1599	13.31425	12.82622	13.84668	14.11935	12.18363	0	0	17.90398	14.2013	0	0	0	0	0	13.55056	0	13.56058	0	12.91543	14.73611	0	0	10.51382	0	0	0	14.2615	13.48812	16.09277	14.26109	0	0	12.44795
A0A669F306	A0A669F306_ORENI	LOC100691094		Glial cell line-derived neurotrophic factor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; glial cell-derived neurotrophic factor receptor binding [GO:0030116]; growth factor activity [GO:0008083]; receptor tyrosine kinase binding [GO:0030971]	glial cell-derived neurotrophic factor receptor binding [GO:0030116]; growth factor activity [GO:0008083]; receptor tyrosine kinase binding [GO:0030971]	LPPVQIGLSVSSTSMSHADTANR	4.539999962	2383.372956	10.77244	0	12.88486	12.118	0	0	0	0	0	0	12.56108	0	0	11.6421	0	11.69748	0	0	13.59139	0	13.78025	14.5111	13.59059	0	15.21167	15.47635	0	0	10.6071	0	0	0	13.41944	0	13.06467	12.94557	0	0	0	0	11.71381	0	15.19966	11.70249	0	0	0	13.06609	12.63809	0	14.35653	17.78364	0	8.552814
I3IWC3	I3IWC3_ORENI	gfap		Glial fibrillary acidic protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	intermediate filament [GO:0005882]	intermediate filament [GO:0005882]		MISQAFSQRVQSSYR	14.89000034	1802.899257	14.38353	13.37767	12.04514	0	13.36497	0	12.11168	13.37796	0	13.59203	13.78473	0	0	11.7379	0	15.56629	0	10.35486	15.10683	15.07766	13.28693	0	16.18043	15.58117	14.81091	14.63069	13.71712	0	0	0	15.14541	0	14.96287	0	15.82315	0	0	0	0	0	0	0	0	14.57007	0	15.51244	0	13.59686	17.15094	0	19.75673	16.42287	0	0
I3KN74	I3KN74_ORENI	LOC100534398	chromatin organization [GO:0006325]	Glucocorticoid receptor (Nuclear receptor subfamily 3 group C member 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]; nucleus [GO:0005634]; spindle [GO:0005819]	mitochondrion [GO:0005739]; nucleus [GO:0005634]; spindle [GO:0005819]; DNA-binding transcription factor activity [GO:0003700]; glucocorticoid receptor activity [GO:0004883]; sequence-specific DNA binding [GO:0043565]; steroid binding [GO:0005496]; zinc ion binding [GO:0008270]; chromatin organization [GO:0006325]	DNA-binding transcription factor activity [GO:0003700]; glucocorticoid receptor activity [GO:0004883]; sequence-specific DNA binding [GO:0043565]; steroid binding [GO:0005496]; zinc ion binding [GO:0008270]	LKGCMPQLVPTMLSLLK	11.89000034	1928.10624	0	15.03814	0	13.97506	0	0	14.61865	0	13.3999	13.42922	0	12.7536	0	9.322349	11.84323	0	0	13.45204	14.69817	0	0	0	0	0	0	0	0	12.35908	0	12.01442	12.17671	0	0	0	0	0	0	0	12.75841	0	16.31745	12.50564	0	15.12908	17.79032	0	0	11.94733	11.87906	0	0	0	0	16.48551
I3KPG3	I3KPG3_ORENI	g6pc	gluconeogenesis [GO:0006094]; response to (R)-carnitine [GO:0061959]	Glucose-6-phosphatase (EC 3.1.3.9)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; glucose-6-phosphatase activity [GO:0004346]; gluconeogenesis [GO:0006094]; response to (R)-carnitine [GO:0061959]	glucose-6-phosphatase activity [GO:0004346]	KSSSPLVK	5.5	844.9090471	14.64862	15.63197	17.00654	17.0518	18.45752	16.55716	16.1612	0	17.68518	18.42121	18.23689	17.66638	0	0	14.9025	15.92697	17.32023	0	17.29555	15.09589	15.73178	0	0	0	0	0	0	0	0	0	0	0	16.99265	15.6779	14.4086	0	0	0	15.40995	17.52429	16.37416	0	0	0	0	14.1589	16.56004	15.74215	16.13751	16.70003	0	15.04686	16.82546	0
A0A669CZL5	A0A669CZL5_ORENI	LOC100691113		Glucosidase 2 subunit beta (Glucosidase II subunit beta)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum [GO:0005783]	endoplasmic reticulum [GO:0005783]		VRGISSSYK	2.819999933	995.7855599	12.56119	0	14.19836	14.57299	0	8.946098	0	14.84413	11.77831	13.48919	9.741322	16.75121	15.80066	11.91062	12.6712	12.58362	14.73736	11.03168	13.50901	14.4581	0	15.13196	14.32133	14.36505	9.124523	12.20965	15.01327	0	10.1742	13.52109	14.92238	15.3285	13.40594	13.42809	14.4928	14.57469	12.77709	13.46281	14.52345	14.72893	12.55353	11.57872	15.31922	14.85051	17.80765	14.8626	12.96906	13.55318	13.01256	11.40093	0	0	0	10.91504
A0A669DNZ4	A0A669DNZ4_ORENI	LOC100707972	cellular amino acid metabolic process [GO:0006520]	Glutamate dehydrogenase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		glutamate dehydrogenase (NAD+) activity [GO:0004352]; glutamate dehydrogenase (NADP+) activity [GO:0004354]; nucleotide binding [GO:0000166]; cellular amino acid metabolic process [GO:0006520]	glutamate dehydrogenase (NAD+) activity [GO:0004352]; glutamate dehydrogenase (NADP+) activity [GO:0004354]; nucleotide binding [GO:0000166]	ESPEQK	2.700000048	717.3436493	15.22932	0	13.17701	15.01586	0	0	18.25582	17.00583	15.68968	15.73837	15.19165	16.83958	0	0	14.65325	15.55762	17.71524	16.56754	14.98564	0	0	15.03176	15.07821	16.18932	16.28374	0	16.77652	15.94793	16.83167	16.47775	15.47733	17.10155	16.49833	16.12032	15.91241	15.85913	14.7647	14.18759	15.52881	17.0232	16.0065	15.40235	0	16.26912	0	0	14.78371	0	14.23089	15.76214	14.60122	16.99979	0	14.45632
A0A669BHG9	A0A669BHG9_ORENI	GRID1		Glutamate receptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; postsynaptic membrane [GO:0045211]	integral component of membrane [GO:0016021]; postsynaptic membrane [GO:0045211]; ionotropic glutamate receptor activity [GO:0004970]	ionotropic glutamate receptor activity [GO:0004970]	TGGSVGNKGR	2.460000038	932.6955382	0	13.58197	14.74578	11.54919	14.26366	14.50046	14.24587	9.767773	0	14.97842	0	15.06299	0	15.48754	14.08646	14.82361	0	0	0	12.53447	15.20414	14.04792	14.57842	13.07411	13.56703	11.00354	0	13.46108	14.69358	0	14.48498	15.21206	0	14.47857	13.40241	14.68413	14.50051	14.36955	0	0	14.99131	11.33346	0	12.86005	12.95011	13.11422	0	13.85664	0	0	15.51156	13.97998	0	12.85525
A0A669D643	A0A669D643_ORENI	LOC100694977	glutamine metabolic process [GO:0006541]	Glutaminase (EC 3.5.1.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; glutaminase activity [GO:0004359]; glutamine metabolic process [GO:0006541]	glutaminase activity [GO:0004359]	KNESNAVVDR	6.730000019	1131.188263	12.14926	10.62712	12.58184	14.36086	12.34247	12.10977	10.46224	0	10.60092	18.58135	14.42262	16.44386	13.83079	13.71429	11.18621	12.46814	0	18.29378	12.09611	0	0	14.85128	14.51976	17.56408	14.0252	6.461024	13.14171	0	18.79993	14.68441	0	14.17459	13.15591	13.57816	11.7589	17.96689	11.53947	12.78519	13.9116	13.00084	0	0	5.201511	17.37533	12.01381	15.67208	17.89903	0	0	0	18.30388	0	0	0
I3K5G4	I3K5G4_ORENI	LOC100692652	glutamine metabolic process [GO:0006541]; UDP-N-acetylglucosamine biosynthetic process [GO:0006048]	Glutamine--fructose-6-phosphate transaminase (isomerizing) (EC 2.6.1.16)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		carbohydrate derivative binding [GO:0097367]; glutamine-fructose-6-phosphate transaminase (isomerizing) activity [GO:0004360]; glutamine metabolic process [GO:0006541]; UDP-N-acetylglucosamine biosynthetic process [GO:0006048]	carbohydrate derivative binding [GO:0097367]; glutamine-fructose-6-phosphate transaminase (isomerizing) activity [GO:0004360]	DDVCFFISQSGETADTLMALR	3.269999981	2375.710883	12.76375	10.69736	11.26628	16.61458	14.60514	12.9115	8.438586	13.64897	14.30599	11.02965	0	0	9.216677	9.4534	11.2584	10.4332	11.64969	11.09492	13.06838	0	0	14.34229	11.33728	14.11463	12.48884	12.99185	0	13.46971	12.21523	12.91896	12.74088	12.74538	13.33506	0	0	17.56263	0	13.38148	14.24993	0	5.099687	10.78646	0	0	0	13.35946	11.17363	0	0	0	9.625496	0	0	10.69954
A0A669CPC5	A0A669CPC5_ORENI			Glutaminyl-peptide cyclotransferase (EC 2.3.2.5)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		glutaminyl-peptide cyclotransferase activity [GO:0016603]	glutaminyl-peptide cyclotransferase activity [GO:0016603]	RLASQVDER	4.179999828	1073.296375	14.25754	13.99431	12.33117	10.71066	13.78043	10.19211	12.2759	0	0	0	12.64846	11.74286	14.89308	0	12.67212	15.09664	14.25406	14.11524	14.3884	13.06578	11.48662	0	0	0	14.11844	14.63696	0	10.845	14.099	0	0	0	0	0	0	0	0	0	0	0	14.02498	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669CYV2	A0A669CYV2_ORENI	qars1	glutaminyl-tRNA aminoacylation [GO:0006425]	Glutaminyl-tRNA synthetase (EC 6.1.1.18)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; glutamine-tRNA ligase activity [GO:0004819]; glutaminyl-tRNA aminoacylation [GO:0006425]	ATP binding [GO:0005524]; glutamine-tRNA ligase activity [GO:0004819]	GSHTVPFTR	9.649999619	1000.590838	15.3534	0	13.71773	10.55604	14.36469	0	13.90593	12.54935	14.68503	16.27199	0	12.64885	12.7472	0	14.2731	14.42237	15.2913	16.42107	0	17.57485	0	0	0	0	0	11.92148	0	0	14.2202	0	13.96899	0	0	0	0	15.58288	0	0	0	15.51987	16.88134	15.48058	15.32891	0	0	0	13.13365	16.84959	14.26065	0	0	14.67943	0	0
A0A669DJU8	A0A669DJU8_ORENI	eprs1	glutamyl-tRNA aminoacylation [GO:0006424]; prolyl-tRNA aminoacylation [GO:0006433]	Glutamyl-tRNA synthetase (EC 6.1.1.15) (EC 6.1.1.17) (Prolyl-tRNA synthetase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; glutamate-tRNA ligase activity [GO:0004818]; proline-tRNA ligase activity [GO:0004827]; glutamyl-tRNA aminoacylation [GO:0006424]; prolyl-tRNA aminoacylation [GO:0006433]	ATP binding [GO:0005524]; glutamate-tRNA ligase activity [GO:0004818]; proline-tRNA ligase activity [GO:0004827]	QFIAAQGGSR	4.199999809	1034.758536	0	14.29552	13.11882	0	13.07422	0	13.0543	0	15.13858	0	0	0	13.54379	13.56493	0	0	15.44283	0	0	0	0	0	18.3927	0	16.56802	0	15.39747	13.87599	0	14.27234	18.33551	0	13.34029	0	15.2467	14.41324	14.50646	12.07774	0	0	0	0	0	16.32615	0	14.95523	15.47116	14.61334	14.57381	15.81299	14.70351	14.57857	15.52543	15.49542
A0A669DQD0	A0A669DQD0_ORENI	qrsl1 QRSL1	glutaminyl-tRNAGln biosynthesis via transamidation [GO:0070681]; mitochondrial translation [GO:0032543]	"Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial (Glu-AdT subunit A) (EC 6.3.5.7) (Glutaminyl-tRNA synthase-like protein 1)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	glutamyl-tRNA(Gln) amidotransferase complex [GO:0030956]; mitochondrion [GO:0005739]	glutamyl-tRNA(Gln) amidotransferase complex [GO:0030956]; mitochondrion [GO:0005739]; ATP binding [GO:0005524]; glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity [GO:0050567]; hydrolase activity [GO:0016787]; glutaminyl-tRNAGln biosynthesis via transamidation [GO:0070681]; mitochondrial translation [GO:0032543]	ATP binding [GO:0005524]; glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity [GO:0050567]; hydrolase activity [GO:0016787]	TIKQVSLALR	6.670000076	1128.191779	0	0	0	13.62227	9.63466	0	11.64798	14.02777	13.98495	13.0348	8.371376	12.73644	13.96732	0	0	14.22954	12.31189	8.020212	0	0	13.31964	10.9376	16.29545	15.05356	14.56757	12.56678	11.82747	17.50241	0	0	14.49927	0	8.856076	14.81285	17.40614	0	9.723351	7.393191	0	0	11.83054	11.97273	14.56833	13.26518	17.45692	11.14018	11.35654	0	14.47298	18.08641	18.3631	14.76383	12.86715	0
A0A669BU14	A0A669BU14_ORENI	gatc GATC	glutaminyl-tRNAGln biosynthesis via transamidation [GO:0070681]; mitochondrial translation [GO:0032543]; regulation of translational fidelity [GO:0006450]	"Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial (Glu-AdT subunit C) (EC 6.3.5.-)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	glutamyl-tRNA(Gln) amidotransferase complex [GO:0030956]; mitochondrion [GO:0005739]	glutamyl-tRNA(Gln) amidotransferase complex [GO:0030956]; mitochondrion [GO:0005739]; ATP binding [GO:0005524]; glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity [GO:0050567]; glutaminyl-tRNAGln biosynthesis via transamidation [GO:0070681]; mitochondrial translation [GO:0032543]; regulation of translational fidelity [GO:0006450]	ATP binding [GO:0005524]; glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity [GO:0050567]	EDAVMEGDCAEK	4.090000153	1370.055398	5.257328	0	0	0	0	0	0	11.56925	0	0	0	11.54811	13.30438	10.24105	0	12.41068	15.6612	11.84432	13.40875	0	10.6571	0	12.08851	13.33262	12.80002	12.97452	9.325047	0	10.24446	12.78999	0	14.99994	0	0	0	0	0	0	0	0	15.89458	0	0	0	0	0	0	13.69203	0	0	0	0	0	0
I3K4Z5	I3K4Z5_ORENI	gstk1	glutathione metabolic process [GO:0006749]	Glutathione S-transferase kappa (EC 2.5.1.18)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		glutathione peroxidase activity [GO:0004602]; glutathione transferase activity [GO:0004364]; glutathione metabolic process [GO:0006749]	glutathione peroxidase activity [GO:0004602]; glutathione transferase activity [GO:0004364]	DITEPVSLSEAAVK	10.60999966	1459.540817	16.91304	15.99324	16.66224	16.28242	15.2822	16.17045	0	15.27998	16.63435	16.56948	0	0	0	0	0	0	17.30157	16.93463	16.89316	0	17.00768	16.66578	0	16.73154	0	17.34883	15.70675	0	0	15.50698	14.64004	16.49039	0	15.81079	15.54155	16.30031	16.56347	0	15.72403	0	14.34943	16.63061	16.19265	15.95465	16.88622	13.97724	17.00281	14.97895	15.85535	16.03647	16.3353	15.77167	12.66592	16.00296
A0A669D6M3	A0A669D6M3_ORENI	LOC100694221	response to oxidative stress [GO:0006979]	Glutathione peroxidase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		glutathione peroxidase activity [GO:0004602]; response to oxidative stress [GO:0006979]	glutathione peroxidase activity [GO:0004602]	KLLSQTN	5.440000057	802.4337727	13.68279	13.32478	0	0	11.0405	18.91653	0	13.62722	0	13.44148	0	0	12.59333	15.42253	13.63837	0	15.11647	14.1835	16.27037	16.33702	0	16.66691	14.5961	0	0	0	0	0	0	0	13.56754	0	14.27426	0	0	0	14.16457	0	0	0	0	0	0	0	0	0	0	14.36286	0	0	0	0	0	0
I3J289	I3J289_ORENI	gsr	cell redox homeostasis [GO:0045454]; glutathione metabolic process [GO:0006749]	Glutathione reductase (EC 1.8.1.7)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; flavin adenine dinucleotide binding [GO:0050660]; glutathione-disulfide reductase activity [GO:0004362]; NADP binding [GO:0050661]; cell redox homeostasis [GO:0045454]; glutathione metabolic process [GO:0006749]	flavin adenine dinucleotide binding [GO:0050660]; glutathione-disulfide reductase activity [GO:0004362]; NADP binding [GO:0050661]	NSQVKSVSK	1.289999962	977.0177045	15.56175	13.9531	14.43949	14.52139	0	14.07925	15.849	15.71504	15.96738	14.57028	16.17865	15.45623	15.50997	15.82447	14.41153	0	14.37477	0	15.71741	0	16.58282	17.20271	13.53978	14.12162	16.11966	17.54908	0	13.84161	0	0	0	0	16.62843	0	17.29305	0	14.09197	0	0	14.50498	15.02134	14.97021	13.19668	0	14.13519	0	15.7923	15.48542	17.56709	0	17.30075	0	16.97509	0
A0A669CFS7	A0A669CFS7_ORENI	gss		Glutathione synthetase (GSH-S) (EC 6.3.2.3)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; glutathione binding [GO:0043295]; glutathione synthase activity [GO:0004363]; magnesium ion binding [GO:0000287]	ATP binding [GO:0005524]; glutathione binding [GO:0043295]; glutathione synthase activity [GO:0004363]; magnesium ion binding [GO:0000287]	MAQGIPDEVLMNSALIK	4.199999809	1841.424099	13.19473	15.98521	14.13566	15.08592	0	14.36995	14.6256	14.58911	16.9766	16.04795	15.87436	0	0	15.08289	0	15.72432	15.77709	14.11863	15.71293	14.52071	13.88814	14.68535	15.52828	15.29045	15.74046	12.74085	14.92832	14.41183	14.4011	14.82899	16.08677	0	0	14.66125	14.48009	0	14.49044	14.77759	15.36938	0	14.54697	0	13.61985	14.71088	12.15591	12.58729	15.85043	0	15.76773	0	0	0	16.80197	16.25042
I3KP17	I3KP17_ORENI	LOC100534455	glutathione metabolic process [GO:0006749]	Glutathione transferase (EC 2.5.1.18)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; glutathione transferase activity [GO:0004364]; glutathione metabolic process [GO:0006749]	glutathione transferase activity [GO:0004364]	NNISFDFKK	2.75	1110.285235	8.51379	12.72457	14.32079	13.50303	0	0	18.18952	13.12652	14.70761	17.08646	12.70173	14.38624	0	0	13.43545	10.40428	13.61905	14.39249	14.99651	14.42995	14.91556	0	0	0	14.84182	15.45958	0	12.51441	0	12.62312	16.21617	17.75585	12.85984	12.68258	0	0	0	0	14.16329	0	11.30379	14.56985	5.701916	0	13.44654	13.98155	13.92083	14.47071	14.29534	19.02691	0	0	15.21122	14.81433
A0A669CNH4	A0A669CNH4_ORENI	LOC100710600	glycerol-3-phosphate metabolic process [GO:0006072]; glycerol catabolic process [GO:0019563]	Glycerol kinase (EC 2.7.1.30)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; glycerol kinase activity [GO:0004370]; glycerol catabolic process [GO:0019563]; glycerol-3-phosphate metabolic process [GO:0006072]	ATP binding [GO:0005524]; glycerol kinase activity [GO:0004370]	CVTVGVTNQR	12.89999962	1132.513229	0	12.56087	12.46189	0	13.20165	0	17.09171	0	12.06365	13.53982	16.98769	0	0	10.69413	13.5473	11.24354	12.36002	13.28721	13.85536	12.56059	13.32788	11.72316	13.96682	8.153054	16.56382	13.37833	14.54325	14.82839	0	12.66206	12.13371	15.91478	0	0	10.31693	0	14.71861	12.18669	0	13.65544	13.52292	12.83052	0	0	0	7.649453	16.42443	8.14294	10.75887	0	0	14.0776	0	13.46822
A0A669CIU4	A0A669CIU4_ORENI			Glycerol-3-phosphate acyltransferase 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum [GO:0005783]; integral component of membrane [GO:0016021]	"endoplasmic reticulum [GO:0005783]; integral component of membrane [GO:0016021]; transferase activity, transferring acyl groups [GO:0016746]"	"transferase activity, transferring acyl groups [GO:0016746]"	TLLKIFEWANLQMK	5.989999771	1750.427734	0	0	0	0	0	0	0	17.11109	0	0	18.91076	0	16.72318	0	0	0	0	0	0	0	17.40594	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.6632	0	0	0	0	0	17.40193	0	0	0	0	0
A0A669DHF4	A0A669DHF4_ORENI		glycerol-3-phosphate metabolic process [GO:0006072]	"Glycerol-3-phosphate dehydrogenase, mitochondrial"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	glycerol-3-phosphate dehydrogenase complex [GO:0009331]; mitochondrion [GO:0005739]	glycerol-3-phosphate dehydrogenase complex [GO:0009331]; mitochondrion [GO:0005739]; calcium ion binding [GO:0005509]; sn-glycerol-3-phosphate:ubiquinone-8 oxidoreductase activity [GO:0052591]; glycerol-3-phosphate metabolic process [GO:0006072]	calcium ion binding [GO:0005509]; sn-glycerol-3-phosphate:ubiquinone-8 oxidoreductase activity [GO:0052591]	KFLYHEMGYR	6.079999924	1344.488686	12.91723	14.33975	15.48323	13.66072	0	12.83567	15.60841	14.41932	16.03716	15.06809	0	0	15.02559	0	0	15.88439	14.07669	0	15.69498	15.28855	17.17945	0	15.34199	0	0	0	0	0	0	16.12658	0	14.5098	16.48952	0	14.34834	0	16.23629	0	15.26643	0	12.9751	15.1204	16.11926	0	15.06781	13.82418	14.33913	0	0	0	0	15.54216	17.55556	17.65154
A0A669E397	A0A669E397_ORENI	LOC100709681	carbohydrate metabolic process [GO:0005975]	Glyco_hydro_35 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		beta-galactosidase activity [GO:0004565]; carbohydrate metabolic process [GO:0005975]	beta-galactosidase activity [GO:0004565]	GVIFVNGQNLGR	3.190000057	1273.753205	13.31097	14.58682	13.29604	0	13.80288	0	13.03392	15.00717	10.81968	14.01882	0	12.99712	12.27533	14.34098	0	0	0	13.59562	11.33709	13.69794	9.955161	14.31017	13.35141	0	13.26975	0	13.26224	13.65551	10.8315	15.18945	15.69763	15.65934	15.14021	13.4419	12.95924	0	0	0	13.24379	11.64871	0	14.39622	0	4.815534	13.93286	14.39348	12.57429	14.14083	12.85994	15.34465	10.65919	13.89264	14.88308	0
A0A669CIN3	A0A669CIN3_ORENI	LOC100705425		Glyco_trans_2-like domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		HTISVEDGGK	8.630000114	1043.239623	0	15.05919	0	0	15.00251	14.94232	0	0	14.17495	14.17711	14.84836	0	0	12.90475	15.17158	13.75928	0	9.871406	13.4515	14.49097	0	0	0	14.96324	13.92395	0	14.22904	14.46242	0	14.35319	15.67412	14.58001	0	0	14.73155	13.82579	14.18275	0	15.29278	14.52571	14.78732	8.535848	15.3997	0	15.19844	13.68907	15.36404	15.27591	14.5831	14.57964	15.42283	15.19856	0	16.98204
A0A669B0T6	A0A669B0T6_ORENI	LOC100704330		Glycosyltransferase family 92 protein (EC 2.4.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; transferase activity, transferring glycosyl groups [GO:0016757]"	"transferase activity, transferring glycosyl groups [GO:0016757]"	EEIQREQTR	6.46999979	1189.429683	14.47842	0	12.82654	8.02916	12.70302	13.06678	0	16.6284	9.111015	10.31092	14.10098	14.14761	0	13.14679	14.67286	9.002665	11.70517	12.34615	0	0	14.45477	0	16.24523	13.65031	0	16.62031	14.81664	14.77457	9.1992	0	12.25298	0	0	0	0	10.44209	0	0	0	16.58991	0	0	0	0	0	0	13.87578	0	0	0	0	17.93308	0	12.47807
I3JEM3	I3JEM3_ORENI	gtdc1	central nervous system development [GO:0007417]	Glycosyltransferase-like domain-containing protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"transferase activity, transferring glycosyl groups [GO:0016757]; central nervous system development [GO:0007417]"	"transferase activity, transferring glycosyl groups [GO:0016757]"	QLIDLLKENIAGCSVFTLPAK	5.380000114	2330.237011	17.62201	18.28017	19.17283	0	0	15.09906	17.22739	17.98486	15.14067	18.0167	12.86486	17.42637	14.41023	18.49369	12.34268	18.05871	16.65406	17.93193	0	18.32128	0	14.47168	0	0	0	0	0	12.69978	16.56981	0	0	15.05413	15.63068	17.32617	0	15.77878	12.81707	18.21896	0	0	0	0	0	19.07097	0	12.40694	0	0	0	0	0	16.15853	0	0
A0A669DKZ4	A0A669DKZ4_ORENI		N-terminal protein myristoylation [GO:0006499]	Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		glycylpeptide N-tetradecanoyltransferase activity [GO:0004379]; N-terminal protein myristoylation [GO:0006499]	glycylpeptide N-tetradecanoyltransferase activity [GO:0004379]	NMTLQRTMK	3.880000114	1136.244505	0	0	0	16.6806	14.52305	14.25769	16.81932	15.447	14.37273	0	0	0	15.21045	0	17.56843	14.13559	14.59406	14.23388	0	14.53514	14.59798	18.11424	13.81643	14.27856	17.4511	14.47416	14.49474	14.82409	14.55854	14.72983	15.40443	15.12301	14.82413	0	0	15.61275	10.70402	0	0	13.67185	15.06741	11.91513	10.34409	12.93751	0	13.28559	15.47663	0	0	13.98874	16.48102	13.45256	0	14.41371
A0A669BJ45	A0A669BJ45_ORENI			Glyoxalase domain-containing protein 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DVLGMKILR	14.64999962	1061.871605	0	0	13.47158	14.4625	10.13109	0	17.91005	14.50364	14.90704	0	0	0	0	0	15.54372	0	0	0	0	17.43592	0	15.97853	17.24315	0	0	0	0	0	0	0	19.86682	0	0	0	16.49218	0	0	0	16.7549	0	0	0	17.66852	0	15.70738	0	0	0	0	0	0	15.36741	0	0
I3JBB5	I3JBB5_ORENI			Glyoxylate reductase/hydroxypyruvate reductase a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"NAD binding [GO:0051287]; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]"	"NAD binding [GO:0051287]; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]"	LPEGVEEVK	6.449999809	999.7182803	0	14.39211	14.4053	0	0	0	12.85187	17.08553	0	12.70112	12.88216	0	16.56666	14.94757	16.88664	11.94271	14.90044	0	14.91143	14.83144	0	17.06322	0	16.38789	0	15.80636	15.05938	12.86765	15.67673	11.24269	0	15.20077	17.02575	15.68528	0	16.89253	0	12.16503	0	14.83874	17.67776	0	12.28099	12.63515	14.07822	14.40974	12.86244	0	0	0	0	0	0	0
Q6F4I9	Q6F4I9_ORENI	GnRHR type3		GnRH receptor type3 (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; gonadotropin-releasing hormone receptor activity [GO:0004968]	gonadotropin-releasing hormone receptor activity [GO:0004968]	NNIPKAR	16.13999939	813.457395	13.06563	0	0	16.23439	13.67387	14.81862	0	0	14.55003	0	15.94987	14.91048	0	0	15.40834	16.29294	15.68779	16.47278	15.37936	0	0	0	15.69801	0	0	0	0	16.38615	0	0	0	16.63462	0	16.03111	0	0	15.13663	15.82551	0	0	0	15.80267	0	0	16.26983	0	0	16.39274	0	0	18.26571	16.69549	0	16.00532
A0A669F6X3	A0A669F6X3_ORENI	LOC100699206	endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; protein transport [GO:0015031]	Golgi SNAP receptor complex member 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cis-Golgi network [GO:0005801]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	cis-Golgi network [GO:0005801]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; protein transport [GO:0015031]		MSTTNMAASNNYWEDLR	4.21999979	2015.500174	11.38493	14.4679	12.84649	0	12.26284	0	13.34591	0	0	14.66986	12.16806	12.43094	0	14.95294	0	14.36456	13.37296	13.23418	15.45501	11.43459	11.96097	11.42074	16.06894	0	15.53883	12.88203	0	14.34539	9.7677	13.18537	14.255	0	0	12.44545	0	0	10.72245	14.80264	0	12.51564	0	15.55294	13.32157	0	0	9.589173	0	0	13.94437	16.44643	13.10934	0	14.07499	0
A0A669DMV8	A0A669DMV8_ORENI	LOC100701703		Golgi apparatus protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; postsynaptic Golgi apparatus [GO:0150051]	cytoskeleton [GO:0005856]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; postsynaptic Golgi apparatus [GO:0150051]		LSSDCEDQIRVILQESALDYR	6.75	2510.558603	0	0	0	14.47146	16.00017	0	0	0	0	0	0	0	0	0	0	0	0	16.14848	0	10.34216	12.30642	0	15.50321	0	0	18.66294	0	0	16.16052	0	0	15.75599	15.45638	0	17.47098	15.96608	0	12.97599	14.26614	15.12323	12.56194	15.58556	14.38047	14.36806	14.34876	17.09149	17.37461	0	0	14.00895	15.37478	0	19.07479	0
I3JRJ1	I3JRJ1_ORENI		regulation of ARF protein signal transduction [GO:0032012]	Golgi brefeldin A resistant guanine nucleotide exchange factor 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi apparatus [GO:0005794]	Golgi apparatus [GO:0005794]; guanyl-nucleotide exchange factor activity [GO:0005085]; regulation of ARF protein signal transduction [GO:0032012]	guanyl-nucleotide exchange factor activity [GO:0005085]	QNIPMTVEQFK	11.76000023	1333.613884	14.35816	14.20264	14.56521	15.07856	12.59115	0	0	0	11.45688	13.4133	0	13.76358	12.77764	13.774	15.11147	13.76934	12.3178	11.445	0	12.19561	13.65952	15.05179	0	13.47982	13.91247	0	13.98501	10.98746	12.83153	0	14.17723	15.77679	16.44651	0	0	12.40066	14.16274	14.41537	13.3458	14.14663	13.43694	0	14.31178	0	0	14.28288	0	0	0	0	13.97289	0	0	14.12768
I3JG65	I3JG65_ORENI	casc4		Golgi membrane protein 2 (Protein GOLM2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		HTVATHR	11.19999981	820.5901926	15.80951	14.09306	15.84163	0	14.5752	13.09767	13.0863	0	0	14.14017	11.5307	14.7796	0	14.33895	15.34587	12.61204	14.50565	0	13.15865	0	0	0	0	13.60381	0	14.04609	15.70416	0	15.95091	16.18902	0	14.9825	0	15.89408	14.5449	14.5266	14.2735	14.87649	14.47677	0	14.70084	0	0	0	17.18904	0	16.44098	0	0	0	0	0	0	0
I3KDR3	I3KDR3_ORENI	GPR180	G protein-coupled receptor signaling pathway [GO:0007186]; response to pheromone [GO:0019236]	GpcrRhopsn4 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; G protein-coupled receptor signaling pathway [GO:0007186]; response to pheromone [GO:0019236]		VDSSTLAK	13.52000046	820.4631082	14.4235	12.95455	12.94362	14.56034	14.90202	14.69233	11.74125	0	0	16.17157	16.22397	15.86212	14.90971	14.95816	14.77429	15.01229	15.46526	14.35845	12.9977	14.66536	13.21218	13.92127	15.56192	14.19573	14.16787	15.10658	13.08869	13.78943	0	0	14.05048	14.88914	0	0	15.25381	0	14.8889	13.55638	14.20291	0	13.95064	14.04386	15.19187	14.69813	14.1879	15.58265	13.82955	0	13.24988	0	0	16.41122	8.763627	0
A0A669D1C4	A0A669D1C4_ORENI		negative regulation of insulin receptor signaling pathway [GO:0046627]; signal transduction [GO:0007165]	Growth factor receptor-bound protein 10a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		insulin receptor binding [GO:0005158]; negative regulation of insulin receptor signaling pathway [GO:0046627]; signal transduction [GO:0007165]	insulin receptor binding [GO:0005158]	NIRMAHQK	1.74000001	1013.505173	0	0	0	11.84178	0	13.53097	14.69727	13.72259	13.84793	0	12.47424	14.58549	13.20564	15.70245	11.8372	14.32653	13.06441	18.57895	0	14.85729	0	12.74092	0	13.64507	0	0	0	11.71355	0	18.43813	14.22333	0	0	13.58643	14.27697	0	0	0	0	13.37098	13.91148	0	11.74832	15.19887	0	0	11.24731	12.60566	15.13806	15.3833	0	16.90296	14.17757	0
A0A669F225	A0A669F225_ORENI	ghr1	endocytosis [GO:0006897]	Growth hormone receptor (Growth hormone-binding protein) (Serum-binding protein) (Somatotropin receptor)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; cytokine receptor activity [GO:0004896]; endocytosis [GO:0006897]	cytokine receptor activity [GO:0004896]	NSLQMSLTYIK	4.489999771	1314.453776	0	11.9006	12.1337	11.75751	0	0	13.65391	11.24051	0	0	0	0	17.48064	15.48628	0	15.21715	0	15.1486	0	0	19.50617	0	0	0	13.94727	0	0	0	13.10002	0	0	0	0	12.50358	11.15015	13.45013	0	11.16081	0	0	15.24995	0	0	11.13728	0	0	13.50931	12.14186	0	0	0	0	0	0
A0A669DFC7	A0A669DFC7_ORENI	grpel1	protein folding [GO:0006457]	GrpE protein homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial matrix [GO:0005759]	mitochondrial matrix [GO:0005759]; adenyl-nucleotide exchange factor activity [GO:0000774]; chaperone binding [GO:0051087]; protein homodimerization activity [GO:0042803]; protein folding [GO:0006457]	adenyl-nucleotide exchange factor activity [GO:0000774]; chaperone binding [GO:0051087]; protein homodimerization activity [GO:0042803]	TLRPALVGVAKAL	1.879999995	1309.77889	13.63705	12.52419	12.92867	12.36804	14.93157	14.29048	9.746216	11.38885	12.13835	0	14.55876	14.97071	13.60297	12.53328	0	14.77559	10.78234	12.29281	0	0	0	14.78152	0	14.7681	13.24513	15.52011	14.48325	0	15.15863	12.40742	18.93305	18.11291	18.14615	0	0	14.01976	11.37212	0	0	0	13.98945	0	13.33861	0	0	0	0	14.06499	12.85235	0	0	0	0	0
A0A669CPP3	A0A669CPP3_ORENI	CACNB4		GuKc domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel complex [GO:0005891]; voltage-gated calcium channel activity [GO:0005245]	voltage-gated calcium channel activity [GO:0005245]	HFIHSR	10.85999966	797.3938858	0	0	14.6772	13.21274	14.38074	13.65457	0	16.20751	0	14.39973	13.44154	11.84651	17.95197	18.24346	17.8748	18.02504	17.74094	17.35617	19.04821	18.78159	14.13365	19.41345	20.31777	18.81332	0	16.31067	10.67447	19.29239	18.45337	18.17435	18.19794	19.05163	18.29737	15.60077	15.69602	15.68035	13.80273	0	14.17072	17.90226	14.27404	10.47614	17.23326	13.56221	16.57815	13.97412	14.41478	13.94615	0	16.93793	15.38932	13.04913	18.94196	19.09681
A0A669E6U4	A0A669E6U4_ORENI		guanine catabolic process [GO:0006147]	Guanine deaminase (Guanase) (EC 3.5.4.3) (Guanine aminohydrolase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanine deaminase activity [GO:0008892]; zinc ion binding [GO:0008270]; guanine catabolic process [GO:0006147]	guanine deaminase activity [GO:0008892]; zinc ion binding [GO:0008270]	ALDASK	2.170000076	604.9972139	0	11.86379	0	13.51045	13.66351	13.27147	0	15.23251	13.10215	16.57526	16.57813	14.16658	15.09632	11.62553	0	14.57707	15.29172	0	12.37173	12.31169	0	14.20118	13.72343	13.20889	0	13.33819	0	15.74054	0	0	0	17.92849	18.52344	10.25787	13.43448	11.42781	15.23743	14.9993	11.45294	13.95155	14.88459	13.85079	16.21437	14.64944	16.39144	13.44007	14.76014	18.265	13.54681	14.59876	15.27993	13.43264	0	15.7072
A0A669D7A5	A0A669D7A5_ORENI	bckdhb		Transket_pyr domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	AAAAR	1.129999995	459.1474468	15.62454	16.20111	16.53393	15.95149	16.12021	16.04948	14.95881	16.52681	16.09647	15.59072	16.10693	14.68911	15.99431	0	16.03777	16.01096	16.04825	16.31773	16.48136	16.07891	16.35784	16.24326	15.27968	15.98378	15.77036	16.19659	15.8302	16.14924	15.03855	16.72349	0	17.27898	0	0	15.99269	0	15.49092	16.00952	15.79219	16.37185	16.11396	0	15.76306	0	16.84218	15.46105	16.26935	0	16.66563	16.31544	16.41209	16.81837	16.10488	16.09665
I3J8H8	I3J8H8_ORENI		adenylate cyclase-modulating G protein-coupled receptor signaling pathway [GO:0007188]	"Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		G-protein beta/gamma-subunit complex binding [GO:0031683]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; adenylate cyclase-modulating G protein-coupled receptor signaling pathway [GO:0007188]	G-protein beta/gamma-subunit complex binding [GO:0031683]; GTPase activity [GO:0003924]; GTP binding [GO:0005525]	QSSVGAPLR	9.869999886	915.1316951	16.11947	10.20486	13.96133	14.06781	11.86126	17.43179	14.68892	14.43608	16.67172	17.16663	13.91776	17.63666	15.34254	16.45842	15.68658	17.03792	17.27152	15.67824	14.59223	15.58629	15.26658	11.70433	17.25159	16.59826	18.82724	15.07472	0	15.11227	14.49654	0	17.66094	17.42057	0	15.59539	0	0	16.06905	12.80864	15.61039	10.60521	0	10.31792	14.66018	15.45204	0	0	0	6.512046	17.46372	16.32965	16.97764	0	0	0
I3JWL4	I3JWL4_ORENI	LOC100700730	G protein-coupled receptor signaling pathway [GO:0007186]	Guanine nucleotide-binding protein subunit gamma	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	heterotrimeric G-protein complex [GO:0005834]	heterotrimeric G-protein complex [GO:0005834]; G-protein beta-subunit binding [GO:0031681]; G protein-coupled receptor signaling pathway [GO:0007186]	G-protein beta-subunit binding [GO:0031681]	MSSKMQSSSSIVQAR	3.670000076	1643.536448	15.62465	13.68639	13.63931	16.00189	14.35566	0	0	0	0	0	14.63518	0	13.90616	0	0	0	0	0	0	0	0	0	15.75585	0	0	0	0	0	15.94403	12.79793	16.47544	17.10111	0	16.49848	15.36808	13.22108	0	0	0	0	15.96375	0	15.19102	0	0	0	0	0	15.34845	0	15.26783	0	0	0
A0A669DTG4	A0A669DTG4_ORENI	LOC100697917	intracellular signal transduction [GO:0035556]	Guanylate cyclase (EC 4.6.1.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; guanylate cyclase activity [GO:0004383]; protein kinase activity [GO:0004672]; intracellular signal transduction [GO:0035556]	ATP binding [GO:0005524]; guanylate cyclase activity [GO:0004383]; protein kinase activity [GO:0004672]	GSLKYVLNDK	12.02000046	1136.672521	0	13.68435	12.79879	12.96563	0	0	13.07656	0	11.43607	0	17.48332	0	15.00778	9.419181	13.82621	13.28772	17.92922	17.80031	14.88484	11.35791	14.30482	0	0	0	15.47671	14.08637	16.31146	0	18.82735	0	0	15.11975	0	0	13.1835	17.79607	13.49137	15.13667	0	16.95806	13.86891	0	0	14.49732	0	13.79171	0	0	0	0	0	0	15.18215	13.28465
I3K0H2	I3K0H2_ORENI	lrguk		Guanylate kinase-like domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				IKQHSK	4.320000172	739.9156566	0	13.69399	15.03604	15.0694	11.41571	15.68857	14.94072	15.21099	16.02184	15.04028	14.26201	13.82182	14.49527	15.86186	13.09289	14.67627	10.38986	13.60024	0	15.63249	15.84537	13.46323	10.16474	13.28669	0	15.35159	13.16851	14.90814	0	14.76443	18.2128	17.18155	16.6864	0	0	12.81221	14.38649	0	15.33088	0	13.62202	0	0	12.44731	15.91625	0	0	0	16.24258	0	0	0	0	0
I3JC86	I3JC86_ORENI			H(+)-transporting two-sector ATPase (EC 7.1.2.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"apical plasma membrane [GO:0016324]; proton-transporting V-type ATPase, V1 domain [GO:0033180]"	"apical plasma membrane [GO:0016324]; proton-transporting V-type ATPase, V1 domain [GO:0033180]; ATP binding [GO:0005524]; proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]; proton-transporting ATPase activity, rotational mechanism [GO:0046961]"	"ATP binding [GO:0005524]; proton-transporting ATPase activity, rotational mechanism [GO:0046961]; proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]"	VGSHVTGGDIYGMVFENSLIK	5.21999979	2239.401529	13.52297	11.96385	14.27737	0	12.19811	12.26558	0	0	15.71251	13.8133	10.63427	10.4598	0	15.00337	12.46953	0	11.95407	0	0	8.840439	0	0	0	14.58223	0	15.58753	15.43861	15.34973	0	0	0	0	0	15.12603	14.3741	0	0	0	0	0	13.10634	0	0	0	10.447	12.35003	0	0	0	12.18686	13.77069	13.46752	13.17134	0
A0A669BKT5	A0A669BKT5_ORENI		nucleosome assembly [GO:0006334]	H1.0 linker histone	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleosome [GO:0000786]; nucleus [GO:0005634]	nucleosome [GO:0000786]; nucleus [GO:0005634]; DNA binding [GO:0003677]; nucleosome assembly [GO:0006334]	DNA binding [GO:0003677]	AKPAKK	10.13000011	643.286944	15.20777	13.59274	15.21381	15.87025	14.85402	14.85528	15.5223	15.81684	14.07879	14.4844	15.82513	15.35185	14.58812	15.75563	13.2685	14.53167	15.14177	13.12861	11.0162	13.8371	14.32962	14.79222	14.42652	15.52592	0	0	0	12.8621	0	13.70604	20.45902	0	17.28808	15.55303	0	14.51702	0	15.07985	0	15.6203	0	15.07593	15.17249	15.53634	15.33459	13.90886	14.59428	13.81436	15.4524	0	14.13562	14.55214	15.53381	0
A0A669D0M8	A0A669D0M8_ORENI	LOC100699359		HABP4_PAI-RBP1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; mRNA 3'-UTR binding [GO:0003730]	mRNA 3'-UTR binding [GO:0003730]	DGAGMR	3.99000001	606.2414841	16.71662	0	0	14.9148	16.62799	14.51995	16.7968	0	12.10777	16.34361	10.65926	13.80681	16.8005	0	16.00253	0	17.03054	0	0	0	0	0	14.76779	0	0	0	0	0	0	0	16.63277	0	16.18887	0	0	15.24476	0	0	0	15.57438	0	0	14.51906	0	15.24754	0	0	0	0	0	0	0	0	0
A0A669CW83	A0A669CW83_ORENI	hsp90b1	protein folding [GO:0006457]	HATPase_c domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATPase activity [GO:0016887]; unfolded protein binding [GO:0051082]; protein folding [GO:0006457]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]; unfolded protein binding [GO:0051082]	ADDELDVDGTVEEDLGKSR	11.76000023	2062.025706	11.74615	13.42881	12.49195	11.29525	12.50058	11.82014	13.59845	0	12.33825	0	13.38608	0	14.00504	0	0	11.69741	0	0	12.86892	0	12.00249	12.11841	12.4225	15.28216	14.4521	0	10.08023	14.34828	16.99645	18.61954	7.706391	12.99503	0	12.22609	0	10.49784	0	0	0	0	12.62421	12.69336	13.10372	14.24742	0	15.03738	0	11.15462	0	0	0	11.31327	13.17143	11.76105
I3K548	I3K548_ORENI		cell division [GO:0051301]; definitive hemopoiesis [GO:0060216]; spindle assembly [GO:0051225]	"HAUS augmin-like complex, subunit 3"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; HAUS complex [GO:0070652]; microtubule [GO:0005874]; spindle [GO:0005819]	cytoplasm [GO:0005737]; HAUS complex [GO:0070652]; microtubule [GO:0005874]; spindle [GO:0005819]; cell division [GO:0051301]; definitive hemopoiesis [GO:0060216]; spindle assembly [GO:0051225]		LLNLPVVRGDLALQVAR	20.14999962	1847.007845	18.4474	19.69741	0	0	0	16.86263	0	15.76647	0	14.08989	0	0	0	0	16.83801	13.51377	0	0	17.88059	0	11.42208	13.76644	0	0	0	0	0	18.16032	15.25357	0	0	0	0	0	15.70324	0	0	0	0	0	0	0	0	0	0	0	0	0	20.43574	0	0	0	0	0
A0A669DKZ6	A0A669DKZ6_ORENI	slc4a11		HCO3_cotransp domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; inorganic anion exchanger activity [GO:0005452]	inorganic anion exchanger activity [GO:0005452]	DDGKVR	2.75	690.4143812	0	13.82316	11.02642	9.397694	13.73416	13.48921	13.31424	0	13.78851	12.52019	15.11128	0	14.99255	14.15189	11.59453	13.67445	0	14.40343	14.17936	0	15.26657	10.66705	0	0	12.51818	14.48516	14.06352	11.96372	12.40713	13.24069	17.96165	18.92554	0	0	14.20384	12.18067	0	10.77671	14.10665	13.78032	0	14.04741	14.00371	13.36952	14.88457	0	12.20145	13.73769	14.38803	15.42475	14.72617	15.16913	15.07237	0
A0A669C734	A0A669C734_ORENI			HD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TDMEAYTKLTDQVIER	7.650000095	1929.36983	0	0	0	0	0	0	0	0	15.26366	15.66325	0	0	0	0	0	0	0	0	13.70458	14.92196	15.25009	13.52595	0	0	0	18.64135	17.89811	0	0	16.17703	0	0	0	0	0	0	16.6306	0	16.68829	0	0	0	0	0	0	16.92004	0	0	0	0	12.81723	16.30102	0	0
A0A669BXU1	A0A669BXU1_ORENI	LOC100694434		HDAC_interact domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Sin3 complex [GO:0016580]	Sin3 complex [GO:0016580]; transcription corepressor activity [GO:0003714]	transcription corepressor activity [GO:0003714]	MSAEEQLRFK	16.70000076	1255.239752	0	18.65363	0	14.65092	14.62097	17.81295	15.32565	15.48886	18.19702	0	16.36916	17.538	16.76413	16.49872	17.19635	0	0	16.98359	17.08204	16.98859	16.10505	16.26405	0	0	17.76151	0	15.4263	14.85872	18.57549	17.03256	18.176	0	16.12797	16.80069	0	17.19073	0	0	0	0	16.05005	17.71214	0	0	19.09884	18.86591	18.9155	0	17.19583	17.481	0	19.50325	18.16642	0
I3KSE2	I3KSE2_ORENI		rRNA processing [GO:0006364]	HEAT repeat-containing protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]; rRNA processing [GO:0006364]		FSSLLMLMEVASK	30.42000008	1471.219933	14.16691	16.70619	0	17.12654	16.79054	16.95549	15.98412	0	16.63754	16.49784	16.80292	17.1164	17.3699	17.55528	17.30433	14.6772	16.50484	16.36365	0	17.15517	16.39495	16.67202	0	16.6274	16.78115	0	14.05665	0	17.00633	0	18.43298	17.17223	18.45794	17.13169	16.27145	15.95252	0	17.0887	15.6128	0	16.06449	0	17.08812	17.12753	14.97515	17.13711	17.24779	18.28934	17.24159	16.13928	16.79174	17.80019	16.54499	0
I3JVK3	I3JVK3_ORENI			HECT and RLD domain containing E3 ubiquitin protein ligase 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ubiquitin-protein transferase activity [GO:0004842]	ubiquitin-protein transferase activity [GO:0004842]	QHTLAFTPSSGK	3.049999952	1273.199483	14.86922	14.75093	0	11.72209	0	14.80196	15.33052	17.02482	13.86816	0	0	13.10368	15.3995	0	0	0	0	0	0	0	0	0	0	11.92145	0	15.99016	0	16.75538	0	0	0	16.05121	0	13.53667	14.69191	14.59346	15.00492	0	0	0	0	0	16.04134	0	15.14256	16.19902	0	0	0	17.1107	0	0	0	0
A0A669DCY3	A0A669DCY3_ORENI	HECTD4		HECT domain E3 ubiquitin protein ligase 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ubiquitin-protein transferase activity [GO:0004842]	ubiquitin-protein transferase activity [GO:0004842]	SGLDQIKGALQLGMVDIAR	5.519999981	2000.207256	14.45974	13.22453	10.90102	8.702054	0	15.75113	14.19608	9.817696	0	12.8982	0	14.12961	11.76204	13.03356	13.3104	0	14.23474	13.11467	0	0	12.08335	10.97782	13.5571	0	5.501643	9.909175	0	0	0	14.48455	15.66212	15.63803	13.46391	11.57991	0	14.53717	13.44745	12.48722	0	12.94184	11.82076	10.80494	0	14.48605	14.27107	0	14.16801	13.11043	0	0	13.92325	15.3091	11.61959	11.8064
A0A669EKW8	A0A669EKW8_ORENI	AREL1		HECT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ubiquitin-protein transferase activity [GO:0004842]	ubiquitin-protein transferase activity [GO:0004842]	NIMAATFIR	4.28000021	1036.970375	15.00723	0	16.37247	16.12995	16.83159	16.40215	12.9278	15.07809	16.82065	15.9664	0	16.91099	15.56274	16.5652	16.63965	0	13.57627	0	15.1969	0	0	0	0	0	0	0	0	16.90964	0	0	0	0	16.60568	0	0	15.77798	0	15.6269	16.31473	0	0	0	0	0	0	16.59196	0	0	15.52715	0	0	0	0	0
I3J0I8	I3J0I8_ORENI	hectd1		HECT-type E3 ubiquitin transferase (EC 2.3.2.26)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]	metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]	LPEYSSEDIMR	24.76000023	1355.972356	0	18.55715	18.52302	0	0	17.37914	0	0	0	17.85326	0	0	18.21173	0	16.71758	16.64939	0	0	15.6716	0	0	0	16.15257	0	0	0	0	0	0	0	0	0	0	16.30688	0	0	0	0	17.65016	0	0	0	0	0	0	0	16.11354	0	18.91167	0	18.20039	0	17.96758	0
I3JNS4	I3JNS4_ORENI	henmt1	oocyte development [GO:0048599]; piRNA metabolic process [GO:0034587]	HEN1 methyltransferase homolog 1 (EC 2.1.1.n8) (Small RNA 2'-O-methyltransferase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	P granule [GO:0043186]	P granule [GO:0043186]; metal ion binding [GO:0046872]; O-methyltransferase activity [GO:0008171]; RNA binding [GO:0003723]; RNA methyltransferase activity [GO:0008173]; oocyte development [GO:0048599]; piRNA metabolic process [GO:0034587]	metal ion binding [GO:0046872]; O-methyltransferase activity [GO:0008171]; RNA binding [GO:0003723]; RNA methyltransferase activity [GO:0008173]	HQFVVDFVKR	3.299999952	1274.826683	12.09873	14.45293	11.8796	11.6915	0	0	12.75255	0	11.78658	10.54189	0	0	13.24775	0	0	10.27584	0	0	0	16.76921	0	0	0	15.53425	11.81451	12.62968	0	12.23675	0	0	15.97918	0	12.53265	0	0	0	11.11221	0	12.30289	0	0	0	0	13.89005	0	16.97359	5.382463	10.59351	14.62138	0	0	0	0	0
A0A669C7I0	A0A669C7I0_ORENI			HEPN domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KIIISSLK	15.28999996	901.5074598	13.9526	17.23137	17.11577	15.88116	15.87203	16.99175	0	11.94733	0	12.6296	0	0	14.96854	16.84532	0	0	15.44845	0	0	0	15.33638	0	17.90269	0	0	16.73721	0	15.92958	16.84259	0	0	17.86525	14.69439	11.51916	0	12.97916	15.45705	13.99949	12.15158	17.21817	17.85275	11.81121	0	17.25743	16.57968	12.90768	12.54362	13.31303	16.16738	0	18.74806	14.13031	15.7146	0
A0A669DHE9	A0A669DHE9_ORENI	HHLA1		HERV-H LTR-associating 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SIESSVFRR	8.380000114	1080.475308	13.75833	11.12485	12.99574	14.30682	11.53032	13.2109	17.48257	9.783763	13.58907	12.75058	14.1763	13.23741	14.77494	13.77566	13.54888	0	14.30803	10.13185	0	13.7603	12.2361	13.67291	10.31858	13.84668	11.30526	12.18363	14.15636	11.551	18.06849	13.16087	12.091	14.45588	10.75127	0	11.15186	0	0	13.62612	0	12.38192	0	10.4992	0	9.142333	0	17.0146	9.591635	0	0	0	0	13.97342	0	12.44795
A0A669ETQ8	A0A669ETQ8_ORENI	met	transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	HGF/SF receptor (EC 2.7.10.1) (Hepatocyte growth factor receptor) (Proto-oncogene c-Met) (Scatter factor receptor) (Tyrosine-protein kinase Met)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; semaphorin receptor activity [GO:0017154]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	ATP binding [GO:0005524]; semaphorin receptor activity [GO:0017154]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	SPLFCQVDR	4.849999905	1119.608873	0	0	0	0	0	14.2268	11.5152	14.26849	9.788706	16.76064	0	12.21536	0	12.29609	15.7606	0	0	0	14.00456	0	14.12616	14.23321	0	15.38781	0	0	13.61185	11.51449	0	0	0	0	0	0	0	0	0	0	0	13.27123	0	0	0	0	0	0	13.30597	13.7196	0	0	0	12.80369	0	15.45838
I3K7F7	I3K7F7_ORENI	LOC100694075		HIT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		catalytic activity [GO:0003824]	catalytic activity [GO:0003824]	LGKDVLHDQGITDMTDIR	10.88000011	2026.635461	14.6765	11.01244	11.57322	0	12.02541	0	0	0	0	0	0	14.47258	13.82262	13.29852	13.49908	0	0	0	14.0373	13.84189	15.28376	10.09392	0	8.38037	12.73835	11.92954	15.01768	12.35527	0	13.23337	11.94126	14.79836	13.68015	0	0	0	0	13.1875	11.03507	11.57104	0	0	0	13.08483	15.42442	10.88758	12.62933	0	0	0	0	12.63866	13.59006	13.74685
A0A669DD06	A0A669DD06_ORENI	znhit2		HIT-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	ESFVSLMK	9.319999695	956.3421461	17.00409	0	0	0	21.00681	16.38209	0	0	15.28834	14.33569	0	0	17.57939	0	0	20.49059	17.99088	0	19.52267	16.70842	0	19.72979	0	0	0	0	0	0	0	0	19.67348	0	0	18.16215	0	0	0	0	0	0	0	0	0	15.31942	0	0	0	0	0	0	0	0	0	0
A0A669DIP2	A0A669DIP2_ORENI	ccs		HMA domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; superoxide dismutase activity [GO:0004784]	metal ion binding [GO:0046872]; superoxide dismutase activity [GO:0004784]	MAAPISK	5	734.4162035	12.70531	0	14.42127	16.01855	15.58091	15.10628	14.65001	14.51461	15.06697	15.27754	15.25146	13.50628	15.21405	0	13.50944	14.71703	13.92257	10.61079	0	14.91073	8.062967	11.49085	0	14.94308	15.18569	0	14.80701	0	14.67642	13.29199	0	0	0	0	0	15.17074	0	13.58916	0	0	0	0	14.66871	0	14.57179	13.79009	0	0	0	0	0	0	14.41938	0
A0A669CCQ4	A0A669CCQ4_ORENI	LOC100693400		HMG box domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]"	SLPDGPGGR	4.900000095	855.1739605	12.35632	13.91498	15.06364	14.32855	0	9.506613	0	15.16193	13.32813	13.45388	15.28331	0	11.56008	14.48042	13.13085	13.71368	0	14.43146	13.8207	14.33479	13.595	15.71396	14.34816	14.88907	15.92442	14.97703	14.79707	14.85291	14.70083	0	0	0	0	15.01924	0	13.11051	14.85422	0	0	12.2222	14.6681	13.9262	15.23277	14.69619	12.91167	0	14.41299	15.71541	10.80669	0	14.91935	0	14.56484	15.81098
I3K1E6	I3K1E6_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	HMG box transcription factor 1 (HMG box-containing protein 1) (High mobility group box transcription factor 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; RNA binding [GO:0003723]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]; RNA binding [GO:0003723]	MNEDGNEVRSFGQK	8.619999886	1612.240509	15.86492	0	0	0	15.89784	0	16.54374	14.47934	0	16.82798	0	0	0	0	0	0	0	0	0	16.01355	0	0	0	0	0	17.90724	16.57384	0	17.37625	0	18.04046	17.40558	17.20599	0	17.23077	0	0	0	17.49356	17.5194	0	0	0	0	16.31571	18.5486	0	17.43984	0	0	0	0	18.17437	0
A0A669D516	A0A669D516_ORENI	LOC100703336	cytoskeleton-dependent intracellular transport [GO:0030705]	HOOK_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; cytoskeleton-dependent intracellular transport [GO:0030705]		RGEVIGTHR	9.109999657	1023.709099	13.73919	15.04582	13.49516	0	0	0	0	15.38926	0	0	0	13.28377	0	0	0	13.38125	15.99288	0	0	15.73767	16.9314	0	0	15.73179	0	15.01419	0	15.10425	0	0	10.05277	0	0	15.64277	0	0	14.39286	16.66103	0	0	0	0	12.30709	12.45224	17.9041	13.72811	0	16.80586	14.86142	15.23823	17.58952	14.27983	15.95049	0
A0A669D2D8	A0A669D2D8_ORENI	LOC100711062		HORMA domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MTCPSI	2.109999895	723.8745748	0	14.15666	0	15.2764	0	15.35159	17.71425	0	15.92751	0	15.19529	0	0	0	15.20801	0	15.87597	14.788	15.82105	0	13.05826	0	16.0907	15.36197	14.9958	0	0	0	0	0	0	0	0	0	14.40911	15.89268	15.55036	0	0	0	0	0	0	15.99474	0	16.93197	15.73161	13.35356	16.11275	0	16.3748	0	16.83127	16.91472
A0A669C6Z9	A0A669C6Z9_ORENI	LOC100689828	cytoskeleton organization [GO:0007010]	HP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin filament binding [GO:0051015]; cytoskeleton organization [GO:0007010]	actin filament binding [GO:0051015]	EEAAQPEPVK	6.960000038	1096.640709	13.44389	14.25999	13.98693	15.13687	13.40651	16.20929	0	15.1382	0	0	0	0	0	13.05196	0	13.8418	0	13.35995	0	15.22135	0	8.972694	0	0	14.97456	0	14.4596	0	0	0	15.79283	9.697541	18.48422	0	0	0	15.05606	15.12562	14.04125	13.26281	14.61253	0	14.44713	0	14.05165	14.85502	0	14.93186	14.62158	0	0	0	0	14.04714
I3KDU4	I3KDU4_ORENI	HSF1		HSF_DOMAIN domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	EVLPKFFK	6.650000095	1007.414182	15.7709	0	0	14.89889	0	15.83324	15.24739	16.01716	0	16.73494	15.59464	14.38667	15.1732	16.17963	16.08353	11.86434	16.8306	15.49223	0	15.13535	15.21805	12.97761	15.03805	15.44763	14.1687	0	12.73636	0	0	0	0	0	17.4835	0	16.46128	16.29146	0	0	16.16657	14.79634	15.53983	14.76687	0	15.99844	15.86056	15.782	15.86534	0	16.22089	0	11.9405	0	0	0
A0A669E429	A0A669E429_ORENI	larp1		HTH La-type RNA-binding domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]	RNA binding [GO:0003723]	AGNPPKAR	15.64000034	810.8745873	0	0	15.38231	17.97742	17.14096	16.72466	18.3232	17.40998	21.22165	20.76795	0	0	16.81067	15.95555	16.47454	17.18884	16.6197	0	0	0	17.12447	15.55656	0	21.32114	16.3489	0	14.94991	19.16759	0	15.71055	19.14631	0	0	19.96401	0	0	0	16.83615	0	16.78598	0	0	0	16.6259	18.22957	0	0	17.20911	0	0	0	0	0	0
A0A669E4X7	A0A669E4X7_ORENI	LOC100712247		HTH OST-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LMQVHQER	8.850000381	1039.373204	14.65236	14.20015	13.37885	17.99421	18.4513	14.40098	11.97792	14.59058	20.38783	15.51506	14.50248	13.55283	0	12.75789	14.10204	14.37948	12.19404	11.31219	13.18958	0	16.96524	14.16565	14.59568	0	13.47352	13.22093	15.81225	0	18.90493	13.77743	17.47332	14.42423	19.9877	12.35512	18.65018	13.85125	14.20416	14.96521	13.7526	15.68937	14.82797	17.56215	15.64494	15.90332	14.50649	13.38542	14.90534	14.51973	16.26349	16.73021	18.44059	14.34227	17.34615	0
I3KKM6	I3KKM6_ORENI		protection from non-homologous end joining at telomere [GO:0031848]	HTH myb-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]"	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]; telomeric DNA binding [GO:0042162]; protection from non-homologous end joining at telomere [GO:0031848]"	telomeric DNA binding [GO:0042162]	NINKSK	2.829999924	704.1509012	0	0	0	0	0	0	0	0	0	16.07517	0	0	0	0	0	16.05968	0	0	14.26327	15.23776	0	0	14.29234	13.32366	15.11025	0	15.70392	0	15.58661	16.9756	17.64271	18.06854	18.16739	16.82838	0	0	0	0	0	0	14.59847	14.79689	0	0	0	0	15.05874	0	15.9317	14.81152	0	0	15.96477	12.52874
A0A669CES0	A0A669CES0_ORENI		"DNA integration [GO:0015074]; transposition, DNA-mediated [GO:0006313]"	HTH_Tnp_Tc3_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"DNA binding [GO:0003677]; DNA integration [GO:0015074]; transposition, DNA-mediated [GO:0006313]"	DNA binding [GO:0003677]	MAKTQPMISSR	2.130000114	1264.758237	12.26032	10.13932	13.29225	0	0	0	12.76965	10.25788	10.15297	0	0	0	0	9.041023	0	0	13.16038	0	14.98919	0	12.81945	0	15.31753	0	14.48362	18.125	14.1437	12.71442	12.0238	0	14.37775	12.18507	0	13.00089	9.269414	0	0	17.73126	0	13.71378	12.28693	11.29474	14.01874	14.4644	0	0	14.41229	0	0	0	7.687535	12.8748	11.7803	0
I3JIW5	I3JIW5_ORENI	hypk		HYPK_UBA domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SLREHMGNVVEALVALTN	5.090000153	1953.283357	13.43249	12.54257	12.01605	14.55421	9.96836	13.67142	16.03489	0	13.59265	12.37246	12.52464	14.52676	13.37837	0	0	0	12.17557	0	0	0	12.37192	0	13.51889	12.95572	12.90262	14.04049	8.496471	7.367434	11.70035	10.31038	15.07793	15.74252	15.34105	12.28297	12.03668	13.06985	13.91524	0	15.84613	11.69153	0	14.44358	0	14.71802	13.72257	0	13.4245	12.04408	8.975063	14.81638	0	0	14.59502	9.226591
A0A669DXX7	A0A669DXX7_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	"Hairy-related 4, tandem duplicate 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"DNA binding [GO:0003677]; protein dimerization activity [GO:0046983]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]; protein dimerization activity [GO:0046983]	KPMVEK	11.02000046	747.4364901	13.59388	15.28584	11.82279	14.56373	13.96386	14.1555	14.19278	15.40811	14.21913	14.40178	15.7327	15.65438	0	14.91049	14.8727	14.26055	0	15.49832	13.0734	12.70539	14.29383	15.78999	14.10683	4.280916	14.62627	0	0	0	0	0	16.0913	0	17.49425	14.32271	0	0	13.66921	0	0	0	14.41686	16.22898	13.18818	0	0	14.92222	13.25615	0	14.46796	14.27632	13.4807	0	0	16.11411
A0A669ENT4	A0A669ENT4_ORENI	LOC100695211	methylation [GO:0032259]	Hcy-binding domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		methyltransferase activity [GO:0008168]; methylation [GO:0032259]	methyltransferase activity [GO:0008168]	NSPVNFLMK	8.289999962	1066.080117	0	0	16.16388	16.08113	14.1089	0	15.49549	0	14.61067	12.62403	12.49777	13.27358	0	12.63792	10.99544	13.23802	13.8775	12.69406	11.71	0	10.95937	17.67509	0	0	14.02755	0	0	17.41699	16.17615	14.33361	0	0	0	0	0	0	0	0	0	0	14.46002	0	17.83643	0	0	0	0	0	0	15.22246	14.05904	0	0	0
I3JE26	I3JE26_ORENI	heca		Headcase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				HKLNTYHVR	7.920000076	1168.866066	12.07707	16.70344	14.42104	9.479632	16.3436	11.83337	0	6.312732	0	0	13.69189	14.12336	13.84905	13.65275	14.51661	12.60951	16.97939	12.955	0	0	12.01322	12.52845	10.98004	12.46402	14.8543	12.92071	0	14.52211	0	0	11.87341	12.96595	0	12.05178	14.64241	10.44452	13.84841	13.82121	11.93009	15.66742	17.50409	14.26249	15.05246	11.31561	13.31083	10.50694	11.11034	13.24976	13.8657	14.15333	12.29822	18.17792	19.03969	12.57797
A0A669BN16	A0A669BN16_ORENI			Heat shock protein 4a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATPase activity [GO:0016887]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	TPEKNLPEMDID	1.690000057	1418.046412	11.01124	0	0	0	0	13.02018	0	0	0	0	10.70021	0	0	8.159986	10.24648	0	13.94554	0	0	0	0	0	0	9.784843	0	0	0	0	0	10.13214	0	0	13.44911	0	0	0	8.663126	7.814405	0	13.35323	12.00968	0	0	17.78158	0	0	0	11.28452	0	9.358748	0	13.19607	0	0
C8CBS3	C8CBS3_ORENI	hsp70		Heat shock protein 70 (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATPase activity [GO:0016887]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	IQEIVLVGGSTRIPK	6.369999886	1610.457926	0	13.61469	15.8437	14.71515	16.46555	13.81228	0	15.17154	14.65269	14.13338	0	0	15.90816	15.008	0	0	0	0	0	0	0	0	0	0	0	0	16.23642	0	0	0	0	0	0	0	0	0	0	0	0	17.04324	0	0	0	0	0	15.4808	0	0	0	0	0	0	16.4802	0
A0A669CFK5	A0A669CFK5_ORENI		cellular response to unfolded protein [GO:0034620]	Heat shock protein b8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; protein homodimerization activity [GO:0042803]; cellular response to unfolded protein [GO:0034620]	protein homodimerization activity [GO:0042803]	AEGDFYTMGNR	13.28999996	1260.726113	14.86411	13.42589	13.80679	0	14.71254	16.71695	15.06065	16.42815	0	15.45902	14.58881	14.50107	14.79876	16.87998	14.02697	0	14.51402	15.44342	0	17.31635	14.2615	17.81681	10.12623	16.87348	15.49967	15.8274	0	16.47866	14.44849	13.78304	0	17.5986	16.97497	11.78768	0	16.86058	0	0	0	0	0	0	17.12918	17.94176	16.09875	0	0	0	0	0	0	0	0	17.6349
A0A669DSD2	A0A669DSD2_ORENI			Hedgehog interacting protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]; catalytic activity [GO:0003824]	calcium ion binding [GO:0005509]; catalytic activity [GO:0003824]	LLPPAS	1.830000043	595.5525205	14.49214	14.0548	12.82697	13.86135	13.24949	12.52296	0	12.16249	16.11815	0	0	14.40144	0	14.60968	0	12.62123	0	14.43454	14.91744	10.18402	13.69027	15.0114	15.02745	12.47625	14.11688	0	14.45017	12.93427	0	13.46138	17.54297	19.55629	18.44765	0	0	10.87472	0	14.42951	13.03574	0	15.21207	14.17661	0	13.97929	14.14975	14.49061	18.01289	15.48298	14.93474	15.60247	14.8307	15.66412	13.15549	14.34913
A0A669D8Y9	A0A669D8Y9_ORENI	brip1	nucleobase-containing compound metabolic process [GO:0006139]	Helicase ATP-binding domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; nucleobase-containing compound metabolic process [GO:0006139]	ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]	ENQQIASASLK	3.599999905	1188.081528	12.00238	8.070759	13.03829	9.949091	0	0	0	0	13.29656	0	0	10.98072	15.62849	0	0	0	0	14.97268	0	0	12.62613	13.67853	0	0	14.73307	0	15.49113	13.2174	0	0	0	0	0	18.96708	0	15.69476	0	0	12.27336	0	0	17.65036	0	0	0	9.76335	0	0	17.41517	10.46205	13.89187	11.73559	0	14.45991
A0A669CQS0	A0A669CQS0_ORENI			Hemicentin 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium ion binding [GO:0005509]	calcium ion binding [GO:0005509]	ISRVHVQDSGR	5.699999809	1253.631758	0	8.990792	14.81683	11.77444	0	15.66084	12.01245	14.13749	16.91509	0	14.30036	18.46262	14.68734	10.09914	15.07006	0	0	14.65354	0	0	0	0	0	15.57579	0	0	0	19.23714	0	18.55427	0	0	0	12.65017	14.53225	0	0	13.88687	0	10.4369	8.262799	13.84326	12.74403	0	0	0	13.95133	13.46171	0	0	0	0	0	0
I3JXY4	I3JXY4_ORENI			Hemicentin 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		QDGRQILMR	27.60000038	1133.407564	0	0	0	18.19432	0	0	13.59536	17.92416	0	0	0	16.16653	0	19.70403	17.11998	0	14.94881	0	16.28954	15.16158	16.95822	15.9001	17.00504	15.31241	18.18209	18.48158	19.34327	17.69878	18.69915	0	0	0	19.44773	17.32743	0	0	0	0	16.6392	0	0	0	16.08557	17.3961	17.61847	15.69168	14.39613	0	0	16.68231	17.75415	0	17.3305	0
I3JR71	I3JR71_ORENI	smarcal1	DNA repair [GO:0006281]; replication fork processing [GO:0031297]	HepA-related protein (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1) (Sucrose nonfermenting protein 2-like 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; annealing helicase activity [GO:0036310]; ATP binding [GO:0005524]; nucleosome-dependent ATPase activity [GO:0070615]; DNA repair [GO:0006281]; replication fork processing [GO:0031297]	annealing helicase activity [GO:0036310]; ATP binding [GO:0005524]; nucleosome-dependent ATPase activity [GO:0070615]	MDKQQPGNPFNVLIMVSLLFK	11.84000015	2452.147346	11.96669	14.56557	13.83742	14.51537	13.90683	0	0	0	16.35079	0	0	0	15.92951	16.75148	15.24976	0	15.65138	0	15.13383	14.28269	0	13.96455	0	0	0	0	15.23089	0	18.68368	0	0	0	19.37399	0	0	0	15.25314	16.72713	0	15.00586	15.7322	14.25343	17.69506	0	0	16.6662	0	15.80048	13.2608	16.75671	15.05397	0	15.32164	17.10269
I3IW99	I3IW99_ORENI		"heterochromatin organization [GO:0070828]; nucleosome assembly [GO:0006334]; regulation of transcription, DNA-templated [GO:0006355]"	Heterochromatin protein 1-binding protein 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleosome [GO:0000786]	"nucleosome [GO:0000786]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; heterochromatin organization [GO:0070828]; nucleosome assembly [GO:0006334]; regulation of transcription, DNA-templated [GO:0006355]"	chromatin binding [GO:0003682]; DNA binding [GO:0003677]	TPAVKK	2.720000029	642.3774053	13.82412	15.3593	15.19466	14.31863	0	0	0	15.07235	15.72517	16.01807	14.08577	14.0049	15.07356	0	14.7058	16.19924	0	12.16108	13.48967	0	0	0	13.29303	15.86676	13.34275	0	15.57212	13.13887	13.14446	0	17.98134	0	0	0	0	15.39324	0	15.34283	0	14.7369	0	12.31326	15.4561	0	14.44661	15.47357	0	12.81956	0	9.439804	15.12268	0	0	0
A0A669E345	A0A669E345_ORENI	LOC100706673		Heterogeneous nuclear ribonucleoprotein K	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleoplasm [GO:0005654]; spliceosomal complex [GO:0005681]	nucleoplasm [GO:0005654]; spliceosomal complex [GO:0005681]; DNA binding [GO:0003677]; RNA binding [GO:0003723]	DNA binding [GO:0003677]; RNA binding [GO:0003723]	LLIHQSLAGGIIGVKGAK	2.059999943	1774.414261	0	14.77477	12.58573	12.5324	10.28273	11.65385	12.96229	0	0	0	15.91204	13.02916	10.37957	12.00647	14.01048	0	10.62309	13.77579	10.44357	10.69079	12.91513	14.09158	0	13.67216	0	14.65343	6.941879	12.99853	14.25367	0	11.79848	0	17.24839	13.4071	11.51458	13.66183	14.50034	11.10154	0	13.86351	11.49337	11.72443	12.45478	0	11.74755	14.4059	13.72675	12.11122	0	12.17664	0	0	0	14.319
A0A669B3N3	A0A669B3N3_ORENI		"mRNA splicing, via spliceosome [GO:0000398]"	Heterogeneous nuclear ribonucleoprotein M	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"RNA binding [GO:0003723]; mRNA splicing, via spliceosome [GO:0000398]"	RNA binding [GO:0003723]	MSSGMDFGSPMGMDR	2.779999971	1637.315566	14.62615	15.0941	14.26106	11.76155	14.31257	14.43981	0	13.32594	16.26865	13.96765	15.65944	15.07474	15.51026	15.17325	15.85988	15.59729	16.60055	16.08243	16.48172	15.81787	15.32604	16.10049	0	14.62552	0	0	17.53332	13.27237	0	17.46082	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.8762	0	0	0	0	0	0
A0A669E6X9	A0A669E6X9_ORENI	HK1	cellular glucose homeostasis [GO:0001678]; glycolytic process [GO:0006096]; hexose metabolic process [GO:0019318]	Hexokinase (EC 2.7.1.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; glucokinase activity [GO:0004340]; glucose binding [GO:0005536]; cellular glucose homeostasis [GO:0001678]; glycolytic process [GO:0006096]; hexose metabolic process [GO:0019318]	ATP binding [GO:0005524]; glucokinase activity [GO:0004340]; glucose binding [GO:0005536]	DTNPTATVK	3.349999905	947.1185568	12.73567	0	0	12.76407	16.9992	12.32799	12.17916	14.19604	11.54335	12.44369	14.83754	0	13.52485	14.8795	13.98896	14.74963	13.0993	10.34603	14.7384	15.43869	0	4.609063	14.35133	13.91912	0	13.79575	0	0	0	13.6452	15.00962	16.76914	15.15739	18.30282	11.92682	14.72429	14.10199	11.39903	12.91437	0	12.05074	13.44031	0	14.34121	13.42187	13.18088	13.73836	12.13431	16.25074	14.95218	14.48987	13.79324	12.84931	15.32864
I3IV76	I3IV76_ORENI	B3GNT3	protein glycosylation [GO:0006486]	Hexosyltransferase (EC 2.4.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	"Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; transferase activity, transferring hexosyl groups [GO:0016758]; protein glycosylation [GO:0006486]"	"transferase activity, transferring hexosyl groups [GO:0016758]"	TFLLLLLLDFFLVLFCAQKK	28.23999977	2441.411658	0	0	0	0	0	0	0	18.08078	0	0	18.1233	15.86223	0	0	0	18.40513	0	18.13281	18.63799	0	17.40276	0	0	0	19.05036	0	0	0	0	17.89189	0	0	0	0	0	0	0	0	19.1355	0	0	0	0	0	0	0	0	11.70944	16.20802	0	0	0	0	0
A0A669CEP6	A0A669CEP6_ORENI	LOC112841661		High affinity IL-2 receptor subunit beta (Interleukin-2 receptor subunit beta) (p70-75)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; cytokine receptor activity [GO:0004896]	cytokine receptor activity [GO:0004896]	KPPSGVPR	12.47999954	836.6609849	15.89933	16.78856	17.07183	16.05813	15.35836	15.70807	0	0	16.39271	0	15.59049	17.20352	0	16.44893	17.00274	16.80257	0	0	0	0	15.91394	16.78592	17.36197	16.36821	15.33483	0	16.0369	16.2747	13.19475	10.55921	14.97733	13.69094	14.90813	0	10.87088	0	11.76527	0	17.03605	0	0	0	0	0	0	0	14.22822	0	0	0	0	12.88128	14.82622	0
A0A669CFN2	A0A669CFN2_ORENI			High density lipoprotein binding protein b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]	RNA binding [GO:0003723]	YGGGGGAAK	13.61999989	737.9812864	0	17.06731	15.50394	18.09614	0	18.28265	16.55269	19.26281	15.68013	18.34825	17.03693	17.96027	15.05636	15.56849	15.44874	15.08991	16.41993	16.84131	16.03008	16.30484	16.62161	17.28573	14.88611	18.26941	19.7012	16.66652	17.38978	17.32414	18.40305	18.58562	0	21.29583	17.45534	15.19802	15.89533	18.18468	15.85834	17.28022	0	17.27271	17.1987	16.73584	18.02551	15.796	15.66942	16.65755	15.87571	15.75644	16.30109	16.41094	16.29021	20.26204	18.13564	18.23308
I3J7Q8	HISAT_ORENI	hisat		Histidine N-acetyltransferase (EC 2.3.1.33)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		histidine N-acetyltransferase activity [GO:0047981]	histidine N-acetyltransferase activity [GO:0047981]	QGILLMR	6.03000021	845.8495191	14.35051	0	14.98289	13.94836	11.79409	12.56513	0	12.75551	13.10064	13.77256	13.02314	0	16.05767	14.51358	14.88444	14.76732	13.45763	14.85156	13.60058	11.40811	13.2152	14.50706	15.75638	15.98016	11.20248	9.807003	11.8606	14.32793	14.02923	14.06335	12.23794	0	13.72082	11.64347	12.14598	10.33163	14.63655	0	0	15.02867	13.47293	16.0288	12.85169	13.95008	12.74826	0	0	15.40632	13.62567	13.48534	15.53417	14.83084	0	0
A0A669CYZ7	A0A669CYZ7_ORENI	hars1	histidyl-tRNA aminoacylation [GO:0006427]	Histidine--tRNA ligase (EC 6.1.1.21)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; histidine-tRNA ligase activity [GO:0004821]; histidyl-tRNA aminoacylation [GO:0006427]	ATP binding [GO:0005524]; histidine-tRNA ligase activity [GO:0004821]	EMVNEK	8.260000229	764.2393595	9.023274	14.46728	13.40848	14.37307	13.77126	13.29265	15.01938	0	13.70764	14.75474	11.87469	15.36465	12.50901	14.31525	13.60853	9.917363	14.55739	14.39809	13.7644	11.03963	14.3667	14.56033	0	11.54822	14.33535	9.628756	14.31537	13.5202	13.11711	14.37236	17.21486	0	16.66762	15.69691	14.11217	15.17145	12.78354	14.12807	11.46239	12.77109	15.29823	13.11963	15.22642	0	14.03575	0	13.63651	13.51861	14.47102	13.57222	0	14.62878	0	16.53477
A0A669BWH7	A0A669BWH7_ORENI			Histone H2A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleosome [GO:0000786]; nucleus [GO:0005634]	nucleosome [GO:0000786]; nucleus [GO:0005634]; DNA binding [GO:0003677]; protein heterodimerization activity [GO:0046982]	DNA binding [GO:0003677]; protein heterodimerization activity [GO:0046982]	TEKPTKSK	4.159999847	918.5823192	13.56901	11.46719	16.51467	15.69076	14.94937	16.92607	16.55992	16.93716	13.93788	13.29675	16.67445	0	17.71309	0	15.83221	0	17.31038	16.78209	15.75168	15.6162	15.54584	15.29476	15.80931	17.35542	17.63893	14.41338	15.86634	0	0	17.61062	16.85918	0	0	16.97158	0	16.29723	12.21817	13.94513	15.1192	13.21373	0	14.94435	13.56456	15.00576	9.823597	0	0	0	0	0	0	0	0	0
A0A669F876	A0A669F876_ORENI	LOC100698988		Histone acetyltransferase (EC 2.3.1.48)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; histone acetyltransferase activity [GO:0004402]; metal ion binding [GO:0046872]; transcription coregulator activity [GO:0003712]	histone acetyltransferase activity [GO:0004402]; metal ion binding [GO:0046872]; transcription coregulator activity [GO:0003712]	TMMGAQQK	8.920000076	907.2406127	14.33816	18.88296	15.03741	0	0	0	0	0	0	0	0	0	0	0	0	0	21.63651	0	0	0	17.6997	0	0	0	0	0	0	0	0	0	0	0	0	0	16.55282	0	0	0	0	0	0	0	0	0	0	0	0	0	17.04484	0	0	17.94374	0	0
I3JRQ0	I3JRQ0_ORENI	LOC100696367		Histone deacetylase (EC 3.5.1.98)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	histone deacetylase complex [GO:0000118]	histone deacetylase complex [GO:0000118]; metal ion binding [GO:0046872]; NAD-dependent histone deacetylase activity (H3-K14 specific) [GO:0032041]	metal ion binding [GO:0046872]; NAD-dependent histone deacetylase activity (H3-K14 specific) [GO:0032041]	KATLEELQSVHTER	1.940000057	1641.401308	0	12.61173	13.08296	0	9.906077	13.24216	12.71921	14.06447	14.65686	15.25402	0	11.96952	0	0	0	12.99645	13.47373	14.8795	13.43958	13.10752	13.04336	0	13.64528	14.11614	13.27032	0	11.81258	14.08958	0	0	0	15.52961	15.00617	0	0	0	0	0	0	13.46368	0	0	13.72591	14.86667	0	0	14.26343	0	0	0	0	0	0	14.83939
A0A669E8C6	A0A669E8C6_ORENI	ezh2	histone H3-K27 methylation [GO:0070734]	Histone-lysine N-methyltransferase EZH2 (EC 2.1.1.356)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; histone-lysine N-methyltransferase activity [GO:0018024]; histone H3-K27 methylation [GO:0070734]	histone-lysine N-methyltransferase activity [GO:0018024]	VHGDR	12.43999958	584.4436693	15.36205	14.84715	14.79965	15.39041	15.45092	16.04001	0	15.72327	16.68353	15.44074	15.81191	15.32372	16.37914	16.3618	16.39133	0	17.60801	16.0329	0	16.88765	0	20.09281	0	0	15.68465	0	0	15.06549	0	15.14778	17.22419	18.54778	17.48495	16.2212	0	0	14.77007	14.43872	0	0	14.98928	14.82096	0	17.26895	0	15.1718	0	0	20.64738	17.32283	17.77788	0	17.571	0
I3JG58	I3JG58_ORENI	KMT2A	"regulation of transcription, DNA-templated [GO:0006355]"	Histone-lysine N-methyltransferase (EC 2.1.1.354)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	MLL1 complex [GO:0071339]	"MLL1 complex [GO:0071339]; DNA binding [GO:0003677]; histone methyltransferase activity (H3-K4 specific) [GO:0042800]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]; histone methyltransferase activity (H3-K4 specific) [GO:0042800]; zinc ion binding [GO:0008270]	AAGSSNTHATNPTSHNSSKSK	1.879999995	2084.940142	14.00683	14.54129	0	13.95677	0	15.8026	0	0	0	13.93318	0	13.56857	0	15.86825	0	0	14.74165	0	13.16582	0	12.39558	12.55426	0	0	14.30807	13.15854	13.13382	10.35854	14.90129	14.78487	0	16.1577	0	0	16.86554	15.89008	13.98362	0	0	12.70332	15.03943	14.95599	15.7794	14.87548	0	11.41046	15.64427	14.08855	14.65689	14.88769	16.20211	14.16658	14.83792	11.74549
A0A669DE39	A0A669DE39_ORENI	dot1l	regulation of cell cycle [GO:0051726]	"Histone-lysine N-methyltransferase, H3 lysine-79 specific (EC 2.1.1.360) (Histone H3-K79 methyltransferase)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; histone methyltransferase activity (H3-K79 specific) [GO:0031151]; regulation of cell cycle [GO:0051726]	histone methyltransferase activity (H3-K79 specific) [GO:0031151]	KHGEYTLER	1.75999999	1133.495535	0	0	12.38252	0	13.51538	0	0	0	0	0	10.93113	17.45721	0	13.41973	0	0	17.5974	14.6097	0	0	0	0	14.00746	0	0	0	14.30374	13.6104	0	11.85898	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.95692	0	0	18.36283	0	0
I3JTC0	I3JTC0_ORENI	LOC100692842		Holocytochrome c-type synthase (EC 4.4.1.17)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial inner membrane [GO:0005743]	mitochondrial inner membrane [GO:0005743]; holocytochrome-c synthase activity [GO:0004408]; metal ion binding [GO:0046872]	holocytochrome-c synthase activity [GO:0004408]; metal ion binding [GO:0046872]	AAAITK	2.380000114	575.4301114	0	10.58453	0	15.18967	13.37331	10.12746	13.41761	14.03555	14.40019	16.86774	0	0	13.05372	0	15.81774	16.51819	15.92689	0	18.0196	11.9838	0	0	0	11.64317	10.34839	13.3594	12.44661	14.53502	13.65554	11.98848	0	17.89411	0	13.835	15.36795	0	12.14215	15.39993	0	15.57486	13.70819	14.88808	0	14.0652	0	14.11476	15.60514	15.53875	0	0	0	18.70849	0	0
I3JG06	I3JG06_ORENI	LOC100534461	multicellular organism development [GO:0007275]	Homeobox domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; multicellular organism development [GO:0007275]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]"	NCSPSNNSGNASSKR	12.10999966	1579.468622	0	0	0	0	0	0	0	0	10.33194	0	0	14.38524	17.12524	0	17.96444	18.44635	13.94643	12.98987	13.38891	13.73746	12.11155	14.39755	0	15.15683	0	14.34634	15.31472	13.66518	12.41443	15.50942	0	13.63502	16.21066	14.30395	14.92368	13.91662	14.39636	14.74076	10.58259	0	0	7.866484	18.97765	14.18417	13.58875	14.02298	16.26712	16.06741	0	17.80451	0	15.96298	0	0
I3KG70	I3KG70_ORENI		multicellular organism development [GO:0007275]	Homeobox protein cut-like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; multicellular organism development [GO:0007275]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]"	LERAANR	5.480000019	829.0067293	16.80016	0	0	15.75106	0	0	16.95775	0	16.04018	15.87329	0	16.52911	0	0	16.24223	0	0	0	0	16.09753	0	16.11281	0	0	16.65024	16.8118	0	15.96033	0	16.30789	14.92817	16.69318	16.74104	17.1013	0	0	16.78067	15.6946	16.54712	17.04571	0	15.49832	0	0	16.01486	17.00182	0	0	16.08203	0	0	16.65504	16.31196	0
A0A669F7D5	A0A669F7D5_ORENI	LOC100708083	cholesterol metabolic process [GO:0008203]; triglyceride catabolic process [GO:0019433]	Hormone-sensitive lipase (EC 3.1.1.23) (EC 3.1.1.79) (Monoacylglycerol lipase LIPE) (Retinyl ester hydrolase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	caveola [GO:0005901]; cytosol [GO:0005829]; lipid droplet [GO:0005811]	"caveola [GO:0005901]; cytosol [GO:0005829]; lipid droplet [GO:0005811]; acylglycerol lipase activity [GO:0047372]; all-trans-retinyl-palmitate hydrolase, all-trans-retinol forming activity [GO:0047376]; hormone-sensitive lipase activity [GO:0033878]; triglyceride lipase activity [GO:0004806]; cholesterol metabolic process [GO:0008203]; triglyceride catabolic process [GO:0019433]"	"acylglycerol lipase activity [GO:0047372]; all-trans-retinyl-palmitate hydrolase, all-trans-retinol forming activity [GO:0047376]; hormone-sensitive lipase activity [GO:0033878]; triglyceride lipase activity [GO:0004806]"	IPDGIMAAYPATLLTTDASPSR	2.950000048	2277.645059	14.45255	10.83671	0	14.03374	14.84816	0	0	13.18151	0	10.2535	12.54961	10.01371	8.761696	0	14.38634	11.19074	11.24244	0	0	0	0	15.68693	11.40196	14.61645	10.76091	12.24296	9.992682	14.11065	0	13.42751	0	0	11.86775	11.68945	0	11.96365	13.2581	13.34411	13.1039	17.39252	12.28159	0	10.37245	11.44532	12.10194	13.88893	0	0	11.75937	10.54779	15.58938	9.949297	0	0
A0A669BZM8	A0A669BZM8_ORENI			Host cell factor C1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	MLL1 complex [GO:0071339]; Set1C/COMPASS complex [GO:0048188]	MLL1 complex [GO:0071339]; Set1C/COMPASS complex [GO:0048188]		MELQPGTAYK	2.170000076	1151.033592	0	13.96591	0	12.54512	10.44749	10.2199	17.0456	12.7292	0	0	12.13049	0	16.3288	0	14.4451	12.71585	0	0	0	0	13.80199	14.01328	9.906374	0	16.05756	14.09039	15.56606	14.0018	14.06261	0	0	0	0	11.40262	0	10.03316	13.23692	0	0	13.33377	14.2911	11.33597	13.46651	0	0	0	0	0	13.59548	0	0	11.75506	0	0
Q533X7	Q533X7_ORENI		multicellular organism development [GO:0007275]	Hox protein (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; multicellular organism development [GO:0007275]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]"	TPESGAGDGGSSR	4.599999905	1177.912974	12.8279	14.64312	14.05377	12.59081	0	14.68004	0	12.23643	15.33195	16.16011	16.76946	10.61905	12.23528	16.83564	16.90032	13.67176	0	13.59507	15.66999	0	12.8617	0	0	0	0	0	0	15.89252	15.84018	0	18.07091	18.42757	18.51558	0	15.38975	0	14.82138	0	15.22329	15.38583	0	15.29558	13.94478	14.64772	14.92822	17.96424	0	0	0	0	0	0	0	0
C1KG00	C1KG00_ORENI		multicellular organism development [GO:0007275]	Hoxc4a (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; multicellular organism development [GO:0007275]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	QQVLEL	6.840000153	728.9060523	0	0	16.42306	0	0	0	0	17.4694	0	18.67268	13.44347	16.76897	14.06454	14.51215	13.68655	17.37027	0	14.10728	16.38103	0	12.12672	0	11.01134	0	14.77832	0	0	13.57025	0	15.27059	0	0	0	13.12036	0	0	0	14.68331	0	0	0	13.1056	0	0	14.43141	0	9.185228	9.443825	0	0	0	0	0	0
I3IZC1	I3IZC1_ORENI	CDC37		Hsp90 chaperone protein kinase-targeting subunit (Hsp90 co-chaperone Cdc37) (p50Cdc37)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; protein kinase binding [GO:0019901]	protein kinase binding [GO:0019901]	VQAEEKK	4.760000229	830.5244546	13.78283	0	14.11725	13.93946	14.62614	14.55087	16.16346	14.86847	13.89457	15.39371	15.05122	14.81535	13.40439	0	0	0	13.13037	15.14103	14.25771	0	11.16864	14.04626	0	15.22725	0	14.10138	14.06737	0	13.70579	0	14.07403	0	15.40192	14.00074	0	15.50197	13.84634	14.37098	14.95901	14.59091	14.17202	13.38892	14.25872	13.51966	0	12.72648	0	15.75462	13.56911	14.61687	0	13.36298	12.9616	14.18682
A0A669AXB7	A0A669AXB7_ORENI			HtrA serine peptidase 3a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		serine-type endopeptidase activity [GO:0004252]	serine-type endopeptidase activity [GO:0004252]	YFLGIWMVTITK	5.78000021	1471.544998	15.77216	0	0	0	0	0	12.31312	0	0	12.45428	0	12.66042	0	0	0	9.53736	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.18121	0	0	15.16001	0	0	17.19775	0	0	0	0	13.6169	0	10.26223	0	0	10.21993
I3IZR2	I3IZR2_ORENI	LOC100706739	carbohydrate metabolic process [GO:0005975]	Hyaluronidase (EC 3.2.1.35)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		hyalurononglucosaminidase activity [GO:0004415]; carbohydrate metabolic process [GO:0005975]	hyalurononglucosaminidase activity [GO:0004415]	LFLSSQIK	15.89000034	935.4571635	16.64442	18.18414	15.62416	15.43327	0	15.80742	15.07536	18.09711	16.58021	11.11968	14.23136	17.49396	0	0	17.03868	0	16.2608	13.2915	16.10646	0	16.41484	0	0	0	15.16024	13.83851	14.35109	16.32376	17.48084	13.76192	16.07514	7.870672	15.15257	14.50842	0	16.52623	12.52559	12.27312	0	12.04672	14.40221	16.80099	0	0	17.63173	0	12.85919	0	14.54265	13.68117	14.52238	0	13.23586	13.41974
I3K0G4	I3K0G4_ORENI	hvcn1		Hydrogen voltage-gated channel 1 (Voltage-gated hydrogen channel 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of plasma membrane [GO:0005887]	integral component of plasma membrane [GO:0005887]; voltage-gated proton channel activity [GO:0030171]	voltage-gated proton channel activity [GO:0030171]	KHGIDI	4.03000021	683.2036687	13.89736	12.93851	14.6891	14.15697	14.98129	0	15.28606	14.13149	0	14.38821	0	0	15.8031	13.50173	14.15694	0	14.53807	14.78021	12.74965	0	12.86202	0	16.10483	14.0351	14.66702	11.17391	0	13.74691	12.81682	14.87627	16.71935	19.20284	18.63827	13.43969	0	0	15.04809	12.29172	14.37953	14.40831	14.82621	12.6301	14.09275	0	14.75628	14.50771	14.39229	14.39931	15.11587	12.53413	14.54584	14.03331	15.77351	13.54229
A0A669ELY9	A0A669ELY9_ORENI		fatty acid beta-oxidation [GO:0006635]	Hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit alpha a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial fatty acid beta-oxidation multienzyme complex [GO:0016507]	mitochondrial fatty acid beta-oxidation multienzyme complex [GO:0016507]; 3-hydroxyacyl-CoA dehydrogenase activity [GO:0003857]; enoyl-CoA hydratase activity [GO:0004300]; NAD+ binding [GO:0070403]; fatty acid beta-oxidation [GO:0006635]	3-hydroxyacyl-CoA dehydrogenase activity [GO:0003857]; enoyl-CoA hydratase activity [GO:0004300]; NAD+ binding [GO:0070403]	MAVTRAAGVFSK	6.110000134	1237.727121	13.37001	11.34429	0	14.41577	0	11.01899	15.50412	11.65475	0	0	0	4.537279	0	0	18.13207	15.70628	13.46727	15.42373	13.37045	12.08101	0	13.58145	15.06468	14.0433	12.74074	17.15927	0	17.56206	16.90641	0	22.72878	22.43431	19.94426	13.16358	0	0	0	13.79178	11.66274	0	0	0	14.02262	16.69355	0	19.73379	19.5833	19.06826	15.58712	0	16.38167	11.67706	15.82662	16.83561
I3KYI9	I3KYI9_ORENI	HCAR1		Hydroxycarboxylic acid receptor 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; G protein-coupled receptor activity [GO:0004930]	G protein-coupled receptor activity [GO:0004930]	SKSNLSWHK	2.74000001	1086.099012	8.214445	14.35309	16.79056	14.92033	18.82851	0	13.22815	12.74418	0	15.43894	11.86324	13.85169	13.20585	13.16454	17.10944	14.8826	11.10441	13.7858	15.58201	13.99791	14.47587	12.61933	12.22437	15.04996	10.89202	0	15.07879	12.01721	19.5358	18.52104	15.40752	18.90411	19.59932	13.70035	0	12.36011	12.10635	12.41415	16.38575	18.91002	12.20358	7.224857	17.42387	13.08607	0	0	12.13689	0	15.52313	17.05418	13.75876	12.46021	18.91255	17.54362
A0A669E6I3	A0A669E6I3_ORENI		fatty acid beta-oxidation [GO:0006635]	Hydroxysteroid (17-beta) dehydrogenase 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	peroxisome [GO:0005777]	peroxisome [GO:0005777]; oxidoreductase activity [GO:0016491]; fatty acid beta-oxidation [GO:0006635]	oxidoreductase activity [GO:0016491]	IKDAGSELVK	19.65999985	1058.884017	0	17.54747	0	17.11197	0	17.79809	19.85413	0	18.42493	0	0	18.14447	15.41478	15.37973	15.67133	16.72834	16.82079	0	0	17.64207	16.46941	0	0	0	0	17.88145	19.55399	0	19.31598	19.09551	18.1715	18.94221	18.89542	17.89813	17.15356	17.56972	17.62465	16.75746	16.59177	16.40594	15.79145	16.45854	16.909	16.81525	17.1085	0	16.9032	16.31809	0	0	17.31954	14.86446	18.33076	19.21362
I3JNY9	I3JNY9_ORENI			Hyperpolarization activated cyclic nucleotide gated potassium channel 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; sodium channel activity [GO:0005272]; voltage-gated potassium channel activity [GO:0005249]	sodium channel activity [GO:0005272]; voltage-gated potassium channel activity [GO:0005249]	MLGSERAVEHER	2.920000076	1430.340047	14.96192	14.92229	11.03697	0	0	13.68952	13.76036	10.02149	0	14.83735	0	14.22406	0	0	0	10.35411	0	14.557	0	14.70482	12.24829	13.31748	12.82734	15.79936	15.52948	13.25275	11.28584	13.30857	0	13.57649	15.33611	15.55074	13.99141	0	13.4697	0	0	14.60436	13.1344	11.99051	14.54305	0	15.05463	0	12.21281	0	18.32275	13.92075	0	13.66679	11.47692	0	16.99643	14.69963
C7T453	C7T453_ORENI	hcrt	"circadian sleep/wake cycle, wakefulness [GO:0042746]; feeding behavior [GO:0007631]; multicellular organismal response to stress [GO:0033555]; neuropeptide signaling pathway [GO:0007218]; response to starvation [GO:0042594]; sleep [GO:0030431]"	Hypocretin-1 (Orexin-A)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum [GO:0005783]	"endoplasmic reticulum [GO:0005783]; circadian sleep/wake cycle, wakefulness [GO:0042746]; feeding behavior [GO:0007631]; multicellular organismal response to stress [GO:0033555]; neuropeptide signaling pathway [GO:0007218]; response to starvation [GO:0042594]; sleep [GO:0030431]"		MLWFPTK	2.559999943	921.5772309	13.6879	16.08077	13.60523	15.18262	0	14.82165	14.73696	0	17.13734	0	0	16.23674	0	15.80436	0	15.56908	15.8469	15.80111	0	14.66958	0	15.83177	0	15.31501	15.73515	12.96932	15.66121	0	14.91292	0	0	0	15.85796	19.17472	15.83544	0	14.83609	14.88313	15.85195	14.75023	0	0	14.22976	15.24138	14.39142	12.58729	15.62316	14.86765	0	16.86834	0	15.25661	16.77474	16.66729
I3JTV1	I3JTV1_ORENI	LOC100704213	IMP salvage [GO:0032264]; purine ribonucleoside salvage [GO:0006166]	Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; guanine phosphoribosyltransferase activity [GO:0052657]; hypoxanthine phosphoribosyltransferase activity [GO:0004422]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]; IMP salvage [GO:0032264]; purine ribonucleoside salvage [GO:0006166]	guanine phosphoribosyltransferase activity [GO:0052657]; hypoxanthine phosphoribosyltransferase activity [GO:0004422]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]	AEFAVQSEGR	1.789999962	1094.339705	13.5291	12.99548	12.44737	16.32071	15.27068	10.94116	12.8049	15.47785	0	11.86229	15.05087	0	15.63558	14.91117	13.86313	14.03254	0	13.93879	14.73379	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.63696	17.52379	0	0	0	0	17.53346	15.27555	16.50233	0	14.1117	0	0	14.20834	0	0	0
I3KAB1	I3KAB1_ORENI	ikbkb		I-kappa-B kinase (EC 2.7.11.10)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; ATP binding [GO:0005524]; IkappaB kinase activity [GO:0008384]	ATP binding [GO:0005524]; IkappaB kinase activity [GO:0008384]	VACSK	9.630000114	562.9939269	0	15.49986	15.81413	0	14.50202	14.50924	0	15.17741	0	15.89577	14.27384	14.57313	14.57182	14.27389	0	13.80067	14.03078	0	16.20475	13.71721	15.28454	0	0	15.53741	13.81418	0	0	12.73074	14.12286	13.84688	0	16.86988	19.33266	15.26908	14.27266	14.53685	13.92023	13.18285	15.18602	15.84933	13.25687	14.98748	13.32867	13.90019	15.11695	15.46206	14.33065	14.24963	13.93748	15.27402	12.81024	14.34137	13.15845	14.8447
A0A669BZ41	A0A669BZ41_ORENI	LOC100690950	apoptotic process [GO:0006915]; endocytosis [GO:0006897]; regulation of clathrin-dependent endocytosis [GO:2000369]	I/LWEQ domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]	clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]; actin binding [GO:0003779]; clathrin binding [GO:0030276]; phosphatidylinositol binding [GO:0035091]; apoptotic process [GO:0006915]; endocytosis [GO:0006897]; regulation of clathrin-dependent endocytosis [GO:2000369]	actin binding [GO:0003779]; clathrin binding [GO:0030276]; phosphatidylinositol binding [GO:0035091]	NGNLHDR	5.110000134	826.4579529	11.58389	14.11786	14.47352	14.06793	14.15568	14.38503	12.96023	12.18689	15.25936	13.13073	14.67181	11.71213	13.33915	15.73498	13.56892	13.34345	15.1296	14.58485	13.05168	14.37475	14.52942	11.47645	15.40895	15.20471	0	13.82545	14.12905	0	15.91318	16.53082	15.71651	16.01196	16.37986	11.44752	13.55404	11.69378	14.19918	0	14.73119	14.86348	0	12.10347	14.77849	0	0	15.28742	13.88655	14.21798	14.85858	15.33942	15.32554	15.04927	15.50761	15.19168
I3JS62	I3JS62_ORENI	LOC100698206		IF rod domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	intermediate filament [GO:0005882]	intermediate filament [GO:0005882]; structural molecule activity [GO:0005198]	structural molecule activity [GO:0005198]	MATMMLSR	7.239999771	971.6248984	13.47312	12.60193	15.23091	11.77198	13.18664	12.53322	14.72921	13.03512	14.00745	0	14.50018	14.67539	15.17166	14.3197	15.10892	13.74742	13.26377	11.76303	0	16.20662	13.31137	15.53677	14.44416	15.28213	14.67395	16.50808	13.45924	15.14732	13.81525	14.63991	0	0	0	14.51091	0	15.10676	11.09521	0	15.81224	0	14.52963	0	13.45798	16.9852	15.00338	0	0	0	14.11118	11.525	11.50515	14.94196	0	15.92428
I3KPW3	I3KPW3_ORENI	LOC100707554		IG domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		ASFCDGFRNGK	4.710000038	1259.107544	14.1787	13.07857	12.94653	6.779572	0	12.52924	0	16.5927	0	12.61857	14.40261	11.62784	11.15952	10.67129	0	0	0	0	0	0	0	0	15.92738	16.25226	0	0	0	0	0	0	0	0	0	13.83081	0	0	0	0	0	0	0	14.20023	15.60946	0	14.76429	0	15.72123	0	16.96685	14.12254	0	0	0	0
I3IZ01	I3IZ01_ORENI			IGc1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VTGCEVLEDGQPALIMFR	6.619999886	2035.020783	12.90113	13.05973	0	0	13.82625	14.74603	14.78713	18.3605	18.52549	13.36142	14.36982	0	14.68075	0	11.9163	0	0	12.61129	10.88539	12.5495	0	13.41627	0	14.63102	11.82116	11.18843	11.08641	0	10.69302	11.9788	12.09126	16.59566	19.86734	17.85265	14.06076	13.97803	15.01203	0	12.96514	12.45275	0	16.46314	15.42632	0	15.58702	13.75844	13.12071	0	15.41633	15.59429	16.06189	20.06734	0	0
A0A669DVD1	A0A669DVD1_ORENI			IGv domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QYPGKPQEFLISHLGTGVKMSDPVPGITFK	8	3287.874702	12.83957	11.99239	0	13.9258	16.77784	0	12.69215	15.47566	12.09207	12.35819	10.61642	10.17057	0	12.74076	14.59687	0	9.914595	0	0	0	12.20162	0	13.1819	13.86123	13.10676	13.5054	14.97637	0	0	11.55079	12.35015	0	13.90349	0	11.36169	0	0	0	0	0	0	0	8.212968	0	0	0	0	12.15335	14.72629	0	0	19.28063	0	12.56165
A0A669EHZ9	A0A669EHZ9_ORENI	LOC112841661		IL2RB_N1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; cytokine receptor activity [GO:0004896]	cytokine receptor activity [GO:0004896]	KTVDLMER	7.96999979	1004.611046	16.87823	16.47305	16.31446	16.03046	16.70685	17.23684	15.55745	0	13.80932	0	16.42207	17.55719	0	17.12339	17.44552	15.39802	0	17.44773	0	14.57481	14.73255	18.23154	17.12889	0	14.23509	15.39047	17.54906	0	0	16.75159	15.67365	16.17315	15.36645	16.66704	0	18.36723	16.31023	0	15.47825	0	15.16163	17.3298	0	0	0	0	0	0	0	0	0	0	0	0
A0A669EP95	A0A669EP95_ORENI		regulation of ARF protein signal transduction [GO:0032012]	IQ motif and Sec7 domain ArfGEF 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; guanyl-nucleotide exchange factor activity [GO:0005085]; regulation of ARF protein signal transduction [GO:0032012]	guanyl-nucleotide exchange factor activity [GO:0005085]	SDRGSLSR	5.090000153	876.4172993	0	18.82689	18.76437	21.58515	20.10684	0	0	20.38877	20.40286	20.11964	20.09379	19.40919	0	0	17.52579	0	0	0	15.71265	18.5153	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669BM26	A0A669BM26_ORENI		regulation of GTPase activity [GO:0043087]; signal transduction [GO:0007165]	IQ motif containing GTPase activating protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		regulation of GTPase activity [GO:0043087]; signal transduction [GO:0007165]		TALQEEIKSK	1.070000052	1143.808463	11.77366	0	13.74445	13.14958	14.42153	12.37773	0	11.09678	16.8406	0	13.64869	0	15.41526	0	0	0	14.82156	0	0	14.47941	14.58714	0	14.79868	0	0	0	0	0	12.84692	10.7514	0	0	0	0	0	0	0	14.08479	0	0	0	0	10.2706	0	0	10.21619	0	0	0	0	0	0	0	0
A0A669BVX2	A0A669BVX2_ORENI	LOC100697996		IRF tryptophan pentad repeat domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; transcription regulatory region sequence-specific DNA binding [GO:0000976]	DNA-binding transcription factor activity [GO:0003700]; transcription regulatory region sequence-specific DNA binding [GO:0000976]	ADGLYARR	14.61999989	921.924014	17.59571	17.14585	16.36529	16.47486	18.15232	17.92313	16.63962	0	0	17.24623	15.60142	18.10285	16.0307	15.654	14.61613	16.79474	16.15007	16.40562	16.72772	16.73484	0	16.21036	15.65321	0	10.24757	14.87002	14.73286	17.63536	0	0	16.22016	0	16.44845	18.88209	0	18.15697	18.73385	17.35505	18.5776	18.48382	18.6917	16.70109	18.20571	15.81719	0	17.44403	0	0	15.40602	0	16.9789	0	16.56194	0
A0A669EET1	A0A669EET1_ORENI			IRF-2BP1_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		HRADSMSDMSDSHK	1.659999967	1635.829257	15.37202	0	14.49749	12.99119	15.58192	0	16.80877	15.46772	15.32052	0	16.43697	0	0	0	0	0	14.65964	15.83988	14.1836	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.50179	0	0	0	0	0	0	0	0
A0A669DKT7	A0A669DKT7_ORENI			IRG-type G domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; GTP binding [GO:0005525]	GTP binding [GO:0005525]	DTLLYVMPNVNPDVISK	4.940000057	1935.4277	16.40461	0	0	0	14.45446	0	0	0	0	0	13.89154	14.25936	0	13.8591	0	14.76706	0	0	14.1553	0	13.48706	12.14447	0	0	0	11.50495	0	15.65515	0	0	16.94088	0	0	16.14779	0	16.06003	14.49166	0	13.36159	9.637181	0	16.12471	0	13.12043	16.01037	16.76198	0	15.99382	0	14.90236	0	0	14.78162	0
I3KA60	I3KA60_ORENI	dok6		IRS-type PTB domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MMEEMEK	12.31000042	971.7815676	14.98934	0	0	16.23577	12.73395	0	0	15.57089	13.11807	13.34446	0	15.03171	12.62202	12.30787	14.11648	15.21605	16.52286	13.24955	0	0	0	0	0	0	17.18487	14.41132	13.01701	13.98652	0	0	13.49444	0	0	13.92449	0	11.29173	15.21564	0	0	0	0	15.18391	0	13.70529	0	0	0	0	0	16.32216	0	0	0	0
I3KDI2	I3KDI2_ORENI	LOC100704193		IU_nuc_hydro domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GMMVLDYMEK	9.729999542	1232.254092	12.5074	0	7.774207	15.69835	11.96404	0	0	10.5734	8.841127	0	12.89059	14.00914	12.46348	0	17.23442	4.454147	0	13.77724	0	12.66548	0	12.07827	0	0	0	11.97012	13.8344	12.67842	16.78446	0	15.814	16.0069	17.24257	0	13.62816	10.91573	12.4378	13.84694	10.42304	0	16.17529	0	10.90159	13.48383	0	0	0	0	0	19.56035	0	0	0	7.45217
I3JKJ2	I3JKJ2_ORENI	LOC100628564	antigen processing and presentation [GO:0019882]; immune response [GO:0006955]	Ig-like domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; MHC class II protein complex [GO:0042613]	integral component of membrane [GO:0016021]; MHC class II protein complex [GO:0042613]; antigen processing and presentation [GO:0019882]; immune response [GO:0006955]		EMEYIYSHYYNK	4.650000095	1651.791277	14.45978	14.88815	17.95398	17.77896	19.61463	19.96363	19.04935	14.64443	0	0	0	0	0	0	0	0	17.33821	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18.83835	0	15.44278	0	0	0
A0A126CP11	A0A126CP11_ORENI			IgM heavy chain VH region (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NKFSVELDSSSNTVTLTGR	8.81000042	2054.276597	0	15.6229	14.73754	12.63797	13.14864	14.05417	14.79251	0	15.30115	14.36181	14.55508	0	0	0	0	0	13.87429	0	12.1841	13.21512	12.63405	0	16.41926	16.37546	0	0	0	15.58664	15.20983	0	17.37287	0	17.88782	14.55881	14.41076	0	13.60753	14.63618	15.80683	14.51219	0	14.94196	16.32685	16.21202	14.59185	0	0	0	15.49669	13.03767	0	0	0	16.76341
A0A669D794	A0A669D794_ORENI			Immediate early response 3-interacting protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SVRTVMR	5.869999886	864.3793766	0	15.39552	15.0001	15.85095	0	15.16419	0	16.37857	16.0803	15.77538	16.89911	16.08521	17.20054	15.28564	0	16.69614	15.5383	15.18355	14.78011	15.18312	0	17.77367	0	17.48993	16.43515	17.30301	15.38565	16.14405	16.55828	14.92921	16.33647	0	16.95961	15.73952	17.17621	0	15.59628	16.96795	15.45137	17.03224	0	16.43368	16.95362	0	16.18467	17.16121	0	15.59508	13.15753	16.97594	0	17.06861	0	17.05257
I3IW19	I3IW19_ORENI			"Immunoglobin superfamily, member 21a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GARPLISR	2.470000029	869.3506311	13.24852	11.55743	13.25782	14.90862	12.70437	0	0	13.7977	12.62382	15.90275	15.10616	0	14.61268	0	14.33749	11.58763	14.64491	12.8539	0	12.47685	16.90103	15.00515	16.095	0	13.34605	0	11.22223	15.12283	12.00631	15.74402	0	0	15.37824	0	0	7.733547	11.82281	14.68303	14.38018	15.05738	0	13.60336	0	0	12.15628	14.00665	13.79331	12.64625	0	0	0	0	0	0
I3KBQ9	I3KBQ9_ORENI			"Immunoglobulin like and fibronectin type III domain containing 1, tandem duplicate 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VELKVQPA	6.150000095	883.2194143	15.6155	16.31839	9.104544	0	15.24795	14.14304	0	12.75907	0	14.17405	0	16.37491	0	0	14.98901	0	15.708	15.87461	0	0	0	15.00567	17.66141	16.49071	15.32014	0	0	15.55971	0	0	15.91587	0	17.66184	0	0	0	0	14.97885	0	0	0	0	15.46766	0	0	0	0	0	19.1496	17.5716	15.34534	0	0	18.16959
I3J6L1	I3J6L1_ORENI		gonadotrophin-releasing hormone neuronal migration to the hypothalamus [GO:0021828]	"Immunoglobulin superfamily, member 10"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; gonadotrophin-releasing hormone neuronal migration to the hypothalamus [GO:0021828]		DMATTEPYMQSTFTR	7.579999924	1795.775616	0	14.9039	0	0	15.1464	0	0	0	15.66244	0	0	0	0	16.46521	0	17.40248	17.98758	17.27935	0	0	0	0	0	0	0	0	0	0	0	0	14.57197	0	0	0	16.15252	11.39097	14.12557	0	15.56199	0	0	0	14.92435	13.94592	0	0	0	14.92815	0	16.861	0	0	0	0
I3KGC3	I3KGC3_ORENI			"Immunoglobulin superfamily, member 3"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		EAAGQMTVR	6.679999828	961.7486546	14.95155	0	14.81897	0	0	0	15.70627	15.62759	0	0	15.10591	15.30751	0	12.86156	15.46407	15.0585	14.85371	14.37925	0	0	0	0	0	0	0	0	0	13.48439	0	0	15.75629	15.97218	0	15.04777	14.26042	15.86199	16.45635	12.20134	0	0	0	0	17.5395	13.02872	14.74725	15.47567	0	0	17.48189	0	0	0	0	0
A0A669DVT9	A0A669DVT9_ORENI	XPO1	intracellular protein transport [GO:0006886]	Importin N-terminal domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; nuclear export signal receptor activity [GO:0005049]; small GTPase binding [GO:0031267]; intracellular protein transport [GO:0006886]	nuclear export signal receptor activity [GO:0005049]; small GTPase binding [GO:0031267]	QPLIRSMR	28.84000015	1015.585721	12.71156	19.20189	14.53281	16.52892	12.01375	0	0	15.07234	0	0	15.88233	0	0	0	18.64121	0	15.68781	0	0	16.40986	0	16.37482	19.70387	16.72532	0	0	0	0	16.94271	0	17.96304	19.86719	17.48693	0	15.34153	0	11.5788	17.18955	12.56184	15.84318	18.34566	0	11.65814	12.10318	10.84456	0	12.82722	12.22982	0	0	0	0	0	0
A0A669BK05	A0A669BK05_ORENI	LOC100696635	protein import into nucleus [GO:0006606]	Importin subunit alpha	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; nuclear import signal receptor activity [GO:0061608]; protein import into nucleus [GO:0006606]	nuclear import signal receptor activity [GO:0061608]	AHKNENFLK	7.190000057	1100.32666	14.09943	12.71923	0	14.58286	16.16	16.19528	12.44246	15.40153	14.06545	11.29828	0	18.32405	15.0294	13.67314	11.8309	8.925588	15.43806	0	14.47239	13.33347	14.30016	14.55854	14.63274	15.11719	0	18.90334	14.92477	12.17125	17.35864	14.38479	12.94605	14.15141	13.43989	0	14.85177	18.14473	12.10496	14.481	13.67347	0	13.81797	0	0	0	6.398537	0	11.72889	14.63529	14.13102	0	12.56256	13.23703	0	17.40324
I3KQQ5	I3KQQ5_ORENI		intracellular protein transport [GO:0006886]	Importin-13	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; small GTPase binding [GO:0031267]; intracellular protein transport [GO:0006886]	small GTPase binding [GO:0031267]	GLQGSGYSDY	10.90999985	1046.520795	14.56849	13.25499	0	13.81408	10.0432	14.09672	0	0	14.26497	15.23679	17.32589	15.23456	0	16.16176	15.6355	17.2496	15.10955	14.03109	16.44198	12.75089	16.54338	0	15.55396	17.56752	15.98968	0	19.32188	14.53585	17.57959	0	19.41359	0	0	0	0	0	17.01962	0	15.3327	16.33491	0	16.58964	0	0	15.22084	0	0	15.72621	16.21263	0	14.61923	0	17.01482	0
A0A669ELF2	A0A669ELF2_ORENI			Inhibitor of Bruton agammaglobulinemia tyrosine kinase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TVIGVAAGR	9.699999809	844.1137401	14.16918	11.02708	14.73073	12.06107	12.61692	0	13.75609	13.93783	11.90361	0	14.34385	0	14.74196	12.12386	14.37508	14.6929	11.99177	14.68351	12.52991	15.26784	0	13.96976	0	16.93779	14.17274	10.41987	10.60799	12.0741	0	13.2825	0	0	13.81511	15.00921	12.80251	13.36129	13.42629	13.44349	12.97447	13.79167	14.00635	13.38311	13.88553	12.6355	13.06528	14.23511	0	11.5472	14.70895	16.44313	16.65448	0	12.59746	0
I3K535	I3K535_ORENI	ing4	hematopoietic progenitor cell differentiation [GO:0002244]; histone acetylation [GO:0016573]; negative regulation of cell population proliferation [GO:0008285]	Inhibitor of growth protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	MOZ/MORF histone acetyltransferase complex [GO:0070776]	MOZ/MORF histone acetyltransferase complex [GO:0070776]; metal ion binding [GO:0046872]; hematopoietic progenitor cell differentiation [GO:0002244]; histone acetylation [GO:0016573]; negative regulation of cell population proliferation [GO:0008285]	metal ion binding [GO:0046872]	TLSSEQKLSILR	7.440000057	1374.495789	13.10938	0	11.77495	11.66662	0	14.31173	0	15.14263	14.97763	14.47015	12.64592	9.287845	0	16.15998	13.1357	16.48772	15.62849	12.38167	15.64992	14.28693	15.23843	14.76826	0	14.40181	16.17676	16.52538	0	0	17.17955	13.33266	0	13.88807	0	15.70031	0	16.56842	13.89847	15.77496	14.38523	13.85455	0	0	0	16.06411	0	11.7345	0	0	15.31752	18.16687	15.55979	0	0	14.04809
I3J6G1	I3J6G1_ORENI	nfkbil1	I-kappaB kinase/NF-kappaB signaling [GO:0007249]	Inhibitor of kappa B-like protein (NF-kappa-B inhibitor-like protein 1) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; I-kappaB kinase/NF-kappaB signaling [GO:0007249]		GDTALHVAANR	3.299999952	1124.398428	11.43381	13.28149	12.97986	13.16462	13.70429	10.75008	11.04575	0	15.44921	0	14.09596	0	0	12.48597	11.1373	0	17.42661	0	0	0	17.44538	16.4446	13.19086	0	0	15.45723	14.24734	0	0	13.58154	0	13.59948	14.12067	0	7.811715	14.77159	12.78783	0	16.89794	11.1855	14.18306	0	11.25669	12.39726	0	13.87938	14.66331	12.83753	0	0	15.77391	0	0	15.99832
A0A669EKV7	A0A669EKV7_ORENI	LOC100692869		Inhibitor of nuclear factor kappa-B kinase subunit alpha (EC 2.7.11.10) (Nuclear factor NF-kappa-B inhibitor kinase alpha)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; ATP binding [GO:0005524]; IkappaB kinase activity [GO:0008384]	ATP binding [GO:0005524]; IkappaB kinase activity [GO:0008384]	LPLVPGDCSRPDTMER	2.5	1841.990484	14.45895	13.53457	10.09596	0	0	14.17003	14.25336	13.72171	13.59374	15.32477	14.41114	16.59487	17.38237	15.0314	0	0	0	15.67205	0	0	0	14.56416	16.62986	15.97178	0	0	17.68606	15.37863	0	15.89839	0	0	17.00518	15.56313	11.49563	0	0	16.76887	0	15.35073	0	0	0	0	0	0	0	15.01255	0	0	0	0	0	17.54241
I3JZZ5	I3JZZ5_ORENI	IMPDH	GMP biosynthetic process [GO:0006177]	Inosine-5'-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; IMP dehydrogenase activity [GO:0003938]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]; GMP biosynthetic process [GO:0006177]	IMP dehydrogenase activity [GO:0003938]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]	TKRPSVAIMACGRPQGTSVYK	1.950000048	2323.933183	13.21706	0	11.67492	14.21373	0	13.45243	13.36699	12.58995	13.59308	14.57631	13.90719	13.9372	11.37919	13.09931	13.10685	0	14.46604	13.74798	12.97716	0	12.89278	11.56952	13.30018	14.70182	12.99551	13.43137	14.25997	13.09055	11.13476	13.5177	14.2257	15.31599	0	14.95852	0	0	0	11.62772	12.548	13.98496	15.57006	0	0	10.19086	0	11.69922	13.45462	11.78518	13.75682	0	0	0	0	13.07317
A0A669F5W1	A0A669F5W1_ORENI			"Inositol 1,4,5-trisphosphate receptor, type 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	"endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; inositol 1,4,5 trisphosphate binding [GO:0070679]; inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity [GO:0005220]"	"inositol 1,4,5 trisphosphate binding [GO:0070679]; inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity [GO:0005220]"	AFSAFR	2.359999895	699.7319861	0	14.5231	0	13.81838	15.21458	13.54522	0	0	13.28436	0	13.3393	0	14.72014	13.14283	14.337	0	0	0	0	0	0	16.19543	0	0	0	15.39789	14.88544	0	0	0	0	16.37276	17.81862	18.84552	0	19.05584	0	15.28376	13.86174	0	0	0	0	0	17.38972	0	0	17.58196	15.9137	15.99041	16.67575	0	16.63956	17.08795
A0A669CYS4	A0A669CYS4_ORENI			"Inositol 1,4,5-trisphosphate receptor, type 3"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	"endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; inositol 1,4,5 trisphosphate binding [GO:0070679]; inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity [GO:0005220]"	"inositol 1,4,5 trisphosphate binding [GO:0070679]; inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity [GO:0005220]"	GGAGHWNSLYR	8.090000153	1218.429357	0	0	0	0	0	0	16.04638	0	0	0	0	13.0153	0	12.86546	12.14384	0	9.975038	0	8.815458	12.54316	0	15.08209	18.89775	15.00849	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.54553	0	15.2859	12.06106	0	0	0	15.91824	0	0
A0A669DA61	A0A669DA61_ORENI	ppip5k1		Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase (EC 2.7.4.21) (EC 2.7.4.24)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]	"cytosol [GO:0005829]; 5-diphosphoinositol pentakisphosphate 3-kinase activity [GO:0102092]; ATP binding [GO:0005524]; diphosphoinositol-pentakisphosphate kinase activity [GO:0033857]; inositol heptakisphosphate kinase activity [GO:0000829]; inositol hexakisphosphate 1-kinase activity [GO:0052723]; inositol hexakisphosphate 3-kinase activity [GO:0052724]; inositol hexakisphosphate 5-kinase activity [GO:0000832]; inositol-1,3,4,5,6-pentakisphosphate kinase activity [GO:0000827]"	"5-diphosphoinositol pentakisphosphate 3-kinase activity [GO:0102092]; ATP binding [GO:0005524]; diphosphoinositol-pentakisphosphate kinase activity [GO:0033857]; inositol-1,3,4,5,6-pentakisphosphate kinase activity [GO:0000827]; inositol heptakisphosphate kinase activity [GO:0000829]; inositol hexakisphosphate 1-kinase activity [GO:0052723]; inositol hexakisphosphate 3-kinase activity [GO:0052724]; inositol hexakisphosphate 5-kinase activity [GO:0000832]"	ARLHEILQK	11.25	1106.943067	0	0	9.900094	13.91109	14.15121	13.63919	13.14223	12.15211	0	13.38344	16.19157	12.54536	15.18611	13.20744	10.73275	13.68302	13.93219	0	0	17.34859	18.40957	14.55955	14.18177	15.64691	15.1286	17.01512	14.14585	14.87494	11.31691	16.94679	0	14.71757	14.58324	0	0	11.82052	13.83887	11.89215	17.73368	0	14.38307	18.02037	13.64329	0	0	13.72915	0	0	14.44636	0	13.23596	16.89484	15.48981	14.46563
A0A669BS03	A0A669BS03_ORENI	ISYNA1	inositol biosynthetic process [GO:0006021]; phospholipid biosynthetic process [GO:0008654]	Inositol-3-phosphate synthase (EC 5.5.1.4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		inositol-3-phosphate synthase activity [GO:0004512]; inositol biosynthetic process [GO:0006021]; phospholipid biosynthetic process [GO:0008654]	inositol-3-phosphate synthase activity [GO:0004512]	TTEMTIRTER	11.35000038	1237.370614	11.97166	0	12.47641	0	0	13.30862	0	18.12387	18.12779	0	0	13.6329	12.10699	13.98106	18.43813	0	13.42299	11.80122	0	9.37232	10.99881	0	12.87884	0	0	14.94812	13.14423	0	15.25309	13.24001	20.09268	15.91549	20.19289	0	13.68292	0	16.15108	0	0	0	18.38135	0	0	0	16.89754	13.30707	0	0	0	0	14.48973	0	0	0
A0A669AZZ8	A0A669AZZ8_ORENI		phosphatidylinositol dephosphorylation [GO:0046856]	Inositol-polyphosphate 5-phosphatase (EC 3.1.3.56)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"inositol-1,3,4,5-tetrakisphosphate 5-phosphatase activity [GO:0052659]; inositol-1,4,5-trisphosphate 5-phosphatase activity [GO:0052658]; inositol-polyphosphate 5-phosphatase activity [GO:0004445]; phosphatidylinositol dephosphorylation [GO:0046856]"	"inositol-1,3,4,5-tetrakisphosphate 5-phosphatase activity [GO:0052659]; inositol-1,4,5-trisphosphate 5-phosphatase activity [GO:0052658]; inositol-polyphosphate 5-phosphatase activity [GO:0004445]"	SAVSEMLK	8.029999733	882.2709532	0	0	0	14.1465	0	12.78419	13.68163	0	12.30259	14.00129	14.40691	11.96363	0	13.44475	14.85627	12.73077	15.75397	13.33606	11.60498	0	12.8751	12.71347	0	0	0	6.584731	14.68287	0	14.43975	0	0	12.52247	0	0	10.10138	15.21226	0	11.26425	0	12.44603	11.72924	15.17425	0	0	13.49736	12.72846	0	14.39986	13.44082	0	14.85292	0	15.29523	12.7645
A0A669ENV9	A0A669ENV9_ORENI		lysosomal transport [GO:0007041]	Insulin-like growth factor 2 receptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; mannose binding [GO:0005537]; signaling receptor activity [GO:0038023]; lysosomal transport [GO:0007041]	mannose binding [GO:0005537]; signaling receptor activity [GO:0038023]	YPEGSENWEVVDDKSSK	11.39999962	1967.637087	12.86342	16.00461	13.04381	7.247559	13.57546	9.381	0	14.75766	10.78909	14.33789	13.15938	14.7637	11.29774	12.53076	0	15.31831	0	0	0	0	13.5378	9.537971	13.05522	11.90275	0	0	13.14406	0	15.94347	0	0	0	14.42047	0	0	0	13.33025	11.47569	13.51668	0	0	11.69031	0	0	14.71877	13.27201	0	0	0	13.31853	15.5593	14.82802	12.21485	0
I3JGN5	I3JGN5_ORENI		negative regulation of cell population proliferation [GO:0008285]; regeneration [GO:0031099]; response to hypoxia [GO:0001666]	Insulin-like growth factor-binding protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; extracellular region [GO:0005576]	cytoplasm [GO:0005737]; extracellular region [GO:0005576]; insulin-like growth factor I binding [GO:0031994]; insulin-like growth factor II binding [GO:0031995]; negative regulation of cell population proliferation [GO:0008285]; regeneration [GO:0031099]; response to hypoxia [GO:0001666]	insulin-like growth factor I binding [GO:0031994]; insulin-like growth factor II binding [GO:0031995]	AAADAQESMK	7.010000229	1035.675869	14.59263	12.80104	14.16261	15.49481	13.33598	14.78097	0	13.72868	14.06067	15.35129	13.16037	18.96134	13.58862	16.18574	0	14.13352	0	15.89486	0	0	16.36166	0	0	11.28255	15.20383	13.92415	15.22567	0	0	14.55616	14.75036	12.38492	14.43926	14.3612	15.46599	14.52561	13.23474	13.07071	14.68727	0	0	13.1333	15.60645	11.74638	13.34885	14.31169	12.35985	12.66839	16.16902	14.20218	15.9256	0	14.16514	14.43706
A0A669CJZ0	A0A669CJZ0_ORENI	LOC106097077	DNA integration [GO:0015074]	Integrase catalytic domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		DNA integration [GO:0015074]		GKENLVVGQMQMAFHMR	23.88999939	2023.419913	0	0	12.32786	12.56285	10.96181	11.49302	14.42482	11.98902	13.85148	13.08449	15.16375	13.55371	0	0	0	0	13.44619	11.31336	0	12.96583	13.45406	12.87773	13.51552	10.66681	12.69472	13.66177	14.62903	13.12292	14.09339	13.9482	0	0	0	0	0	12.71027	13.39344	12.8678	0	0	13.948	12.49434	10.57947	15.26485	0	0	0	15.02927	13.33405	0	0	14.31331	14.41033	0
A0A669F0A2	A0A669F0A2_ORENI	ints10	snRNA processing [GO:0016180]	Integrator complex subunit 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integrator complex [GO:0032039]	integrator complex [GO:0032039]; snRNA processing [GO:0016180]		AEMLLLLLK	4.619999886	1043.015804	14.21555	15.64648	16.14996	15.57144	16.18894	15.63939	15.51306	15.06833	15.80865	13.35274	16.84222	13.56922	0	0	14.99306	0	0	0	7.96513	0	15.40285	15.14084	15.53727	0	0	0	0	0	0	16.8812	0	15.84092	15.15101	0	14.82301	0	16.57527	12.0299	14.56406	0	0	13.27597	0	0	15.50975	0	14.63493	0	0	0	17.86145	0	15.5148	0
I3KLV8	I3KLV8_ORENI	ints12	snRNA processing [GO:0016180]	Integrator complex subunit 12	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; metal ion binding [GO:0046872]; snRNA processing [GO:0016180]	metal ion binding [GO:0046872]	GTVSKLTLSK	11.06999969	1032.978236	14.30114	12.42989	13.35905	0	0	11.88667	14.1397	12.17708	11.35684	0	12.60673	8.35	17.71026	14.5167	12.89094	13.68308	14.97176	16.12967	10.99757	15.49036	14.15154	12.35567	0	0	13.63279	15.02756	10.83587	18.90531	0	7.723524	0	13.88092	14.97911	0	7.530654	17.46775	0	5.767612	16.02889	0	0	12.91301	0	0	0	14.10568	13.34328	15.34007	15.98251	12.49693	14.60036	0	0	13.4921
A0A669E5H0	A0A669E5H0_ORENI		snRNA processing [GO:0016180]	Integrator complex subunit 7	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integrator complex [GO:0032039]	integrator complex [GO:0032039]; snRNA processing [GO:0016180]		LFQKYPFPILINSAFLK	8.050000191	2039.037748	13.42179	14.17991	0	11.168	12.0145	0	8.877324	15.48492	0	0	0	11.86313	0	13.66	12.0934	0	9.052389	0	0	14.3425	13.9268	0	0	11.10512	13.1242	0	11.82508	14.19788	14.63624	16.0048	13.30797	14.04404	14.27983	12.66111	13.71041	14.00254	0	0	14.45241	14.08718	0	10.56652	12.88404	8.296292	11.64726	0	16.39595	0	13.87457	9.268588	10.01115	0	13.82873	13.71842
A0A669DGM9	A0A669DGM9_ORENI		cell-matrix adhesion [GO:0007160]; cell motility [GO:0048870]; hemidesmosome assembly [GO:0031581]; integrin-mediated signaling pathway [GO:0007229]	Integrin beta	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integrin complex [GO:0008305]	integrin complex [GO:0008305]; cell motility [GO:0048870]; cell-matrix adhesion [GO:0007160]; hemidesmosome assembly [GO:0031581]; integrin-mediated signaling pathway [GO:0007229]		AQSQEGWGPER	1.440000057	1241.901943	0	0	0	0	0	0	14.99658	13.90672	12.21618	15.09477	13.28379	0	13.89542	12.75202	0	0	0	13.60839	14.11438	12.7726	13.20228	0	14.38313	8.775696	12.78932	12.40634	13.43109	13.34129	0	0	0	0	19.43814	0	15.20316	0	0	16.017	14.32649	14.4404	0	0	13.97949	12.91664	0	12.76255	13.98494	0	0	0	0	14.63782	0	13.58516
A0A669BWR1	A0A669BWR1_ORENI		cell adhesion [GO:0007155]; integrin-mediated signaling pathway [GO:0007229]	"Integrin, alpha 10"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integrin complex [GO:0008305]	integrin complex [GO:0008305]; metal ion binding [GO:0046872]; cell adhesion [GO:0007155]; integrin-mediated signaling pathway [GO:0007229]	metal ion binding [GO:0046872]	ETIAPTAQR	1.679999948	985.4453425	13.38758	15.33463	0	6.573078	14.27147	12.00907	15.91403	14.79151	14.90664	15.11334	15.95634	14.61028	0	14.77575	12.91411	0	0	0	15.67568	15.26592	0	15.77781	0	0	0	0	0	14.13726	16.11714	0	0	0	0	0	0	0	0	15.70234	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669C8K6	A0A669C8K6_ORENI	LOC100704409	cell adhesion [GO:0007155]; integrin-mediated signaling pathway [GO:0007229]	Integrin_alpha2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integrin complex [GO:0008305]	integrin complex [GO:0008305]; cell adhesion [GO:0007155]; integrin-mediated signaling pathway [GO:0007229]		LSEGHMTE	6.550000191	920.6433674	15.17666	13.25781	13.7439	14.26288	15.26419	13.79283	14.06978	0	14.0787	15.03606	15.35667	13.86766	8.889904	0	14.91409	16.36292	15.25724	10.98044	0	14.99623	0	15.51607	15.81005	11.07566	15.01538	14.33924	15.04339	14.67207	13.37236	14.74419	16.21958	13.56902	16.46376	14.51687	14.33543	7.922856	12.98974	13.59341	12.1304	15.05445	13.68222	14.74577	13.84163	13.45555	13.00433	14.37904	14.07643	12.13854	15.56817	13.7179	13.95853	0	0	0
A0A669CJ86	A0A669CJ86_ORENI			Interaction protein for cytohesin exchange factors 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LTEAAELDEAINSEGERIK	7.460000038	2087.112335	0	0	0	0	0	0	0	14.76353	14.772	15.23467	16.37196	15.53863	13.27652	12.31964	13.98506	0	13.31538	14.81273	12.64565	12.82439	0	14.63281	14.87193	13.29918	13.94182	14.66778	12.89709	0	0	15.56796	16.34138	16.7351	17.46059	14.28703	14.22731	14.98929	15.77337	0	15.97489	15.12801	0	15.1364	14.28314	15.06049	14.78548	15.21916	15.19422	15.81611	0	0	15.51404	15.61679	15.06486	12.3025
A0A669D5F1	A0A669D5F1_ORENI			Interferon regulatory factor 2 binding protein-like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		MCYTSQVSR	9.75	1148.449592	0	16.33519	7.965215	12.97591	13.595	0	13.11344	0	12.54412	11.84111	10.33058	12.9649	12.6445	0	0	0	12.81854	0	0	12.65864	14.21272	13.52795	14.18906	13.16808	0	14.66323	0	0	11.26093	0	0	15.97314	15.62564	16.1485	16.42449	0	0	0	0	13.44192	15.02505	0	0	0	0	15.55641	0	0	0	15.12613	14.04644	12.02604	14.01849	0
A0A669CYY9	A0A669CYY9_ORENI	LOC100704899	apoptotic process [GO:0006915]; negative regulation of cell population proliferation [GO:0008285]; regulation of immune response [GO:0050776]	Interferon regulatory factor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; transcription regulatory region sequence-specific DNA binding [GO:0000976]; apoptotic process [GO:0006915]; negative regulation of cell population proliferation [GO:0008285]; regulation of immune response [GO:0050776]	DNA-binding transcription factor activity [GO:0003700]; transcription regulatory region sequence-specific DNA binding [GO:0000976]	PVSRMR	3.559999943	762.150493	14.68175	13.29488	14.09824	11.16881	12.76562	9.957673	16.4078	15.50477	14.59253	16.93806	16.86909	14.66249	16.40307	0	15.28396	15.83696	0	16.34967	16.30299	0	16.65796	16.27662	14.95948	16.83602	0	16.29015	16.49594	0	0	15.73584	17.28378	18.87481	20.7021	17.2032	0	0	15.10059	0	13.12647	17.30989	15.62149	15.57317	14.0064	15.18597	14.43599	15.62428	0	0	0	0	14.8295	15.45395	0	0
I3KQS9	I3KQS9_ORENI	LOC100693184	endocytosis [GO:0006897]	Interferon-induced GTP-binding protein Mx (EC 3.6.5.5) (Interferon-inducible Mx protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; endocytosis [GO:0006897]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	APPSIPSR	16.35000038	824.3570122	17.71987	14.54263	18.1171	15.9064	16.24066	16.27646	0	18.72341	0	0	16.92802	17.61783	18.99887	0	12.47021	0	15.91382	0	10.81172	10.81048	0	18.74776	12.16512	19.27869	18.88201	18.19581	17.76877	0	0	18.55785	19.44936	0	17.21008	0	0	14.173	16.66291	12.41673	17.81731	0	18.32349	12.45239	19.88463	0	13.74544	0	16.58802	16.38256	19.35164	0	18.26352	18.20074	16.83257	0
A0A669ELK3	A0A669ELK3_ORENI	LOC100712047		Interferon-induced GTP-binding protein Mx (Interferon-inducible Mx protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	DMIMQFVTK	7.869999886	1144.746539	13.64046	14.0102	12.56102	9.5097	12.51712	0	14.54727	14.2882	13.40007	0	13.55434	13.19768	14.30141	13.94511	13.82113	14.2659	0	11.82734	12.91273	0	0	13.90519	0	14.52668	0	0	8.556294	0	17.65569	16.73988	14.81524	19.12924	15.05035	16.38871	14.27416	12.1515	13.83676	13.99907	13.85357	14.14862	17.69187	0	16.08689	14.29326	0	13.25714	0	0	0	0	13.85449	12.10177	0	0
I3KJ52	I3KJ52_ORENI			Interferon-related developmental regulator 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DVFELGPPMLVDSATMKAMK	7.920000076	2195.983376	0	13.23761	13.22554	16.02178	12.09902	13.30027	13.65184	13.52369	0	11.94555	14.25898	0	0	0	0	14.80789	0	13.34463	0	0	16.51164	0	11.79423	11.97025	14.73218	15.51821	13.07892	2.551047	13.04452	0	0	15.30021	14.16536	0	0	0	0	0	14.3172	0	0	0	14.11134	13.01203	0	14.94376	0	14.40952	13.48391	0	0	14.06814	16.55194	0
A0A669DLV5	A0A669DLV5_ORENI		signal transduction [GO:0007165]	Interleukin 1 receptor accessory protein-like 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; signal transduction [GO:0007165]		FVEELAGHIKETEMK	2.140000105	1775.499678	0	15.34619	0	0	15.85602	16.80202	14.55151	13.70277	0	0	0	0	0	15.40639	0	14.44986	15.06068	0	0	0	0	0	15.81549	0	0	0	0	0	0	0	17.45998	0	17.63749	0	0	0	13.19592	0	0	0	15.60363	0	15.00906	0	0	16.82379	0	15.74252	15.89276	0	15.68193	18.52761	0	18.88774
I3J319	I3J319_ORENI			"Interleukin 12 receptor, beta 2a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; cytokine receptor activity [GO:0004896]	cytokine receptor activity [GO:0004896]	GLSPPARVTTR	7.46999979	1155.561471	11.62457	0	0	13.50412	12.75451	0	0	10.58163	11.58137	15.25032	12.63313	12.66071	0	15.26883	13.38604	13.40253	0	11.93825	13.65837	12.65809	9.779764	14.17775	0	12.2202	0	9.944226	14.25778	0	14.53127	0	16.17035	19.67439	13.54366	14.87024	15.00748	0	13.75889	11.01398	13.48318	13.62607	14.79053	0	10.94313	0	13.25803	13.99545	14.50689	13.53173	13.33876	13.26702	0	0	14.96227	0
I3JZ38	I3JZ38_ORENI	LOC100693282	immune response [GO:0006955]; inflammatory response [GO:0006954]	Interleukin-1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]; extracellular space [GO:0005615]; lysosome [GO:0005764]	cytosol [GO:0005829]; extracellular space [GO:0005615]; lysosome [GO:0005764]; cytokine activity [GO:0005125]; interleukin-1 receptor binding [GO:0005149]; immune response [GO:0006955]; inflammatory response [GO:0006954]	cytokine activity [GO:0005125]; interleukin-1 receptor binding [GO:0005149]	ALTLCDNSQK	7.960000038	1150.247679	13.82238	14.39946	13.98566	10.77129	12.2594	13.94124	12.64874	14.6515	12.14103	12.24402	14.91255	0	0	18.56411	0	0	12.19607	13.71281	13.67677	13.51102	0	0	0	0	0	0	0	0	0	0	0	0	14.54792	0	0	16.84547	0	0	18.63502	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DDI8	A0A669DDI8_ORENI	irak4	innate immune response [GO:0045087]; signal transduction [GO:0007165]	Interleukin-1 receptor-associated kinase 4 (EC 2.7.11.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; innate immune response [GO:0045087]; signal transduction [GO:0007165]	ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	TRSTASTR	6.829999924	879.9976178	14.30969	16.37184	0	0	16.85897	17.31367	0	0	14.86664	0	15.37534	0	15.45344	14.33977	0	15.45905	14.01324	0	11.75327	16.49442	14.57262	14.48872	12.98212	14.05946	0	15.32587	0	14.34461	0	12.44838	13.68736	13.25761	16.2233	0	0	0	0	13.35258	13.97096	0	12.00249	14.17215	12.07534	0	0	13.67669	13.00164	0	13.22453	0	10.13124	14.68233	5.592209	12.64534
A0A669B3L1	A0A669B3L1_ORENI		visual perception [GO:0007601]	Interphotoreceptor matrix proteoglycan 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell projection [GO:0042995]; extracellular region [GO:0005576]; interphotoreceptor matrix [GO:0033165]	cell projection [GO:0042995]; extracellular region [GO:0005576]; interphotoreceptor matrix [GO:0033165]; heparin binding [GO:0008201]; visual perception [GO:0007601]	heparin binding [GO:0008201]	LEILNFR	17.94000053	905.679824	14.34633	0	0	15.81296	0	15.75279	15.09805	0	16.02616	0	16.31763	13.56779	15.54329	14.08742	15.04684	14.41265	13.86309	13.97724	14.15504	14.15694	0	11.17803	12.02109	0	12.86678	14.45745	14.67179	14.4927	0	0	14.43354	15.33733	14.54398	14.75258	0	12.97498	15.9621	14.65953	15.17572	0	13.85822	15.0494	0	14.12812	14.91243	14.13112	0	0	0	15.2239	15.90209	15.70372	12.75537	15.68077
A0A669E9K2	A0A669E9K2_ORENI			Interphotoreceptor retinoid-binding protein like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		serine-type peptidase activity [GO:0008236]	serine-type peptidase activity [GO:0008236]	GQRYGSSK	6.550000191	881.5798263	0	15.7357	0	0	0	13.50676	10.87442	0	12.50926	14.50142	16.31434	13.76124	0	14.05249	0	13.96003	0	14.45263	12.36187	13.62198	0	0	0	14.62354	15.29095	0	14.42708	13.55338	14.36918	15.81687	15.14549	16.68616	15.28881	15.76138	15.23227	14.317	13.60771	0	12.56306	16.69646	12.64534	0	0	14.02417	14.21087	12.77842	16.59703	12.58322	15.37309	13.53626	0	13.47732	0	13.75335
I3IVP3	I3IVP3_ORENI		endocytosis [GO:0006897]; intracellular signal transduction [GO:0035556]	Intersectin 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell projection [GO:0042995]; synapse [GO:0045202]	cell projection [GO:0042995]; synapse [GO:0045202]; calcium ion binding [GO:0005509]; guanyl-nucleotide exchange factor activity [GO:0005085]; endocytosis [GO:0006897]; intracellular signal transduction [GO:0035556]	calcium ion binding [GO:0005509]; guanyl-nucleotide exchange factor activity [GO:0005085]	GCIGDQTGLFPSNYVRPVELPEVSQTSRPGGPTK	8.56000042	3643.157683	0	0	8.254369	0	10.06868	12.91249	0	8.686279	0	0	12.5367	14.52535	0	13.13521	11.48869	14.48897	0	13.78214	9.610577	0	0	0	0	0	0	17.92818	12.03845	0	0	0	15.81098	14.44158	0	0	0	0	0	12.37492	0	0	0	18.45273	11.38607	13.49028	0	12.83206	10.59448	11.74761	0	0	0	0	0	0
A0A669DA04	A0A669DA04_ORENI		endocytosis [GO:0006897]; intracellular signal transduction [GO:0035556]	Intersectin 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell projection [GO:0042995]; synapse [GO:0045202]	cell projection [GO:0042995]; synapse [GO:0045202]; calcium ion binding [GO:0005509]; guanyl-nucleotide exchange factor activity [GO:0005085]; endocytosis [GO:0006897]; intracellular signal transduction [GO:0035556]	calcium ion binding [GO:0005509]; guanyl-nucleotide exchange factor activity [GO:0005085]	VYLCSSFSTSFRVTSTAR	8.819999695	2068.452061	10.83249	12.7864	13.00004	0	14.77235	13.62568	12.03409	13.80079	12.79546	12.7061	13.03952	13.43609	11.72696	0	11.91841	11.68196	0	0	11.86491	17.41685	14.44562	0	9.839755	13.10592	13.31057	10.58651	9.869392	18.899	0	17.30652	13.54052	13.64212	12.55878	0	13.3936	0	0	12.44586	0	0	0	13.24248	14.25332	13.43013	0	0	11.92739	0	13.42386	0	0	14.90009	7.765864	0
A0A669AZB0	A0A669AZB0_ORENI		calcium ion transmembrane transport [GO:0070588]; response to heat [GO:0009408]	Ion_trans domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ion channel activity [GO:0005216]; calcium ion transmembrane transport [GO:0070588]; response to heat [GO:0009408]	ion channel activity [GO:0005216]	AFTILDMER	10.97999954	1112.690335	10.7247	0	0	0	0	13.75999	0	0	0	0	14.85915	15.82425	14.71354	12.74117	0	0	0	0	0	13.16772	0	0	0	0	15.92759	0	0	15.02225	0	17.65517	16.64813	0	0	16.573	0	0	14.09561	0	15.83072	0	0	0	0	0	0	0	0	0	0	15.66028	15.33316	0	19.0453	18.66456
I3J3T0	I3J3T0_ORENI		endocrine pancreas development [GO:0031018]; gastrulation [GO:0007369]	Iroquois homeobox 3a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; endocrine pancreas development [GO:0031018]; gastrulation [GO:0007369]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]"	GAEHFHNHR	12.80000019	1103.795713	11.16216	11.53063	0	12.33522	14.26815	11.54288	12.37818	13.63196	15.85033	15.27703	13.31647	9.529383	14.74674	11.83636	14.51339	0	0	13.48879	15.56961	10.20108	14.6941	13.95359	12.92646	14.92885	16.13051	13.18314	17.55658	17.60845	14.10934	13.63211	12.14656	18.45326	12.66034	8.908588	15.7825	14.21392	13.1673	0	13.66837	12.52145	14.24992	13.79004	0	0	14.6539	16.8065	11.49475	13.90254	0	15.63658	15.16586	0	15.50944	18.18688
A0A669CDB8	A0A669CDB8_ORENI	LOC100707874	glyoxylate cycle [GO:0006097]; isocitrate metabolic process [GO:0006102]; tricarboxylic acid cycle [GO:0006099]	Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		isocitrate dehydrogenase (NADP+) activity [GO:0004450]; magnesium ion binding [GO:0000287]; NAD binding [GO:0051287]; glyoxylate cycle [GO:0006097]; isocitrate metabolic process [GO:0006102]; tricarboxylic acid cycle [GO:0006099]	isocitrate dehydrogenase (NADP+) activity [GO:0004450]; magnesium ion binding [GO:0000287]; NAD binding [GO:0051287]	LIDDMVAQVLKSSGAFVWACK	9.68999958	2334.982334	0	0	12.80702	0	0	13.23211	0	12.38778	11.72203	17.4494	11.73948	13.10169	0	13.12359	12.81222	13.01894	9.268177	0	12.61944	0	11.71023	12.81399	0	13.05134	13.65289	8.685115	13.65994	0	0	10.09256	9.801865	0	13.03927	14.36218	17.9541	11.43824	11.47434	8.916718	13.01306	0	13.58665	13.22704	10.6669	13.32155	12.96255	12.66308	13.0358	12.76295	0	10.47065	14.41133	14.08363	12.09354	0
A0A669B081	A0A669B081_ORENI	LOC100692119	tricarboxylic acid cycle [GO:0006099]	"Isocitrate dehydrogenase [NAD] subunit, mitochondrial"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; isocitrate dehydrogenase (NAD+) activity [GO:0004449]; magnesium ion binding [GO:0000287]; NAD binding [GO:0051287]; tricarboxylic acid cycle [GO:0006099]	isocitrate dehydrogenase (NAD+) activity [GO:0004449]; magnesium ion binding [GO:0000287]; NAD binding [GO:0051287]	WMIPPDAK	6.800000191	973.2026938	14.92648	11.19979	16.27678	15.96399	13.70617	12.31548	17.93601	14.54499	15.27928	15.97314	17.45816	14.58641	15.84035	10.72405	8.166487	0	11.21152	0	0	16.50246	14.80228	0	0	0	0	14.66886	13.06071	15.79463	0	13.37379	9.016602	15.12264	0	13.83446	15.67561	14.39635	12.17322	13.00938	13.3684	9.11844	15.28512	14.08801	15.5678	15.58113	13.25266	14.95681	13.24028	13.2315	0	0	13.56514	14.48315	13.91881	14.31448
A0A669BEZ9	A0A669BEZ9_ORENI	iars2	isoleucyl-tRNA aminoacylation [GO:0006428]	Isoleucyl-tRNA synthetase (EC 6.1.1.5)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		aminoacyl-tRNA editing activity [GO:0002161]; ATP binding [GO:0005524]; isoleucine-tRNA ligase activity [GO:0004822]; tRNA binding [GO:0000049]; isoleucyl-tRNA aminoacylation [GO:0006428]	aminoacyl-tRNA editing activity [GO:0002161]; ATP binding [GO:0005524]; isoleucine-tRNA ligase activity [GO:0004822]; tRNA binding [GO:0000049]	VNLATKMPR	4.760000229	1042.00554	14.78097	12.70099	12.96357	14.23888	14.21405	15.0803	13.33943	11.48009	12.98617	14.2603	14.32098	15.63129	10.76319	12.92582	15.27926	8.981384	10.17437	0	9.509791	14.36227	13.96136	15.61546	11.55915	13.63595	14.72593	14.57581	14.95927	0	17.55302	14.18781	14.88705	0	16.69021	0	14.05725	0	14.25345	12.49583	14.09412	15.47322	0	12.62531	0	14.78822	13.81141	15.05245	12.89196	15.70298	12.89413	16.0186	14.82195	15.70288	14.80489	0
A0A669CU46	A0A669CU46_ORENI	idi1	dimethylallyl diphosphate biosynthetic process [GO:0050992]; isoprenoid biosynthetic process [GO:0008299]	Isopentenyl-diphosphate Delta-isomerase (EC 5.3.3.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		hydrolase activity [GO:0016787]; isopentenyl-diphosphate delta-isomerase activity [GO:0004452]; dimethylallyl diphosphate biosynthetic process [GO:0050992]; isoprenoid biosynthetic process [GO:0008299]	hydrolase activity [GO:0016787]; isopentenyl-diphosphate delta-isomerase activity [GO:0004452]	MARAVWAVLR	10.65999985	1172.792927	0	10.01706	16.09067	11.22919	10.1861	17.51414	0	9.770992	0	11.68202	17.24523	0	0	0	0	11.25076	10.84897	0	0	0	9.781999	15.81824	16.02033	0	13.98455	14.70602	0	0	0	14.53861	16.3611	13.62306	15.02261	15.98738	16.45459	13.94099	9.826229	8.227872	13.10547	14.70646	12.99938	11.28287	14.91189	12.9949	17.03967	0	12.27306	0	13.12445	14.60783	11.9212	11.29801	11.6117	9.755681
I3JGC0	I3JGC0_ORENI	DNAJC13		J domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ATVPLQSNVLEAAPDMKR	5.53000021	1956.659995	14.41783	0	0	16.48283	15.96342	0	16.26493	15.82114	15.2882	0	0	13.6579	0	0	16.49279	19.30386	0	0	0	0	17.34984	0	19.83268	0	0	0	18.15005	0	16.79495	15.45137	0	0	14.7342	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.90341	0	0
A0A669BW14	A0A669BW14_ORENI	LOC100711386		JAKMIP_CC3 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		kinase binding [GO:0019900]; microtubule binding [GO:0008017]	kinase binding [GO:0019900]; microtubule binding [GO:0008017]	MDCADMR	1.899999976	930.4116286	15.15596	14.72012	12.73234	0	0	14.52364	14.45305	15.281	14.12643	14.47434	16.77573	11.68594	12.99535	13.57157	0	12.58423	12.8411	12.1824	10.945	12.60107	0	14.65352	0	0	12.94126	0	0	13.68726	13.3746	15.16316	0	15.20296	15.03155	0	15.08891	9.457877	0	11.93378	0	0	11.00308	0	0	16.1881	0	11.11733	14.54254	14.25304	0	12.53257	0	0	0	0
A0A669C3P9	A0A669C3P9_ORENI	LOC100699848		JmjC domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; histone demethylase activity (H3-K27 specific) [GO:0071558]; metal ion binding [GO:0046872]	histone demethylase activity (H3-K27 specific) [GO:0071558]; metal ion binding [GO:0046872]	MKITAQCIAMGTEYR	7.389999866	1788.751457	0	10.8499	0	10.56729	15.21317	0	0	0	0	0	0	0	0	0	0	0	0	0	17.0069	0	0	0	0	0	0	0	14.90424	15.25914	0	0	13.2965	14.49698	0	0	0	15.86255	13.29384	0	14.96056	13.67476	0	0	15.6152	0	0	15.38071	15.05998	14.59086	18.91716	0	18.25034	10.8433	15.805	0
A0A669DT48	A0A669DT48_ORENI	JMY	'de novo' actin filament nucleation [GO:0070060]; Arp2/3 complex-mediated actin nucleation [GO:0034314]; regulation of transcription by RNA polymerase II [GO:0006357]	"Junction mediating and regulatory protein, p53 cofactor"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]; transcription coactivator activity [GO:0003713]; 'de novo' actin filament nucleation [GO:0070060]; Arp2/3 complex-mediated actin nucleation [GO:0034314]; regulation of transcription by RNA polymerase II [GO:0006357]	actin binding [GO:0003779]; transcription coactivator activity [GO:0003713]	KAHAAVLSIQDLTVK	6.150000095	1592.460825	12.20161	11.30829	0	0	0	0	0	0	11.75736	14.09026	13.26273	12.67346	0	0	0	12.37511	0	12.82513	12.53038	13.40227	0	15.29269	0	14.86341	10.86168	14.20438	0	11.49086	13.47969	0	15.7289	0	19.47383	0	0	13.04771	15.11722	16.11103	13.76532	0	14.18872	0	0	0	0	0	0	0	16.86039	0	0	0	0	0
A0A669B006	A0A669B006_ORENI			Junctional cadherin 5 associated a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell-cell junction [GO:0005911]; integral component of membrane [GO:0016021]	cell-cell junction [GO:0005911]; integral component of membrane [GO:0016021]		APIMGGGRR	1.049999952	915.4299673	11.81826	11.34031	12.33796	14.65604	15.34353	11.91589	0	12.22259	0	17.60177	16.23137	15.75397	16.09629	13.94849	14.72353	17.21371	16.05004	14.29645	14.22949	16.04868	0	17.69598	13.98642	0	0	15.96547	14.53334	0	15.76196	15.70229	0	0	0	0	15.76043	0	14.03966	0	13.5903	15.68769	0	16.14287	16.5305	0	0	16.52145	16.14837	0	17.44869	18.24736	18.17168	0	0	0
I3KA38	I3KA38_ORENI	jph1		Junctophilin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; junctional membrane complex [GO:0030314]; plasma membrane [GO:0005886]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; junctional membrane complex [GO:0030314]; plasma membrane [GO:0005886]		TSMASLRSEQSNGAVLQDLSSPADTPTGSR	7.369999886	3078.49061	0	12.93042	11.588	15.63385	0	15.31731	13.00838	0	0	0	0	0	15.09829	0	12.22994	0	0	0	13.21348	13.50929	0	0	13.89025	14.76469	10.24957	10.46366	12.49141	0	0	0	0	0	14.59206	11.07712	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669EWT0	A0A669EWT0_ORENI	KCNAB3	regulation of ion transmembrane transport [GO:0034765]	K(+) channel subunit beta-1 (Kv-beta-1) (Voltage-gated potassium channel subunit beta-1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; D-threo-aldose 1-dehydrogenase activity [GO:0047834]; voltage-gated potassium channel activity [GO:0005249]; regulation of ion transmembrane transport [GO:0034765]	D-threo-aldose 1-dehydrogenase activity [GO:0047834]; voltage-gated potassium channel activity [GO:0005249]	NLGKSGLR	14.56999969	844.597923	15.74266	0	0	19.6633	10.16663	15.75883	0	20.46528	19.89468	19.43966	15.0016	12.92525	15.08414	0	16.69238	16.37894	13.663	15.47208	13.96348	14.56373	14.75645	15.87185	0	18.5667	14.59049	0	0	0	0	0	20.55254	21.49955	22.80548	16.04245	16.70323	9.905101	13.03046	0	11.8442	0	12.1077	14.1391	0	0	0	18.85962	0	0	15.54461	0	0	0	0	0
I3JDY7	I3JDY7_ORENI			KASH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; meiotic nuclear membrane microtubule tethering complex [GO:0034993]	integral component of membrane [GO:0016021]; meiotic nuclear membrane microtubule tethering complex [GO:0034993]; actin filament binding [GO:0051015]	actin filament binding [GO:0051015]	TDRASQLK	2.24000001	917.516668	11.13719	15.03964	14.67044	15.99717	13.85208	6.888889	17.03149	12.87169	11.97241	14.06356	10.19068	16.30235	14.34389	15.40914	15.47505	15.49087	13.54203	12.74846	15.50548	2.741362	14.63856	15.53157	0	11.098	13.5782	14.83885	8.59304	13.65582	15.45477	14.35123	12.1345	13.91835	0	14.36222	7.803689	13.77331	0	14.91848	14.76696	12.98024	12.89684	14.03141	14.00575	13.62174	13.11886	0	0	14.34402	14.8247	15.23901	14.83364	16.79812	15.958	14.2791
I3KP01	I3KP01_ORENI			KAT8 regulatory NSL complex subunit 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	histone acetyltransferase complex [GO:0000123]	histone acetyltransferase complex [GO:0000123]		LLGSNRK	3.190000057	788.4267246	11.83575	0	11.56686	14.63263	12.53439	15.2345	10.22135	11.84271	0	16.89486	15.73231	16.03761	0	0	13.73263	0	0	0	0	13.85363	0	12.73188	0	10.93625	13.65778	14.67102	0	0	15.23859	14.69547	15.62989	21.58682	0	0	0	0	14.5517	0	14.3321	0	0	13.61866	0	0	0	0	0	0	0	0	0	0	0	0
I3JL99	I3JL99_ORENI	KHDRBS3		"KH RNA binding domain containing, signal transduction associated 3"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; RNA binding [GO:0003723]	RNA binding [GO:0003723]	GAPPSR	4.619999886	584.0945599	14.54811	15.14952	13.86905	14.29174	14.4341	13.16239	14.26666	14.69636	15.87118	14.88252	13.2955	15.16154	14.19205	14.34633	11.65562	14.22418	12.41414	13.61542	13.85813	0	15.71459	15.19988	12.56187	15.24039	14.87549	14.62208	13.0904	15.31594	14.52761	13.33848	16.4884	0	17.06006	0	0	0	13.51452	14.05947	0	15.12072	14.96625	14.64349	15.14519	0	15.86887	15.78712	15.39241	14.81873	16.04896	15.68633	15.73857	15.76316	15.34339	12.93024
I3JLG7	I3JLG7_ORENI			"KH domain containing, RNA binding, signal transduction associated 1b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; RNA binding [GO:0003723]	RNA binding [GO:0003723]	ARLPAGGPPQR	4.909999847	1119.252979	0	0	0	0	0	12.33073	0	13.20375	13.71663	13.01128	15.50678	0	0	15.11867	0	12.9557	14.75286	13.13738	13.63734	12.07915	13.93888	14.84059	12.28546	0	0	13.44757	13.75171	0	13.17076	0	0	0	16.09325	16.0612	14.08533	0	0	0	14.34369	0	13.00627	18.69388	15.10421	0	0	13.48762	14.82617	15.21366	15.36837	12.00776	0	0	0	0
I3K2P3	I3K2P3_ORENI	LOC100710770		KH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; RNA binding [GO:0003723]	RNA binding [GO:0003723]	GAMRGGAPR	4.260000229	868.3303042	0	12.48509	10.16432	8.962142	14.18272	11.27072	0	9.757063	0	0	0	9.424124	13.18995	8.044549	0	0	14.009	0	0	0	14.52096	0	0	12.96754	0	13.10973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.15938	14.51437	0	15.01902	14.93822	0	14.85644	10.04193	0	12.92064	13.06673	0
I3JDR9	I3JDR9_ORENI	KIAA1549L		KIAA1549 like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SDIEHYRNK	2.99000001	1160.050712	15.89717	12.83536	10.88831	0	0	0	0	13.19397	0	0	0	0	8.358394	0	14.98134	13.73534	13.50909	0	0	0	0	0	0	0	0	0	0	0	14.36141	0	15.55812	0	0	15.36894	0	0	0	0	0	14.826	0	0	15.62785	0	0	13.90565	0	15.06376	12.26084	0	11.098	16.33222	0	0
A0A669EG92	A0A669EG92_ORENI			KISS1 receptor b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; G protein-coupled receptor activity [GO:0004930]	G protein-coupled receptor activity [GO:0004930]	HAFPAILLWRSR	11.47000027	1466.933948	12.80373	13.36814	12.24985	0	10.56604	12.55585	13.31102	8.614615	14.0757	14.06081	9.48819	14.73567	14.70399	13.75323	9.24711	0	13.42116	14.03581	10.77979	12.1143	14.11274	14.27176	0	14.06964	14.67514	0	0	15.24257	0	0	17.87426	18.86593	17.92001	16.58277	0	15.09565	10.05895	13.65147	13.66069	14.25025	0	0	14.81226	12.93708	12.41459	14.02081	0	14.17089	0	0	0	0	0	0
I3K211	I3K211_ORENI	krr1	rRNA processing [GO:0006364]	KRR1 small subunit processome component (KRR-R motif-containing protein 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]; RNA binding [GO:0003723]; rRNA processing [GO:0006364]	RNA binding [GO:0003723]	IGTMVR	7.119999886	691.8962872	14.52084	0	0	0	0	13.6435	12.98432	15.1075	0	10.53189	16.97477	15.87029	0	0	0	13.4368	13.23734	13.51665	0	16.26241	0	12.74438	14.29486	12.52147	14.4258	16.7781	17.08951	13.86014	14.73998	17.58997	0	14.83988	0	0	0	0	0	0	15.19613	0	0	0	0	16.14008	13.09651	0	13.16063	13.50465	0	13.20243	0	13.98135	0	15.93891
A0A669BVJ3	A0A669BVJ3_ORENI	LOC100693338 KATNAL2		Katanin p60 ATPase-containing subunit A-like 2 (Katanin p60 subunit A-like 2) (EC 5.6.1.1) (p60 katanin-like 2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule [GO:0005874]; spindle pole [GO:0000922]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; spindle pole [GO:0000922]; ATP binding [GO:0005524]; isomerase activity [GO:0016853]; microtubule binding [GO:0008017]; microtubule-severing ATPase activity [GO:0008568]	ATP binding [GO:0005524]; isomerase activity [GO:0016853]; microtubule binding [GO:0008017]; microtubule-severing ATPase activity [GO:0008568]	MSTDNNKK	6.460000038	937.9308105	0	14.72406	15.0396	13.88791	15.94705	13.34998	13.67518	16.01797	13.73515	0	14.7269	13.24033	14.21269	13.84115	13.32303	16.42408	13.53629	0	14.92303	14.59275	0	0	0	16.00642	0	0	14.70049	0	15.81044	0	12.66665	0	0	0	13.0985	0	0	14.90895	15.33712	15.98755	0	15.14499	0	14.35442	10.62137	13.61453	14.99641	15.07442	0	15.24309	15.54935	0	0	0
I3JZQ8	I3JZQ8_ORENI	KATNA1 katna1	cell cycle [GO:0007049]; cell division [GO:0051301]	Katanin p60 ATPase-containing subunit A1 (Katanin p60 subunit A1) (EC 5.6.1.1) (p60 katanin)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centrosome [GO:0005813]; cytoplasm [GO:0005737]; microtubule [GO:0005874]; spindle pole [GO:0000922]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; microtubule [GO:0005874]; spindle pole [GO:0000922]; ATP binding [GO:0005524]; isomerase activity [GO:0016853]; microtubule binding [GO:0008017]; microtubule-severing ATPase activity [GO:0008568]; cell cycle [GO:0007049]; cell division [GO:0051301]	ATP binding [GO:0005524]; isomerase activity [GO:0016853]; microtubule binding [GO:0008017]; microtubule-severing ATPase activity [GO:0008568]	EISENLKLAR	6.989999771	1172.873562	14.48937	0	13.92556	16.95091	16.15469	13.22738	13.26102	8.945325	12.9069	17.60588	13.55753	14.28753	0	13.34904	7.066136	11.73185	15.33744	12.26336	15.82729	0	13.32302	13.31858	14.46026	12.18407	9.350687	10.49022	18.0137	13.08274	10.60649	11.55071	0	13.73986	0	0	13.94399	0	12.39755	13.72205	10.69226	13.0264	16.52212	12.98162	13.38925	9.888612	0	13.88772	14.74491	0	13.27924	13.89201	12.44651	13.82607	13.92579	0
A0A669BTJ5	A0A669BTJ5_ORENI	LOC100702545		Katanin_con80 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; integral component of membrane [GO:0016021]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; integral component of membrane [GO:0016021]; microtubule binding [GO:0008017]	microtubule binding [GO:0008017]	SVPGPAGDMAK	16.36000061	1045.169623	15.64387	15.53246	0	15.03024	0	16.92359	16.92461	0	0	12.14458	0	0	0	0	0	17.14897	0	0	0	0	0	17.22163	0	0	17.16624	0	0	0	0	0	22.47446	24.18324	19.5735	0	17.13465	0	16.93704	0	0	0	0	16.37116	0	0	16.60409	0	17.15193	0	0	0	0	0	0	0
A0A669EYQ7	A0A669EYQ7_ORENI	LOC100690426		Kazal-like domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]		TKSLLLGDACIDPLDTK	6.519999981	1860.773219	0	0	16.6162	0	16.04536	15.25991	0	0	0	0	0	0	16.25415	16.01248	0	15.95642	0	15.72297	13.021	16.16226	14.98344	14.03949	9.20108	0	13.32369	9.887531	12.69918	13.85927	13.33537	0	0	0	0	13.87234	0	0	13.92437	13.97174	14.76096	13.63389	0	11.62533	14.0334	13.48944	15.56834	0	13.91478	13.86492	14.08893	11.26509	16.89281	12.63234	0	0
A0A669EDW0	A0A669EDW0_ORENI		regulation of cell growth [GO:0001558]	Kazal-type serine peptidase inhibitor domain 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; insulin-like growth factor binding [GO:0005520]; regulation of cell growth [GO:0001558]	insulin-like growth factor binding [GO:0005520]	MSSSDEA	5.699999809	743.6474678	11.58533	14.94255	11.13592	14.64661	13.3373	0	14.82695	0	16.4395	15.15512	15.78821	0	0	10.33704	12.99559	0	0	15.91155	15.19922	14.19627	14.88216	14.4016	0	14.22134	15.10545	0	16.08499	0	0	0	16.3927	17.80284	16.35089	15.74036	14.94288	14.05565	13.47053	15.67141	13.04116	11.13166	13.1807	10.83908	15.33652	0	0	0	0	14.64561	13.88365	16.31108	0	14.70111	13.07757	13.70182
A0A669B0T0	A0A669B0T0_ORENI			Kelch domain containing 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GTIHSDMFLLK	4.730000019	1260.614187	13.9637	11.24821	12.94347	10.00823	8.414495	12.28794	0	0	0	0	0	0	18.46707	0	12.66828	10.99476	11.64028	11.41506	0	13.81408	0	4.104763	11.55799	0	0	0	0	0	15.84071	12.2271	0	0	12.21468	12.41815	12.12433	12.18563	9.904473	12.82994	8.668647	11.64372	11.4203	0	13.63272	9.914027	14.05216	13.02765	10.91428	7.886546	11.87413	0	13.62909	0	16.85168	0
A0A669D8P9	A0A669D8P9_ORENI	KLHL28		Kelch like family member 28	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SCKMANTCR	3.25	1142.824826	13.27568	0	12.56021	11.34833	11.51412	13.3371	14.29447	13.45927	0	0	14.39025	13.543	16.56852	0	0	14.53337	14.15961	0	0	12.77491	16.43683	17.88444	0	15.02902	19.04523	11.24941	18.9586	14.85177	14.99493	0	15.475	0	0	0	0	0	0	0	10.97973	0	13.71216	0	0	0	14.38202	12.98101	0	0	17.53464	0	15.13162	14.80755	11.43062	12.19375
I3KX02	I3KX02_ORENI	kbtbd8	regulation of translation [GO:0006417]	Kelch repeat and BTB domain-containing protein 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi apparatus [GO:0005794]; spindle [GO:0005819]	Golgi apparatus [GO:0005794]; spindle [GO:0005819]; regulation of translation [GO:0006417]		SQGLAALYK	21.23999977	949.7695783	11.95898	13.5698	15.00335	0	15.21363	14.03816	15.14243	14.34753	14.03092	16.33316	0	0	17.09455	15.22372	16.16841	17.28687	15.34653	15.72203	17.70498	16.42586	15.44145	15.09436	0	15.74017	16.37535	0	14.96487	16.68067	14.91051	14.44751	16.0086	16.23568	15.98795	13.33368	9.879329	14.60588	14.27697	14.27949	13.17587	15.19759	0	16.11396	0	13.08203	14.41576	16.16262	15.45323	13.68081	16.11784	16.29268	16.02348	0	17.94148	16.72519
A0A669EX92	A0A669EX92_ORENI		protein ubiquitination [GO:0016567]	Kelch-like family member 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Cul3-RING ubiquitin ligase complex [GO:0031463]	Cul3-RING ubiquitin ligase complex [GO:0031463]; protein ubiquitination [GO:0016567]		ASMNTKR	5.849999905	823.928276	14.0947	13.83453	13.70711	14.00075	0	11.7092	8.463914	14.65046	15.66447	12.67961	14.89686	13.72536	12.6773	16.59805	13.59321	13.33532	15.80491	0	15.46185	0	15.11456	14.9523	0	0	13.24789	13.66053	13.92299	15.52402	17.08063	0	15.49571	0	0	0	0	12.34228	0	0	15.42659	14.84374	15.93204	16.71435	15.55372	15.76909	13.05406	11.90504	13.69925	14.58795	14.98404	0	0	0	0	0
I3JX77	I3JX77_ORENI	klhl36	protein ubiquitination [GO:0016567]	Kelch-like protein 36	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein ubiquitination [GO:0016567]		KDDHQNLSWSTLDT	5.949999809	1660.157986	15.01975	0	0	0	16.86521	0	0	14.20327	14.35295	0	15.5566	15.82711	14.53954	0	15.67227	0	0	0	16.8841	0	0	0	0	0	0	0	0	0	0	14.47061	0	0	17.42422	0	0	0	0	14.94119	0	18.1664	0	16.38339	0	0	0	0	16.00996	0	0	0	0	0	0	0
I3KRD3	I3KRD3_ORENI			Keratin 15	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	intermediate filament [GO:0005882]	intermediate filament [GO:0005882]; structural molecule activity [GO:0005198]	structural molecule activity [GO:0005198]	KVVVVSSSTHTTST	2.359999895	1431.400624	15.3541	15.25257	12.41886	13.20318	13.36614	13.73036	8.896983	0	15.21804	0	0	14.25359	9.300493	0	0	0	0	14.47091	0	0	0	15.66006	13.67164	0	14.69614	0	0	13.40577	13.20772	11.49516	17.61929	20.39301	20.88259	13.62724	15.33315	8.948515	0	12.39686	9.946953	12.75815	0	9.6893	15.90297	0	14.17368	16.53909	18.25049	17.34081	13.35054	15.1996	13.15874	0	14.66945	16.07595
I3KRD8	I3KRD8_ORENI			Keratin 98	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	intermediate filament [GO:0005882]	intermediate filament [GO:0005882]; structural molecule activity [GO:0005198]	structural molecule activity [GO:0005198]	SKPPPPMPR	11.46000004	1021.573379	0	17.47753	21.4401	0	21.74296	21.86523	0	19.86092	14.09948	8.564193	12.49327	0	0	0	0	0	0	0	19.19092	0	0	0	0	12.67991	0	0	0	0	0	0	0	0	13.97502	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DYK1	A0A669DYK1_ORENI			Kinase D-interacting substrate 220a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		HEVELMSK	11.56999969	989.3300059	12.6494	0	13.7284	11.4936	11.10393	6.510646	0	11.4515	14.06486	14.15268	13.05214	16.47176	12.25422	10.6286	12.42816	0	14.80127	12.70601	8.547826	7.14198	0	0	14.84379	13.4911	13.14544	14.19345	9.808677	14.45036	10.73053	18.77307	12.38729	14.42602	13.07009	11.27787	12.8544	14.46513	13.82341	0	13.99473	14.21704	14.46264	0	0	0	0	12.80194	12.65459	0	12.48598	0	10.90057	0	14.26759	13.40548
A0A669EF12	A0A669EF12_ORENI	LOC100704507	inositol phosphate biosynthetic process [GO:0032958]	Kinase (EC 2.7.-.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		kinase activity [GO:0016301]; inositol phosphate biosynthetic process [GO:0032958]	kinase activity [GO:0016301]	QAEVLYYRLEHSHSNAVPQLK	1.230000019	2481.678002	14.64286	12.99277	15.15162	0	15.11048	13.62664	13.18303	12.45887	15.25407	15.77995	14.69756	15.6914	15.04038	13.92207	13.62618	15.24729	14.82685	15.0892	0	15.51706	0	0	0	0	13.53005	0	0	15.8662	14.01972	11.20189	12.54885	0	14.57197	15.4146	0	0	14.53202	0	14.78086	14.44238	15.12534	0	17.27815	0	12.79264	0	15.36567	0	16.52277	12.72954	14.94653	0	16.2459	0
A0A669BT78	A0A669BT78_ORENI		microtubule-based movement [GO:0007018]	Kinesin family member 13A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	VYFRCPPGHGVFVNCR	8.050000191	1965.373407	11.8148	13.16516	0	12.53134	0	0	17.19774	14.85861	15.56045	13.55422	14.92066	13.20076	13.6463	13.18654	14.29525	0	12.00543	13.96601	13.92067	12.67349	0	0	14.08673	0	10.19642	0	12.2707	13.49283	13.73867	0	14.98209	0	0	0	14.24926	12.00507	12.54476	13.60864	13.59566	14.79379	13.31906	0	13.8317	14.25295	0	0	0	13.26734	13.93113	0	13.77918	0	0	0
A0A669CPC4	A0A669CPC4_ORENI		microtubule-based movement [GO:0007018]	Kinesin family member 13Ba	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	SGLAASYLSVKALVPQMPK	7.809999943	1975.534316	11.20118	14.73707	14.13196	0	15.46098	0	8.625067	13.26482	15.52945	14.72123	0	14.60374	0	15.60703	0	17.45551	17.1418	0	17.13272	0	14.9977	0	12.36796	0	0	0	0	0	0	0	0	0	14.57201	12.64613	13.35316	15.46355	14.50325	15.13255	15.13088	15.12592	16.09222	12.49399	14.3677	0	0	15.70657	16.35946	16.60719	13.12364	15.63888	0	0	0	16.59393
A0A669CJG2	A0A669CJG2_ORENI		microtubule-based movement [GO:0007018]	Kinesin family member 1Ab	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	QAVNQR	9.640000343	715.5364704	13.09124	14.53108	13.12897	13.86597	14.4946	0	15.40067	15.00785	13.60691	14.25448	14.88537	14.89051	0	0	0	14.96972	0	12.31915	15.1665	15.10865	14.82133	14.95761	14.32848	16.59061	14.56377	13.82676	13.10663	13.44447	16.28235	14.65326	15.36284	0	16.8798	15.5512	14.26258	16.45297	14.51383	14.22296	13.86345	9.851198	14.1038	14.25521	12.99742	14.48128	0	12.77453	0	12.18788	0	0	0	0	16.53067	15.00844
A0A669ET43	A0A669ET43_ORENI		microtubule-based movement [GO:0007018]	Kinesin family member 1B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	DLLNPK	24.80999947	699.0631729	0	0	0	0	17.89967	18.98659	0	19.26172	0	17.21712	0	0	0	17.45358	0	0	16.35761	0	0	0	0	0	0	0	0	18.6895	0	0	0	0	16.69689	0	0	0	0	0	0	0	14.60674	0	0	0	16.46875	0	0	0	0	0	0	0	15.49217	0	0	0
A0A669BZQ7	A0A669BZQ7_ORENI		microtubule-based movement [GO:0007018]; regulation of mitotic nuclear division [GO:0007088]	Kinesin family member 20Ba	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]; regulation of mitotic nuclear division [GO:0007088]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	QLQSDLAGR	10.39999962	987.1696386	13.06575	13.12157	13.48943	17.3093	13.83628	13.38594	13.25774	14.54865	0	14.84545	11.27423	10.75749	13.34184	12.36687	14.78629	12.84876	14.32963	13.58563	14.74427	13.7217	0	0	13.92984	15.32877	12.53102	0	0	13.06214	13.92378	14.98999	14.58633	0	15.15341	11.8377	12.34263	10.11517	11.29405	12.98202	13.76954	14.0025	14.13761	12.30236	16.9936	8.678246	14.26771	13.06277	13.21942	12.74267	13.06409	15.43107	0	14.5785	13.68903	14.07975
A0A669C794	A0A669C794_ORENI	KIF21A	microtubule-based movement [GO:0007018]	Kinesin family member 21A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]	cytoskeleton [GO:0005856]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	THIHK	5.239999771	635.3696508	13.37372	14.22476	14.97571	14.65049	0	15.22214	0	15.22122	14.1983	14.67509	16.9354	12.54308	14.53638	14.22876	14.82239	13.12898	15.7675	13.47408	13.77977	14.64528	8.636462	14.31823	14.73857	0	12.00715	0	14.48862	16.04815	15.16871	15.29189	17.90262	17.28697	17.07117	0	0	14.46256	13.86115	14.47672	14.52392	13.73711	15.00804	0	16.10798	13.37065	11.64214	14.23322	14.493	15.15146	15.40934	15.70515	14.78183	0	15.14117	14.54475
I3K708	I3K708_ORENI		microtubule-based movement [GO:0007018]	Kinesin family member 25	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	AGMLVQNK	5.710000038	875.4819861	16.31175	0	16.01441	0	16.69287	0	16.50595	15.89151	16.90827	16.85451	16.82299	17.4405	17.93441	17.05661	0	16.49977	17.02182	17.16659	16.34535	17.96011	16.04762	0	17.05396	0	15.40764	17.02902	16.0108	17.91242	0	18.30124	18.31108	17.68187	17.85331	17.36528	16.18469	17.38658	16.18944	15.8195	17.89303	14.76388	0	0	17.25446	17.44249	0	17.38353	17.37537	0	0	17.92712	0	0	0	18.34067
I3KRG7	I3KRG7_ORENI		microtubule-based movement [GO:0007018]	Kinesin family member 26Aa	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	DCSTQSLGVAPTAISWLFRVIEER	2.930000067	2734.907513	13.94706	13.83432	13.45886	14.83501	14.83487	13.14569	15.41407	13.66045	14.11824	13.05579	14.75552	14.5746	13.07357	15.74576	5.244819	15.44397	14.0083	0	9.913673	0	12.31037	12.37724	15.31849	0	0	13.51124	0	14.61149	18.64421	15.08443	0	13.13613	0	0	0	0	0	15.20429	0	15.5726	17.36758	13.8394	0	0	12.13977	15.31608	0	0	0	0	15.90838	16.19346	12.17812	16.62016
A0A669BIW2	A0A669BIW2_ORENI	LOC100698656		Kinesin light chain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; kinesin complex [GO:0005871]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; kinesin complex [GO:0005871]; microtubule [GO:0005874]		GGSYFR	3.160000086	684.8435211	15.55492	0	0	14.3868	15.75464	0	0	14.57949	0	0	0	0	0	14.44691	17.09028	16.62847	0	6.567392	12.933	0	14.52769	0	0	0	16.80901	0	14.44248	0	0	15.17958	19.61205	0	19.99214	0	14.81365	15.74543	0	14.83213	16.08534	0	15.48529	14.90783	14.60291	16.57525	0	16.16487	0	19.60678	15.10416	0	0	0	16.58267	16.8067
A0A669BYS0	A0A669BYS0_ORENI	KIF1C	microtubule-based movement [GO:0007018]	Kinesin motor domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	LKFPFK	5.5	779.5457852	14.18138	15.32534	14.92789	15.49499	15.38381	15.5603	12.80385	16.46101	14.76707	17.48112	0	15.38294	16.89465	12.94825	16.21064	19.1801	19.57136	18.63706	16.6524	17.96383	16.13694	18.95988	19.65871	19.43768	15.97011	17.11795	15.99387	21.03751	21.01834	20.64417	18.37185	0	0	16.59702	14.7976	15.12132	17.68158	17.3922	17.3645	19.26643	18.86929	18.52157	17.06704	17.63188	16.7962	16.9007	18.04758	16.86895	16.93384	17.65142	17.12688	18.25546	17.84144	17.49812
I3JLX8	I3JLX8_ORENI			Kinesin-associated protein 3a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	kinesin complex [GO:0005871]	kinesin complex [GO:0005871]; kinesin binding [GO:0019894]	kinesin binding [GO:0019894]	NLSQHDGPTK	8.06000042	1095.761907	15.58434	14.83622	16.46956	15.2221	17.11261	16.06097	18.6941	15.79411	0	16.16327	15.67123	16.64061	0	0	0	0	0	0	13.75354	17.31327	0	14.43387	17.78845	12.85055	0	17.5156	17.91098	0	0	0	17.22258	0	15.45549	0	16.95528	0	17.01739	12.53573	16.56862	0	15.60876	0	15.49534	16.08884	0	0	14.42813	0	0	16.6577	0	0	0	0
A0A669ECQ7	A0A669ECQ7_ORENI	KIF5A	microtubule-based movement [GO:0007018]	Kinesin-like protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	microtubule [GO:0005874]	microtubule [GO:0005874]; ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]; microtubule-based movement [GO:0007018]	ATP binding [GO:0005524]; ATP-dependent microtubule motor activity [GO:1990939]; microtubule binding [GO:0008017]	APFRRPHAALIGNNMSVNPLK	10.39999962	2302.373211	12.33814	12.77055	12.64087	10.61208	0	0	11.91244	10.42455	13.95157	9.905235	12.41755	0	13.02805	0	14.81619	0	0	14.12609	0	0	11.5828	0	15.66497	0	17.71397	0	12.22316	12.58346	13.42222	0	0	14.08068	12.57784	14.47454	12.08539	13.34443	17.23776	0	13.11779	12.81953	0	4.072258	13.52626	13.02663	13.31791	11.5458	14.31747	13.19092	0	17.96052	14.87074	0	12.33772	14.96692
I3KCH7	I3KCH7_ORENI		attachment of mitotic spindle microtubules to kinetochore [GO:0051315]; cell division [GO:0051301]	Kinetochore protein Hec1 (Kinetochore protein NDC80 homolog)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	condensed chromosome kinetochore [GO:0000777]; Ndc80 complex [GO:0031262]; nucleus [GO:0005634]	condensed chromosome kinetochore [GO:0000777]; Ndc80 complex [GO:0031262]; nucleus [GO:0005634]; attachment of mitotic spindle microtubules to kinetochore [GO:0051315]; cell division [GO:0051301]		NSIMSGFGGTEKIK	4.820000172	1485.64347	13.31122	0	0	10.36731	15.04488	14.14446	12.29911	15.84799	7.504893	0	13.5721	11.79352	12.20118	14.75692	14.61893	0	0	14.59024	13.34454	0	0	14.88588	13.63555	15.18111	13.02577	12.91002	12.80663	0	0	14.02788	21.82586	22.10186	21.88936	0	0	0	13.50841	13.4611	13.91644	13.14549	14.12704	14.23184	12.23948	15.32688	0	13.44378	13.48061	13.59868	15.74498	0	15.07879	13.1431	13.55463	0
G3LVK4	G3LVK4_ORENI	kiss2		Kisspeptin-2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ELEVPT	10.06000042	688.0598142	15.06667	18.21696	16.62576	16.24871	0	15.36237	16.45453	15.7164	15.7899	15.56855	16.11579	0	0	0	12.74186	0	14.49883	0	0	15.44011	0	0	0	15.7359	0	0	0	0	0	0	0	0	17.6138	0	0	0	0	0	0	0	0	16.33161	0	0	16.78831	0	0	0	0	0	0	0	17.41057	0
I3JE18	I3JE18_ORENI	knl1	attachment of spindle microtubules to kinetochore [GO:0008608]; cell division [GO:0051301]; protein localization to kinetochore [GO:0034501]	Knl1_RWD_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		attachment of spindle microtubules to kinetochore [GO:0008608]; cell division [GO:0051301]; protein localization to kinetochore [GO:0034501]		ESVLPGRFLSDTEASPMDVLK	4.28000021	2292.231315	12.91057	12.69913	13.9392	12.61821	0	14.44522	0	0	0	0	13.18437	11.76092	0	0	14.92499	13.71045	0	0	0	0	12.76415	0	12.5355	0	0	0	14.35088	0	0	12.46934	10.01664	15.00203	0	13.31626	0	0	0	0	0	9.64101	0	10.80813	15.39541	15.50527	13.18767	0	11.40167	13.47143	0	0	0	0	13.98261	0
I3JWK6	I3JWK6_ORENI	LOC100693557	Wnt signaling pathway [GO:0016055]	Kringle-containing protein marking the eye and the nose	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; Wnt signaling pathway [GO:0016055]		YGAGR	7.570000172	523.032695	15.80667	15.34925	15.61546	0	15.1719	0	15.75276	0	14.27702	0	14.87509	0	0	14.80782	0	16.16866	0	0	15.976	15.7048	15.01421	0	14.9074	0	14.46781	15.76746	0	0	0	0	18.27309	0	18.45154	15.86613	0	0	15.21263	16.00838	0	0	15.23189	15.5116	0	15.54202	15.83102	0	0	0	0	0	14.51822	13.24	14.17158	15.87432
I3KBY4	I3KBY4_ORENI	kxd1		KxDL motif-containing protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	lysosomal membrane [GO:0005765]	lysosomal membrane [GO:0005765]		DLDSIFRR	5.730000019	1021.307447	0	15.01095	14.27857	16.35367	12.27669	14.33372	14.25784	14.9265	14.50466	15.08285	11.13434	14.35672	14.76202	17.00203	0	15.73465	0	0	14.16881	16.26058	13.72397	15.05179	14.14866	0	17.18064	0	17.14318	0	0	0	0	0	0	0	0	0	15.80935	0	0	0	0	0	0	16.81321	0	0	0	0	0	0	0	17.83902	0	0
I3JZC2	I3JZC2_ORENI		biosynthetic process [GO:0009058]; cellular modified amino acid metabolic process [GO:0006575]	Kynurenine aminotransferase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cysteine-S-conjugate beta-lyase activity [GO:0047804]; kynurenine-oxoglutarate transaminase activity [GO:0016212]; L-glutamine aminotransferase activity [GO:0070548]; pyridoxal phosphate binding [GO:0030170]; biosynthetic process [GO:0009058]; cellular modified amino acid metabolic process [GO:0006575]	cysteine-S-conjugate beta-lyase activity [GO:0047804]; kynurenine-oxoglutarate transaminase activity [GO:0016212]; L-glutamine aminotransferase activity [GO:0070548]; pyridoxal phosphate binding [GO:0030170]	TFSATGWKVGWAIGSGNIIK	7.210000038	2092.078559	14.1044	14.68016	0	8.498589	12.92145	0	8.244511	11.43719	0	12.57726	0	13.24541	0	11.69878	0	0	11.87572	10.02281	0	13.21469	9.174368	0	12.94109	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669EU83	A0A669EU83_ORENI	enosf1	carbohydrate catabolic process [GO:0016052]; cellular amino acid catabolic process [GO:0009063]	L-fuconate dehydratase (EC 4.2.1.68)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		L-fuconate dehydratase activity [GO:0050023]; metal ion binding [GO:0046872]; carbohydrate catabolic process [GO:0016052]; cellular amino acid catabolic process [GO:0009063]	L-fuconate dehydratase activity [GO:0050023]; metal ion binding [GO:0046872]	QREDQMLK	4.199999809	1045.986289	11.59257	14.15205	14.88128	12.3796	13.55918	14.4577	0	0	0	14.73893	16.84866	15.15318	14.07466	0	13.32329	10.77806	12.96176	14.5572	0	0	20.29283	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.00939	0	0	0	13.86866	0	0	14.7383	0	0	0	0	0	0	0	0	0
I3JXN9	I3JXN9_ORENI	SLC43A2		L-type amino acid transporter 4 (Large neutral amino acids transporter small subunit 4) (Solute carrier family 43 member 2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; L-amino acid transmembrane transporter activity [GO:0015179]	L-amino acid transmembrane transporter activity [GO:0015179]	MAPTLATAFSRR	4.389999866	1339.141011	14.17678	0	12.27655	10.0712	0	0	0	0	15.44583	14.06315	14.82975	0	12.83221	10.31341	0	0	0	14.97924	0	15.95646	0	0	0	0	0	0	0	15.27813	14.8499	0	0	0	0	15.68541	15.73728	15.21848	0	0	0	14.2528	0	0	15.78798	0	15.55388	14.51143	16.09693	0	15.15532	14.39683	0	16.22147	16.68856	0
I3JRW2	I3JRW2_ORENI			LAM_G_DOMAIN domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QIEEVIHGK	11.02000046	1051.97783	10.07892	14.82349	14.98355	0	15.77323	0	0	13.58635	0	0	0	13.16674	0	13.73607	0	15.2669	0	19.31219	15.20869	14.81565	14.63179	0	0	0	0	16.27122	0	0	0	14.82602	0	0	0	0	0	0	0	0	16.13951	0	0	0	0	16.83761	0	0	0	16.04703	0	0	14.35454	0	0	0
A0A669DV01	A0A669DV01_ORENI		rRNA processing [GO:0006364]	LAS1 like ribosome biogenesis factor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Las1 complex [GO:0090730]	Las1 complex [GO:0090730]; endonuclease activity [GO:0004519]; rRNA processing [GO:0006364]	endonuclease activity [GO:0004519]	SLWQAPLADMSWLLGEIK	2.640000105	2074.909682	0	0	14.68121	11.04288	0	10.61072	11.76153	14.23654	12.73881	9.567146	14.95875	9.74576	0	0	0	0	0	15.2386	13.43217	0	8.244858	16.71923	0	0	0	13.43845	0	0	18.92118	13.51473	14.74557	0	14.59151	11.50813	11.34863	0	0	13.2012	0	0	0	12.60573	11.90494	14.48515	16.10334	13.65908	11.99193	12.79824	12.57946	0	0	15.09036	15.52717	6.549157
A0A669EUB4	A0A669EUB4_ORENI	LOC100706951	regulation of transcription by RNA polymerase II [GO:0006357]	LID domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; LIM domain binding [GO:0030274]; transcription coregulator activity [GO:0003712]; regulation of transcription by RNA polymerase II [GO:0006357]	LIM domain binding [GO:0030274]; transcription coregulator activity [GO:0003712]	TYSLSPR	7.329999924	821.5170305	13.77326	15.55709	17.28324	15.72336	0	13.1448	16.45186	14.34456	0	13.48168	16.06484	15.36685	17.54535	16.81258	0	0	0	13.13583	12.51909	0	12.58054	0	0	0	0	0	0	0	0	0	14.72412	0	15.91833	0	0	13.93778	0	0	14.02621	0	14.12754	13.32208	15.87051	0	0	14.0186	13.19123	0	11.40403	14.535	13.11466	0	0	0
A0A669D2U0	A0A669D2U0_ORENI	LIMCH1		LIM and calponin homology domains 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	EFEGLLSQMR	12.07999992	1226.000802	11.6944	11.48236	12.4243	0	12.75295	0	17.52272	13.53764	9.99618	10.20398	13.72978	16.55871	0	11.00764	9.732389	0	13.72123	0	14.60506	0	13.45836	9.741626	14.74872	10.63066	0	8.691566	12.07583	17.93131	17.85759	11.5535	15.23945	0	13.90229	16.81612	12.26929	13.3931	13.5676	10.95496	13.34396	11.18287	12.17671	13.76147	11.05756	11.88472	0	0	13.41286	11.9898	0	0	0	0	0	17.06609
A0A669B3P0	A0A669B3P0_ORENI			LIM zinc-binding domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	ASGDK	5.570000172	476.2024451	15.11159	15.17193	0	0	15.76778	0	0	16.76086	12.573	13.37241	14.54757	16.11638	15.1064	0	0	11.59908	12.86004	13.49509	14.73186	15.5341	16.14223	15.92255	16.47982	0	0	0	0	0	0	15.42846	0	0	0	0	14.79277	14.76479	15.53202	15.56542	15.61915	0	0	15.7272	0	0	15.6743	15.36733	0	14.1867	0	0	0	0	0	14.24925
A0A669BXS0	A0A669BXS0_ORENI			"LPS-responsive vesicle trafficking, beach and anchor containing"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]		QHPDPDSTVK	2.940000057	1122.748172	15.0823	11.09186	0	12.44027	0	12.9589	0	12.83357	0	0	15.01761	13.17779	13.56532	0	14.38364	14.20671	0	15.52767	17.03182	13.45607	0	0	0	0	0	13.84122	15.11503	0	0	0	0	0	17.63221	15.36023	0	14.27175	0	15.98431	0	0	15.35533	0	14.27468	0	0	0	15.914	13.66087	18.12102	16.85814	16.4235	0	18.70117	0
I3KYN9	I3KYN9_ORENI	ELFN1		LRRCT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		DEEYMAAGHALR	10.17000008	1379.234921	14.20176	12.41334	12.48446	13.77179	14.53624	0	0	0	11.54104	12.94168	15.30514	12.47246	13.48793	0	0	11.60178	13.8913	0	0	12.07738	0	14.66906	0	15.15544	10.3236	0	14.94181	0	0	12.73411	17.27583	18.32777	0	12.68314	0	15.10941	12.25457	12.1015	12.64231	13.26875	0	0	0	12.48065	0	0	10.27978	0	0	0	0	0	0	14.53205
A0A669C3I1	A0A669C3I1_ORENI	omg		LRRNT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ILPGSLDR	1.340000033	870.47093	0	14.94204	0	16.13389	13.26925	17.36151	17.66416	17.21802	0	17.38897	17.33518	16.27885	0	17.81207	15.53755	0	0	17.02826	0	0	16.763	15.176	15.94776	0	17.42668	0	16.05566	0	15.92289	17.01041	0	0	18.30948	0	0	16.46166	16.15193	17.76227	0	17.69924	17.15747	15.81519	0	16.37912	18.66942	17.87709	17.16468	0	17.51512	15.96245	16.55781	0	17.22897	17.66908
I3KVP2	I3KVP2_ORENI	LOC102083264		LTD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SVEDGPVTLSRCSCCEVR	16.70999908	2109.808775	0	0	12.21103	13.276	0	17.09542	11.51739	14.09908	12.12503	13.51818	10.16271	17.07648	14.06125	14.20207	12.59942	13.48679	14.60468	14.25785	13.88196	9.624894	14.05623	18.04893	9.487632	0	12.67471	0	0	10.17134	8.698204	14.41611	0	13.46055	0	0	11.67378	13.97415	0	0	15.62089	12.1082	0	0	0	13.13292	0	11.89574	9.697845	12.80789	0	0	0	0	14.03529	0
A0A669BDB8	A0A669BDB8_ORENI	LOC100698874		Lactamase_B domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ALASTLR	7.690000057	732.2001131	13.38912	12.6585	13.21297	0	0	13.60125	0	14.75775	0	14.64324	0	14.19491	14.97031	14.41281	13.07989	13.89103	13.87497	13.44475	0	12.41357	0	15.74155	13.80489	14.50536	12.60474	0	15.45792	12.38976	15.29799	14.04278	0	19.31597	0	14.84212	0	14.32691	14.5927	15.25049	14.25548	14.74578	14.68682	14.74082	13.72789	14.18788	13.77132	0	12.74557	13.96534	14.77821	0	13.87703	0	14.56339	14.08726
A0A669E9R8	A0A669E9R8_ORENI	LAMA2	cell adhesion [GO:0007155]	Laminin subunit alpha 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	basement membrane [GO:0005604]; membrane [GO:0016020]	basement membrane [GO:0005604]; membrane [GO:0016020]; cell adhesion [GO:0007155]		VPAETVR	5.070000172	770.687789	14.92649	13.57571	12.30173	14.18229	14.56741	0	13.74989	0	13.73892	16.2609	14.32216	0	14.47395	14.69567	12.56874	15.25948	13.17353	12.19843	0	13.76911	0	14.19833	13.9135	15.03095	0	12.2421	0	0	13.00389	0	14.65932	16.64552	15.29771	0	11.44734	0	0	13.46912	10.5561	0	13.21989	14.95086	0	16.88096	12.73313	14.50795	14.5103	0	15.53934	0	16.41108	0	13.6825	15.62129
A0A669CCY2	A0A669CCY2_ORENI	LAMA3	cell adhesion [GO:0007155]	Laminin subunit alpha 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	basement membrane [GO:0005604]; membrane [GO:0016020]	basement membrane [GO:0005604]; membrane [GO:0016020]; cell adhesion [GO:0007155]		GTSLDTFGR	8.020000458	953.1478531	0	0	0	14.82008	14.68927	15.37542	0	10.58245	0	15.16576	0	0	13.9394	0	0	0	15.66141	13.38313	0	0	0	0	0	0	0	0	11.22005	13.63635	15.59944	11.22244	0	0	0	0	14.49967	0	12.95261	0	14.25219	0	0	0	0	0	14.72903	0	0	12.71711	0	0	11.29958	0	0	0
A0A669EIH6	A0A669EIH6_ORENI			"Laminin, beta 2 (laminin S)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	basement membrane [GO:0005604]; membrane [GO:0016020]	basement membrane [GO:0005604]; membrane [GO:0016020]		ADIGETKK	2.589999914	861.1153937	13.33801	12.48157	0	15.40922	14.37991	15.03868	13.73134	13.15659	14.54244	0	15.56808	13.63887	14.01845	0	14.80703	13.62049	15.41814	11.98572	0	14.58592	15.68921	14.23331	0	15.92031	13.89459	16.75935	14.18647	13.74481	15.27675	14.69001	16.55725	14.2624	16.69348	14.13913	15.42796	13.77161	0	14.48514	14.32913	13.44592	14.30092	13.81747	14.51824	0	12.22543	14.53642	0	13.74749	17.02072	14.26896	16.24358	13.75714	14.18582	15.71587
I3IZG3	I3IZG3_ORENI			"Laminin, beta 2-like"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	basement membrane [GO:0005604]; integral component of membrane [GO:0016021]	basement membrane [GO:0005604]; integral component of membrane [GO:0016021]		LLNELFSSVK	15.97000027	1150.168354	0	15.61457	17.02158	13.9136	11.35098	12.60354	13.92603	0	15.38493	14.91828	15.07522	15.45071	16.23705	13.93155	15.20264	0	13.82897	16.21127	13.35829	15.59094	0	14.45617	17.86251	0	16.91359	15.22507	0	14.92726	0	0	17.63654	18.86516	15.78677	15.34988	14.24299	0	15.02117	0	0	15.77571	0	0	15.81769	14.80506	16.00764	0	0	15.25452	17.33167	17.33178	0	15.56417	14.55405	16.25018
I3KJ12	I3KJ12_ORENI	lamtor1	cellular response to amino acid stimulus [GO:0071230]; cholesterol homeostasis [GO:0042632]; endosomal transport [GO:0016197]; lysosome organization [GO:0007040]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of TOR signaling [GO:0032008]; regulation of receptor recycling [GO:0001919]	Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1 (Ragulator complex protein LAMTOR1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	lysosomal membrane [GO:0005765]; Ragulator complex [GO:0071986]	lysosomal membrane [GO:0005765]; Ragulator complex [GO:0071986]; cellular response to amino acid stimulus [GO:0071230]; cholesterol homeostasis [GO:0042632]; endosomal transport [GO:0016197]; lysosome organization [GO:0007040]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of TOR signaling [GO:0032008]; regulation of receptor recycling [GO:0001919]		IAAYAYSAISQIK	9.640000343	1398.245714	0	0	0	0	16.89315	0	0	16.71828	0	0	16.62135	0	0	0	0	0	0	0	0	0	0	0	0	16.58912	15.6031	0	0	0	0	0	23.49741	23.89848	0	0	0	17.20076	16.69085	17.20793	0	0	16.5448	17.08405	16.4315	0	0	15.74802	17.01475	0	0	0	0	0	0	17.13237
I3KDX3	I3KDX3_ORENI	LOC102079881		Lebercilin domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MLSLDFPTPPPAITDASEYR	5.050000191	2215.940305	8.359552	0	9.400663	11.62872	12.49034	12.65718	12.32225	13.79501	12.82018	12.7545	0	12.25573	0	12.70741	14.4715	14.55703	11.56861	14.05632	0	0	17.85686	12.60441	13.00119	14.06113	14.08151	14.71084	14.0843	9.508858	0	0	0	9.71887	0	13.83494	0	0	0	0	0	12.08154	0	17.92252	10.88877	16.29365	0	10.47621	0	11.97097	13.88674	13.26423	0	11.73004	14.57542	15.23185
A0A669BS37	A0A669BS37_ORENI	lmln	cell adhesion [GO:0007155]	Leishmanolysin-like peptidase (EC 3.4.24.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]; cell adhesion [GO:0007155]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	HQVHVLVTPR	3.220000029	1184.935273	8.826852	11.46562	0	11.78639	13.55626	10.24714	15.59116	11.7661	13.17048	0	12.01119	14.03963	0	0	15.35915	0	13.64626	16.92698	0	0	13.65996	0	11.05092	10.96045	17.63094	15.68437	0	11.6984	0	12.95414	13.70397	13.37119	0	13.40297	12.23643	9.981702	0	13.40525	5.466578	17.51842	9.979829	0	11.67248	12.46712	0	10.83715	12.63915	12.74049	19.84575	13.63463	0	15.57801	14.20861	13.01847
I3KUJ8	I3KUJ8_ORENI		"chromatin organization [GO:0006325]; regulation of transcription, DNA-templated [GO:0006355]"	Lethal(3)malignant brain tumor-like protein 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; methylated histone binding [GO:0035064]; zinc ion binding [GO:0008270]; chromatin organization [GO:0006325]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]; methylated histone binding [GO:0035064]; zinc ion binding [GO:0008270]	APANNLESSSSLK	7.510000229	1316.740944	0	0	13.71495	15.34953	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.8871	0	0	0	0	0	0	0	13.91558	0	0	0	0	0	13.73597	0	0	0	0	0	0	0	0	15.71589	13.23934	0	14.41895	0	0
A0A669EXQ2	A0A669EXQ2_ORENI		positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]	Leucine rich adaptor protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]		ETGMKSLDEK	8.420000076	1153.488555	13.79458	12.30352	0	0	16.69655	10.49602	0	17.8283	14.22304	11.1663	0	0	12.97336	0	13.46896	15.69151	0	9.392122	12.03171	5.574756	12.69338	0	18.66041	0	15.41695	0	13.52934	15.18096	0	0	0	15.21245	14.16009	12.19328	0	0	0	13.47145	0	11.54554	14.05637	14.37306	13.26781	13.9212	13.05225	13.2019	0	12.42734	14.08691	18.57944	0	0	0	9.538202
I3IX20	I3IX20_ORENI	LRPPRC		Leucine rich pentatricopeptide repeat containing	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GDLENMKK	8.050000191	933.3109961	10.94679	11.81346	14.89817	14.85705	13.3858	17.46839	0	0	16.26209	0	14.26439	0	13.28556	0	14.59301	15.01683	16.58269	14.90969	14.39808	18.21664	0	0	0	15.21772	0	0	13.44464	0	15.32632	0	0	13.1146	16.6614	0	0	0	0	0	0	17.93036	0	0	0	0	0	16.75889	16.93956	16.66965	16.63573	0	0	0	14.92191	0
A0A669DXL5	A0A669DXL5_ORENI		ion transport [GO:0006811]	Leucine rich repeat containing 8 VRAC subunit Db	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ion transport [GO:0006811]		LELIPEAKITAK	2.880000114	1321.429209	0	15.77928	11.83926	11.83199	16.15527	0	13.18196	0	12.21426	15.40113	13.66993	13.3008	13.63685	14.81757	14.63601	16.59243	14.59595	13.94743	0	17.01837	16.21214	14.76383	14.8565	14.30809	15.96559	16.38171	0	0	12.96643	0	12.85386	0	15.09619	14.61203	0	15.27512	0	10.98812	14.98219	0	14.57396	14.79757	0	0	15.91354	15.30994	13.67733	0	0	0	0	17.14151	0	0
I3KW56	I3KW56_ORENI	LRRC9		Leucine rich repeat containing 9	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				HSMDTMPFR	4.449999809	1138.275823	12.33934	10.04399	12.69404	13.03776	0	11.69998	0	0	8.750194	0	13.61795	14.09686	14.97734	14.82703	0	16.08248	0	12.00221	14.06188	0	0	12.59284	0	12.50068	15.38856	14.51371	0	13.59283	15.57062	14.08227	14.37364	0	13.15568	13.39022	4.254936	14.63098	9.492856	14.09936	0	0	0	0	0	0	0	11.89976	0	0	18.02403	11.07634	15.79157	0	0	0
I3JBC5	I3JBC5_ORENI			Leucine zipper protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KMSVLSR	3.660000086	836.7590761	15.48998	15.25166	0	11.86811	10.31172	13.19869	14.81707	0	12.1938	0	13.65706	13.17749	14.47064	0	0	12.70146	13.2658	9.260749	10.4536	0	12.50087	0	0	14.90001	0	0	14.39827	11.12236	0	0	14.79147	0	12.63324	15.19159	15.36281	13.47345	14.01662	13.33599	0	10.90768	13.80729	14.58527	0	0	15.28736	0	0	0	0	0	15.50842	15.0146	0	0
A0A669EEV7	A0A669EEV7_ORENI	LOC100710423 LAPSER1 LZTS2	microtubule severing [GO:0051013]; mitotic cytokinesis [GO:0000281]; negative regulation of Wnt signaling pathway [GO:0030178]; nuclear export [GO:0051168]; spindle midzone assembly [GO:0051255]; Wnt signaling pathway [GO:0016055]	Leucine zipper putative tumor suppressor 2 homolog (Protein LAPSER1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centrosome [GO:0005813]; cytoplasm [GO:0005737]; microtubule [GO:0005874]; midbody [GO:0030496]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; microtubule [GO:0005874]; midbody [GO:0030496]; microtubule severing [GO:0051013]; mitotic cytokinesis [GO:0000281]; negative regulation of Wnt signaling pathway [GO:0030178]; nuclear export [GO:0051168]; spindle midzone assembly [GO:0051255]; Wnt signaling pathway [GO:0016055]		EIQSELSQK	3.109999895	1061.013529	0	13.55733	15.01863	14.08745	0	0	14.8061	0	14.2821	13.78433	0	0	15.38779	13.26913	15.08799	0	13.27114	0	0	16.97408	14.50593	14.65905	13.11814	0	14.85041	14.56862	13.17991	17.50658	14.37276	12.06705	14.06971	16.99796	0	15.59839	0	11.98841	15.51023	12.16812	0	13.83541	0	13.29321	0	0	12.5282	14.12568	10.24227	0	0	13.83498	0	0	0	0
I3JGE5	I3JGE5_ORENI	lztfl1		Leucine zipper transcription factor-like protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]		GEVEMELINTAHTNVLLLR	5.739999771	2167.28426	10.67369	0	10.72596	13.86913	0	13.086	13.93747	0	12.14573	0	13.29347	12.60615	0	13.46952	0	12.89122	0	13.39294	7.344528	0	0	13.89442	0	12.8395	0	0	0	0	14.17329	0	0	16.14426	15.26112	12.57035	0	14.67501	0	12.90829	14.50177	0	0	0	0	13.68425	0	0	10.35275	0	0	0	0	0	0	13.2379
I3KHB1	I3KHB1_ORENI	shoc2		Leucine-rich repeat protein SHOC-2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GGPAGLVK	7.809999943	699.0924549	0	15.48894	17.2216	0	17.4697	16.76102	16.42919	0	0	0	16.95159	15.07437	15.23336	0	16.56505	0	15.86009	17.54272	15.45685	14.73273	16.82546	16.73315	0	0	0	0	15.46691	0	15.53078	0	19.34911	19.37721	0	0	17.20547	0	16.56169	16.50046	0	16.90783	15.59442	0	0	17.11586	0	0	16.11578	16.16989	0	17.13138	0	16.9084	0	13.98179
A0A669F1U1	A0A669F1U1_ORENI	lars1	leucyl-tRNA aminoacylation [GO:0006429]	Leucyl-tRNA synthetase (EC 6.1.1.4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		aminoacyl-tRNA editing activity [GO:0002161]; ATP binding [GO:0005524]; leucine-tRNA ligase activity [GO:0004823]; leucyl-tRNA aminoacylation [GO:0006429]	aminoacyl-tRNA editing activity [GO:0002161]; ATP binding [GO:0005524]; leucine-tRNA ligase activity [GO:0004823]	TAKLDFLR	6.480000019	962.3099139	15.66289	11.66764	15.04808	15.5801	14.27599	14.29608	15.02145	16.01756	14.36829	16.97854	15.02335	15.16888	16.93616	0	15.42034	15.46359	16.16387	14.01478	16.17387	19.05901	0	15.79633	14.0516	15.92142	16.16871	15.25767	15.29662	16.287	16.01235	15.36504	15.95713	15.23933	16.03707	14.13944	14.47677	16.27966	17.09824	16.259	16.09692	0	15.38949	13.21135	16.60814	0	0	0	15.37251	15.76122	16.69189	15.90477	16.01836	16.57819	16.29146	17.86607
I3KME2	I3KME2_ORENI	LOC100705920	leukotriene biosynthetic process [GO:0019370]	Leukotriene A(4) hydrolase (LTA-4 hydrolase) (EC 3.3.2.6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; leukotriene-A4 hydrolase activity [GO:0004463]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]; leukotriene biosynthetic process [GO:0019370]	leukotriene-A4 hydrolase activity [GO:0004463]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]	FSLGPK	7.320000172	647.2906647	14.79768	0	15.95462	14.22497	14.66872	11.14057	13.48633	13.58234	14.76994	14.26318	12.95414	14.59919	14.74374	16.34854	11.32224	14.90392	12.42237	13.50258	11.91389	14.93161	13.15036	12.4841	8.598637	0	15.2879	13.99989	13.66354	0	11.28016	0	17.52153	16.4396	17.55329	0	0	0	14.56005	14.56227	13.77087	12.75371	10.89814	14.69657	12.2768	13.54142	13.74111	17.00201	15.06698	14.05974	15.73284	14.9237	15.02361	14.34531	11.45326	15.43771
I3J1I8	I3J1I8_ORENI			Leupaxin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	KATHSR	8.170000076	700.58163	11.72016	10.94043	12.58022	13.92747	0	0	14.21203	13.35095	0	0	12.66888	13.07165	14.9407	0	0	0	0	0	11.91728	15.03022	0	14.84812	13.2022	8.043846	0	0	14.81178	15.39572	0	0	15.81112	0	16.59121	0	0	0	0	0	0	17.66829	0	0	0	14.87987	0	17.45704	0	0	0	16.17075	16.02418	0	0	0
I3KRL5	I3KRL5_ORENI	MARF1	meiotic cell cycle [GO:0051321]; oogenesis [GO:0048477]; regulation of gene expression [GO:0010468]	Limkain-b1 (Meiosis regulator and mRNA stability factor 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	peroxisome [GO:0005777]	peroxisome [GO:0005777]; RNA binding [GO:0003723]; meiotic cell cycle [GO:0051321]; oogenesis [GO:0048477]; regulation of gene expression [GO:0010468]	RNA binding [GO:0003723]	MLMPSTSLGK	8.170000076	1064.408881	0	12.19543	14.03416	13.97232	13.37597	16.5197	0	11.60667	11.11896	12.19602	0	11.11966	13.91739	11.12405	0	0	0	0	0	12.71725	14.88875	0	0	11.36531	0	0	18.11944	13.30603	17.97767	17.25683	0	0	0	0	0	16.07324	0	0	0	0	16.043	0	0	0	0	0	0	0	14.84062	0	0	0	11.59023	13.60196
A0A669CLY3	A0A669CLY3_ORENI	LOC100707822	cell adhesion [GO:0007155]	Link domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; hyaluronic acid binding [GO:0005540]; cell adhesion [GO:0007155]	hyaluronic acid binding [GO:0005540]	SMSSTKK	17.70000076	769.2480428	0	15.5252	0	14.2962	0	0	16.865	18.19175	0	0	18.77681	17.57412	17.17727	17.58256	18.381	16.9052	17.97702	0	16.09636	0	14.99814	16.45478	15.42588	15.20998	0	13.76005	14.80542	17.00877	15.31316	0	0	16.96779	16.97808	14.50038	0	15.30153	13.99541	16.16262	15.62662	0	16.5384	14.49741	15.53763	14.93861	15.25241	15.75126	15.90487	14.18682	14.11866	0	14.11886	14.87717	15.38634	14.52666
A0A669DKE0	A0A669DKE0_ORENI		lipid catabolic process [GO:0016042]	Lipase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"hydrolase activity, acting on ester bonds [GO:0016788]; lipid catabolic process [GO:0016042]"	"hydrolase activity, acting on ester bonds [GO:0016788]"	RDFLPQSAMIK	10.19999981	1305.551329	16.23869	18.32202	17.11632	16.88647	18.5248	18.42018	18.59872	17.78274	17.31375	16.56611	19.26256	17.46286	17.54632	16.06133	15.9921	17.62397	0	16.33363	16.59265	0	15.65682	0	0	16.97215	16.36318	18.32968	17.37152	16.6397	16.56315	0	17.49094	18.62824	10.9678	16.25208	0	0	17.92395	16.80125	17.54155	17.79573	16.63994	18.38568	0	19.26489	0	18.28421	19.43401	17.68241	16.10764	0	15.97054	19.52143	16.89656	16.72219
A0A669DC84	A0A669DC84_ORENI	pla1a	lipid metabolic process [GO:0006629]	Lipase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; metal ion binding [GO:0046872]; triglyceride lipase activity [GO:0004806]; lipid metabolic process [GO:0006629]	metal ion binding [GO:0046872]; triglyceride lipase activity [GO:0004806]	DPLCVNNINIR	6.300000191	1326.971647	0	0	0	11.60764	11.38121	12.67072	12.21615	11.82411	0	13.98458	13.43691	12.85371	12.85058	11.04957	0	0	0	8.097411	0	13.41255	0	0	0	15.77233	12.36059	0	0	14.61438	0	14.82784	0	0	11.03647	13.66352	14.13016	12.51894	12.58319	10.7132	13.80949	14.65608	13.97406	13.12422	0	0	9.719866	0	7.437031	0	11.76685	0	0	15.10972	13.64862	0
A0A669CKA0	A0A669CKA0_ORENI			Lipocln_cytosolic_FA-bd_dom domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; small molecule binding [GO:0036094]	small molecule binding [GO:0036094]	TEIPGK	2.75999999	643.7748801	0	0	17.17983	0	17.12518	17.3674	18.09152	16.39984	0	17.83496	16.82427	18.05167	0	17.05812	0	16.26952	0	0	17.9729	16.07843	15.9816	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.96371
A0A669B982	A0A669B982_ORENI	LIAS	protein lipoylation [GO:0009249]	"Lipoyl synthase, mitochondrial (EC 2.8.1.8) (Lipoate synthase) (LS) (Lip-syn) (Lipoic acid synthase)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]	"mitochondrion [GO:0005739]; 4 iron, 4 sulfur cluster binding [GO:0051539]; lipoate synthase activity [GO:0016992]; lipoyl synthase activity (acting on glycine-cleavage complex H protein [GO:0102552]; lipoyl synthase activity (acting on pyruvate dehydrogenase E2 protein) [GO:0102553]; metal ion binding [GO:0046872]; protein lipoylation [GO:0009249]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; lipoate synthase activity [GO:0016992]; lipoyl synthase activity (acting on glycine-cleavage complex H protein [GO:0102552]; lipoyl synthase activity (acting on pyruvate dehydrogenase E2 protein) [GO:0102553]; metal ion binding [GO:0046872]"	NPQILVECLTPDFR	1.950000048	1701.065132	0	0	0	0	15.68646	0	0	16.17088	0	15.58765	17.88782	14.71049	13.73345	0	0	15.50152	0	0	0	0	13.79376	0	15.95947	0	14.16713	14.54587	16.74541	0	0	0	17.13079	0	16.47205	0	0	0	0	0	0	0	0	0	14.22033	0	0	0	0	0	0	0	0	0	0	0
A0A669D3X5	A0A669D3X5_ORENI	armc9	cilium assembly [GO:0060271]	LisH domain-containing protein ARMC9	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centriole [GO:0005814]; ciliary basal body [GO:0036064]	centriole [GO:0005814]; ciliary basal body [GO:0036064]; cilium assembly [GO:0060271]		SPNEIVRQYMAR	3.390000105	1478.827503	16.61201	16.57222	16.3629	15.82208	16.69667	16.50234	15.67583	0	16.95435	16.30825	17.27227	15.94538	17.20552	15.52696	16.07554	15.10035	16.36953	16.79025	16.38057	16.81026	14.90242	0	16.08978	17.30642	13.31768	0	0	0	0	0	0	0	0	16.69201	16.37344	17.21389	16.19828	16.60097	0	16.31027	0	0	0	17.7323	15.7573	14.25616	14.66215	16.01604	16.05673	18.11981	16.26651	0	16.9659	0
I3KL99	I3KL99_ORENI	DCAF1	protein ubiquitination [GO:0016567]	LisH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; protein ubiquitination [GO:0016567]		TMMKPMSAPGSLANQGMSDGSSYLK	2.279999971	2620.634892	0	14.46512	13.86789	12.18307	13.42864	12.42478	0	16.6181	13.83204	16.454	15.68712	14.01509	13.60717	14.00315	0	13.87599	15.69824	9.970616	14.1818	0	0	0	13.13074	15.94565	0	13.53333	0	14.41725	11.97212	0	0	0	0	15.43532	11.937	15.29158	15.21319	0	0	14.45187	0	0	13.53325	14.43716	15.47131	13.7533	0	0	0	15.33134	0	0	0	0
A0A669DYE8	A0A669DYE8_ORENI	LOC100707762	defense response to bacterium [GO:0042742]	Liver-expressed antimicrobial peptide 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; defense response to bacterium [GO:0042742]		QKTGFFTQK	4.739999771	1081.240346	15.09327	14.10914	14.29227	12.83108	0	14.55902	13.43513	0	14.36939	0	14.40852	14.56189	14.725	0	14.87565	0	12.63164	0	0	13.13431	16.10557	0	14.75749	15.08793	14.55348	0	16.66335	14.43352	13.83339	15.01927	0	15.31761	14.90933	14.65032	13.95498	0	14.08229	0	12.53973	13.41472	14.62007	14.79877	12.85457	0	15.52921	14.49673	0	0	13.40755	0	14.60544	14.59682	13.03219	15.32452
A0A669AVH9	A0A669AVH9_ORENI	LONP2	protein import into peroxisome matrix [GO:0016558]; protein processing [GO:0016485]; protein quality control for misfolded or incompletely synthesized proteins [GO:0006515]	"Lon protease homolog 2, peroxisomal (EC 3.4.21.-)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	peroxisomal matrix [GO:0005782]	peroxisomal matrix [GO:0005782]; ATP binding [GO:0005524]; ATP-dependent peptidase activity [GO:0004176]; serine-type endopeptidase activity [GO:0004252]; protein import into peroxisome matrix [GO:0016558]; protein processing [GO:0016485]; protein quality control for misfolded or incompletely synthesized proteins [GO:0006515]	ATP binding [GO:0005524]; ATP-dependent peptidase activity [GO:0004176]; serine-type endopeptidase activity [GO:0004252]	EAGVRSLER	6.28000021	1016.88644	14.12959	13.73101	13.40923	14.78266	14.4015	14.31035	13.11901	14.24652	0	13.6605	15.30276	13.86375	0	13.8069	13.29174	12.39075	15.4314	14.3505	14.58565	12.68843	12.45468	15.25744	0	16.29331	11.13892	14.8294	13.51897	14.16723	13.90859	12.80313	12.2002	15.41888	15.41497	15.4044	13.96861	13.70756	14.40823	13.7932	7.53392	13.62492	13.68141	14.88961	13.43504	16.04998	14.16488	14.77285	14.12405	6.669191	15.11978	13.86026	15.41832	0	15.10207	13.44442
A0A669CE09	A0A669CE09_ORENI		endocytosis [GO:0006897]	Low density lipoprotein receptor-related protein 1Aa	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium ion binding [GO:0005509]; endocytosis [GO:0006897]	calcium ion binding [GO:0005509]	QSYCANRVCK	2.710000038	1281.435877	15.59466	13.47779	5.842608	14.14136	15.42376	12.18365	12.93505	15.85261	0	16.30519	16.9392	14.21591	0	13.72141	17.529	16.58166	14.87701	13.55317	0	0	0	0	15.53422	0	0	0	0	0	15.1509	0	0	0	0	0	0	14.66778	0	0	14.47303	15.21229	0	0	0	0	0	0	0	15.69482	15.8665	0	16.32678	0	0	0
A0A669D324	A0A669D324_ORENI		endocytosis [GO:0006897]	Low density lipoprotein receptor-related protein 1Bb	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium ion binding [GO:0005509]; endocytosis [GO:0006897]	calcium ion binding [GO:0005509]	INLETGESR	23.76000023	1015.77924	15.71489	15.56764	14.59612	14.46988	16.99802	13.97292	15.60941	16.42049	14.92653	13.90652	16.42611	16.00241	13.84872	15.04785	0	15.71507	0	14.91497	15.22284	15.69988	14.58771	15.51225	12.95868	15.75291	14.83262	14.42228	14.2351	15.84851	13.89474	16.4286	0	17.50366	16.69154	14.69265	0	16.41391	16.17278	15.63673	15.47696	15.3499	16.14539	15.99097	14.39165	0	16.1861	16.36056	16.11897	15.75039	11.19112	10.71097	15.29342	15.77048	15.52732	14.69374
A0A669AV41	A0A669AV41_ORENI			Low molecular weight cytosolic acid phosphatase (EC 3.1.3.2) (EC 3.1.3.48) (Low molecular weight phosphotyrosine protein phosphatase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; acid phosphatase activity [GO:0003993]; non-membrane spanning protein tyrosine phosphatase activity [GO:0004726]	acid phosphatase activity [GO:0003993]; non-membrane spanning protein tyrosine phosphatase activity [GO:0004726]	MATDGGVVDQWR	4.300000191	1350.848018	0	10.09135	0	0	13.39834	11.94343	13.95181	13.42518	12.23957	0	0	0	0	14.46318	15.92655	13.78291	0	11.73586	0	0	13.71733	15.49272	6.196026	0	0	10.0376	14.63679	0	0	0	0	0	0	0	12.36161	0	11.36396	0	0	0	10.8747	0	0	15.31705	0	0	0	8.828435	0	0	0	0	15.64941	0
A0A669CQP6	A0A669CQP6_ORENI	LOC100705426	canonical Wnt signaling pathway [GO:0060070]; endocytosis [GO:0006897]; multicellular organism development [GO:0007275]	Low-density lipoprotein receptor-related protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; coreceptor activity involved in Wnt signaling pathway [GO:0071936]; Wnt-activated receptor activity [GO:0042813]; Wnt-protein binding [GO:0017147]; canonical Wnt signaling pathway [GO:0060070]; endocytosis [GO:0006897]; multicellular organism development [GO:0007275]	coreceptor activity involved in Wnt signaling pathway [GO:0071936]; Wnt-activated receptor activity [GO:0042813]; Wnt-protein binding [GO:0017147]	SVIGSLSIMGGSSGPPYDR	3.660000086	1879.075295	13.08189	12.05059	11.12618	13.14947	15.2137	0	12.78872	13.87509	12.09945	14.34511	14.69241	12.89171	13.37305	0	14.01406	12.90531	13.42688	0	15.24211	14.96793	9.693834	13.5163	13.21929	13.07419	12.51344	0	0	10.60715	0	10.98165	0	0	0	15.0643	0	0	0	13.66495	14.20867	11.62541	11.41145	13.62287	0	0	15.37501	12.82217	12.93105	13.46541	15.7304	12.44794	12.30233	10.81468	11.76082	13.72462
I3KZ08	I3KZ08_ORENI	brcc3	angiogenesis [GO:0001525]; cell cycle [GO:0007049]; cell division [GO:0051301]; double-strand break repair [GO:0006302]; histone H2A K63-linked deubiquitination [GO:0070537]; positive regulation of DNA repair [GO:0045739]; response to ionizing radiation [GO:0010212]; signal transduction involved in G2 DNA damage checkpoint [GO:0072425]	Lys-63-specific deubiquitinase (EC 3.4.19.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	BRCA1-A complex [GO:0070531]; BRISC complex [GO:0070552]; cytoplasm [GO:0005737]; spindle pole [GO:0000922]	BRCA1-A complex [GO:0070531]; BRISC complex [GO:0070552]; cytoplasm [GO:0005737]; spindle pole [GO:0000922]; isopeptidase activity [GO:0070122]; metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237]; polyubiquitin modification-dependent protein binding [GO:0031593]; thiol-dependent ubiquitin-specific protease activity [GO:0004843]; angiogenesis [GO:0001525]; cell cycle [GO:0007049]; cell division [GO:0051301]; double-strand break repair [GO:0006302]; histone H2A K63-linked deubiquitination [GO:0070537]; positive regulation of DNA repair [GO:0045739]; response to ionizing radiation [GO:0010212]; signal transduction involved in G2 DNA damage checkpoint [GO:0072425]	isopeptidase activity [GO:0070122]; metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237]; polyubiquitin modification-dependent protein binding [GO:0031593]; thiol-dependent ubiquitin-specific protease activity [GO:0004843]	LADMTGRPMR	13.38000011	1146.551937	12.19723	12.12147	7.579517	13.83538	0	14.34887	18.43589	11.40477	0	0	0	0	13.47213	15.35916	0	0	13.92147	10.60833	19.16808	14.609	12.39973	20.26238	18.43791	13.95099	9.43645	0	14.16891	0	10.94061	13.05882	11.24227	0	7.168863	10.9337	0	0	13.02234	14.56468	19.24805	17.65818	11.9782	5.735159	0	0	0	0	12.42115	12.79385	20.0538	11.15621	19.30605	12.6432	0	18.38604
I3JHQ4	I3JHQ4_ORENI	lysmd1		LysM domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				RIEHIIQPGETLQGLALK	4.71999979	2016.978375	12.42807	13.70439	12.642	13.42711	14.59025	10.85935	14.42776	9.751591	12.80136	14.55685	14.37105	11.56125	11.92604	13.42233	13.68494	0	13.69977	10.58881	0	0	13.32176	0	15.20609	15.99419	0	16.01132	9.650676	14.76589	12.79484	0	0	13.5554	13.41856	13.8975	11.81357	13.0256	13.82127	10.75296	13.17638	13.61536	15.05082	13.36085	14.14277	12.60201	13.93521	15.24981	0	13.40868	0	0	0	0	0	0
A0A669DA71	A0A669DA71_ORENI			"Lysine (K)-specific demethylase 6A, like"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TKALLMK	8.289999962	819.8510991	12.52719	14.98191	11.79962	0	0	15.41929	16.03933	0	0	0	0	0	0	0	14.67319	14.69156	14.23688	0	15.8776	13.94901	13.1239	15.31525	0	0	0	14.9809	0	0	0	13.61692	18.62048	16.57275	0	0	14.49556	0	0	14.27835	14.94147	0	14.779	15.31682	14.28772	0	0	0	15.00831	14.47545	0	0	0	0	0	0
A0A669BG70	A0A669BG70_ORENI			Lysine (K)-specific methyltransferase 2E	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	VSLLEYRK	2.910000086	1005.796047	13.29558	13.29012	13.23889	16.70528	14.05927	0	13.19753	15.01402	0	12.67194	13.5772	0	15.61008	14.19834	15.35395	14.33349	11.75392	12.33496	14.90608	13.85283	12.63743	13.50562	14.21645	15.52429	14.7803	14.39773	14.52156	16.3373	13.5595	14.9551	15.48664	14.77039	9.152025	13.73393	14.34499	12.35874	15.13897	0	15.22856	14.43277	14.2372	13.59037	14.14866	14.86863	13.94324	13.80877	13.76138	13.90441	0	11.16399	15.50795	10.40033	13.57693	14.24236
A0A669CTC7	A0A669CTC7_ORENI			Lysophosphatidylcholine acyltransferase 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MKSLMQNGK	8.100000381	1068.596508	0	0	14.80639	9.772838	0	0	17.07674	0	15.37454	12.26218	0	16.63679	15.07671	17.32355	0	15.98495	0	17.39865	12.50705	0	15.7772	16.00504	15.85982	15.09706	0	14.05029	15.68228	16.66498	16.6568	0	17.25972	14.68397	17.98107	13.78765	15.96031	13.57415	14.61258	0	15.75147	14.2752	0	0	14.75109	9.78986	0	18.81878	18.44809	18.18407	0	0	15.5025	15.89246	15.71557	14.06506
A0A669BJA5	A0A669BJA5_ORENI		lysosome organization [GO:0007040]	Lysosomal trafficking regulator	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		lysosome organization [GO:0007040]		MSGASNTLAR	6.769999981	1023.8507	13.16467	0	13.39176	14.19299	0	0	13.062	0	15.1723	16.17945	0	14.76841	12.56358	14.63959	0	16.64138	15.08025	0	0	13.38762	14.63614	0	13.84836	14.61344	0	0	13.88436	0	13.34307	13.52933	15.63632	14.26323	15.95126	0	13.98431	13.65143	12.49067	16.71865	14.52939	0	0	0	14.20297	0	0	0	0	13.34013	14.67479	0	14.66059	14.35389	15.68128	0
A0A669CRN6	A0A669CRN6_ORENI	LOC100705741	peptidyl-lysine oxidation [GO:0018057]	Lysyl oxidase homolog (EC 1.4.3.13)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; copper ion binding [GO:0005507]; protein-lysine 6-oxidase activity [GO:0004720]; scavenger receptor activity [GO:0005044]; peptidyl-lysine oxidation [GO:0018057]	copper ion binding [GO:0005507]; protein-lysine 6-oxidase activity [GO:0004720]; scavenger receptor activity [GO:0005044]	VICGMQGFPGEK	10.22999954	1337.477223	0	15.61366	14.96627	14.67781	13.73677	15.66442	15.94028	13.92173	15.24822	15.78459	16.14762	0	12.63512	11.80079	16.93707	0	0	0	17.29867	16.99782	16.13095	17.0055	17.31058	16.80594	17.8094	0	17.75508	15.48862	0	0	15.93156	0	0	16.24446	0	0	16.43938	0	15.58447	0	0	0	0	0	0	0	17.02666	0	0	0	0	0	0	0
I3KFA9	I3KFA9_ORENI			M-phase phosphoprotein 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SQAEAK	6.199999809	633.8554966	17.88041	17.51458	17.76474	17.44524	17.34742	0	19.17715	19.17811	18.1563	18.38462	18.09813	16.94103	0	0	16.27024	18.47084	18.59277	0	16.45426	0	16.71161	0	19.18872	0	0	0	17.43667	0	18.51343	16.46286	0	16.59962	0	19.13066	0	16.92843	17.51208	0	18.18879	0	16.5555	16.13277	0	0	19.07232	17.26798	19.55023	0	18.37991	16.77106	18.28976	17.58626	17.26758	0
I3KIP0	I3KIP0_ORENI	LOC100690321	cell cycle arrest [GO:0007050]; negative regulation of mitotic cell cycle [GO:0045930]; positive regulation of neuron differentiation [GO:0045666]	MACPF domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cell cycle arrest [GO:0007050]; negative regulation of mitotic cell cycle [GO:0045930]; positive regulation of neuron differentiation [GO:0045666]		MATPWPMR	10.27000046	1006.324588	15.77215	0	0	15.49163	0	16.05051	13.48153	15.46653	0	13.03539	0	15.11688	0	0	0	14.13286	14.73849	17.11695	16.26333	0	0	0	15.75152	0	0	15.95275	0	0	0	0	15.02295	0	13.70696	14.4531	15.24381	0	15.39557	0	0	16.29526	0	18.26701	15.78739	15.38889	0	16.00333	15.89526	0	13.74733	0	0	0	15.47752	0
I3JWG2	I3JWG2_ORENI	LOC100695261		MARVEL domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	bicellular tight junction [GO:0005923]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	bicellular tight junction [GO:0005923]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]		ELDLMMER	21.12000084	1036.609548	19.29822	19.27974	18.11301	19.66006	19.60314	17.07627	17.14691	18.82292	0	19.7292	18.54125	0	19.58447	19.21561	16.1618	19.70298	19.35802	16.37677	19.17754	20.2913	18.4283	19.7154	16.3809	16.09259	19.52449	0	17.32943	18.83885	0	16.35119	0	0	0	17.09395	19.56927	0	17.35722	0	0	0	17.1303	19.7248	19.27823	17.37013	19.876	19.74157	18.66629	0	18.32289	0	0	0	17.42706	0
I3IYA8	I3IYA8_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	MAX dimerization protein MLX	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"protein dimerization activity [GO:0046983]; transcription factor binding [GO:0008134]; regulation of transcription, DNA-templated [GO:0006355]"	protein dimerization activity [GO:0046983]; transcription factor binding [GO:0008134]	TDGAFSDGGFDNSYISEAIRK	5.300000191	2251.207229	15.40001	15.38726	13.62294	13.95754	15.62082	14.42008	0	0	10.32475	0	14.43101	14.3163	13.57819	13.01107	14.7597	13.05647	0	16.19286	14.80328	14.17375	0	14.3593	15.23187	14.40761	0	13.71532	13.56948	13.1797	12.11563	13.0917	14.81918	16.95047	14.44061	0	12.22584	9.483895	13.01875	11.05666	14.64998	10.24369	0	13.22545	11.77186	0	0	11.15368	13.44675	12.56163	0	0	0	14.49787	13.88703	12.89169
A0A669B400	A0A669B400_ORENI	mecp2		MBD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]	DNA binding [GO:0003677]	TLAQMQPQSQPRPQTQMQPQAQSR	7.690000057	2779.967674	0	0	0	17.51115	0	17.87796	0	0	0	0	0	16.00304	0	0	0	0	0	0	0	15.96157	0	16.18346	13.49703	0	0	0	0	13.16429	0	0	0	0	14.89864	0	11.4298	0	0	0	0	12.34204	0	17.11887	14.07265	10.80146	11.60989	14.95431	0	14.3368	0	0	0	0	0	0
A0A669CVV7	A0A669CVV7_ORENI		intracellular signal transduction [GO:0035556]	MCF.2 cell line derived transforming sequence-like 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]; intracellular signal transduction [GO:0035556]	guanyl-nucleotide exchange factor activity [GO:0005085]	GAMAAVRK	2.730000019	819.1625372	0	0	0	0	0	0	0	16.85856	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18.53248	0	0	0	0	0	0	0
A0A669DA22	A0A669DA22_ORENI		apoptotic process [GO:0006915]; regulation of apoptotic process [GO:0042981]	"MCL1 apoptosis regulator, BCL2 family member b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		apoptotic process [GO:0006915]; regulation of apoptotic process [GO:0042981]		VADPESTTREVEWTK	3.74000001	1747.283589	17.18488	16.82064	0	17.45793	17.54911	0	0	0	16.77905	0	0	0	0	0	17.59917	0	17.65606	17.45445	0	0	0	17.74937	17.54674	17.64305	0	17.25294	17.58872	16.90742	16.81054	17.10678	0	17.33998	16.66664	0	0	0	0	17.67574	0	0	0	0	0	0	0	17.60544	17.32593	0	0	0	0	0	0	18.70047
A0A669CHJ5	A0A669CHJ5_ORENI			MDS1 and EVI1 complex locus	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ESTVPSGGLGIWSR	1.269999981	1445.035322	11.65462	14.56987	14.53623	0	14.55568	0	0	9.81615	0	13.37644	12.97181	15.73244	14.80631	15.15175	12.28291	15.53771	14.55801	14.50432	16.00588	13.69803	0	0	0	0	0	15.76788	0	0	0	0	15.65158	0	15.32476	0	0	16.30535	0	0	15.56754	0	15.57088	0	0	16.27008	15.68722	16.37896	15.60321	0	0	15.77667	0	16.59962	0	0
A0A669BU43	A0A669BU43_ORENI	mfap1		MFAP1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NNGKVVTNK	1.309999943	973.5029047	15.75527	0	0	0	0	0	12.16585	0	0	13.90264	14.77024	0	0	12.94733	14.54814	16.05713	15.04761	15.93562	0	0	0	16.28429	0	15.89689	0	0	15.22317	0	0	0	0	0	15.92608	14.50473	14.07036	0	0	0	14.03898	0	0	18.19988	13.96185	14.71076	0	0	14.60195	0	15.4716	14.00063	16.48556	15.21927	17.24355	15.3972
A0A669F6L8	A0A669F6L8_ORENI	LOC100694538		MFS domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	ALAMGTSSAMAR	6.920000076	1181.712167	12.26361	10.66144	11.62978	16.17994	0	14.219	10.32858	14.84614	12.1081	0	17.61336	17.01684	14.48416	10.68423	0	13.29232	10.34326	12.71513	13.57254	13.80249	18.14648	13.98098	15.03973	0	12.84594	13.39792	15.14412	13.94227	13.57047	15.80417	0	11.92449	12.64472	0	10.84945	0	11.87006	14.05943	0	0	0	0	0	0	14.37323	0	0	0	0	18.51608	0	0	10.47238	0
A0PAH8	A0PAH8_ORENI	G1S3A18		MHC class IA antigen (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KYFVTGSSGAPNIPELFGVLMVDGIQMGYCDVSK	12.90999985	3711.795427	0	12.0094	0	13.5505	7.709579	0	10.03086	0	5.443664	0	0	12.2339	12.03496	0	13.16223	0	11.38627	13.25381	0	0	13.93894	0	0	0	12.27585	10.58366	13.78233	0	16.87794	10.7659	0	10.87543	11.98369	12.05483	0	0	0	0	15.39791	0	0	10.03952	0	0	0	0	11.09527	0	19.21449	0	0	0	0	12.19115
A0A346QR39	A0A346QR39_ORENI	Orni-DAA	antigen processing and presentation [GO:0019882]; immune response [GO:0006955]	MHC class II alpha subunit (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	MHC class II protein complex [GO:0042613]	MHC class II protein complex [GO:0042613]; antigen processing and presentation [GO:0019882]; immune response [GO:0006955]		DYPLEH	4.21999979	773.5531939	15.78476	13.92986	15.40175	14.90702	14.83067	14.35872	14.98142	12.0224	13.74581	15.28669	15.98395	13.73147	16.59329	15.98993	15.05804	14.52743	13.17565	14.39352	14.24602	15.32733	13.88987	17.24245	17.21094	16.69455	11.66567	15.55532	14.34439	14.75623	15.87107	14.67679	17.0466	0	17.43472	14.93757	14.52808	14.34033	14.44755	14.95506	13.56693	15.81969	15.27065	14.99719	15.33494	14.94968	15.69507	13.87647	15.95939	14.56551	15.75643	17.15571	16.351	10.07437	15.46408	15.20497
G3FHD1	G3FHD1_ORENI	Orni-DBA	antigen processing and presentation [GO:0019882]; immune response [GO:0006955]	MHC class II antigen alpha chain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; MHC class II protein complex [GO:0042613]	integral component of membrane [GO:0016021]; MHC class II protein complex [GO:0042613]; antigen processing and presentation [GO:0019882]; immune response [GO:0006955]		NVGRGMK	4.46999979	778.4628305	16.85397	0	16.78703	17.62938	0	0	16.44145	17.08897	16.53757	0	0	16.63675	16.34506	17.42777	15.66879	0	0	0	0	16.1041	0	0	0	0	0	0	0	0	0	16.43439	0	0	0	16.73059	0	17.3215	13.82134	0	0	0	16.56221	0	0	16.66762	17.17143	0	0	0	16.03646	0	15.80364	16.54149	0	0
A0A6M3REQ8	A0A6M3REQ8_ORENI	Orni-DAB	antigen processing and presentation [GO:0019882]; immune response [GO:0006955]	MHC class II antigen beta chain (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; MHC class II protein complex [GO:0042613]	integral component of membrane [GO:0016021]; MHC class II protein complex [GO:0042613]; antigen processing and presentation [GO:0019882]; immune response [GO:0006955]		GNLAAMR	1.24000001	746.5892084	15.13558	14.58141	15.3963	12.70914	15.17221	14.869	16.57287	15.58375	14.76917	17.78419	14.96748	0	15.13712	0	14.45969	14.40405	0	15.32395	14.68988	0	0	15.4609	0	0	0	0	0	0	14.53367	16.26567	15.59578	0	14.70227	0	0	0	15.1143	13.68324	0	0	14.8661	14.7688	16.55434	0	0	0	16.6177	15.43596	15.33038	0	15.74445	14.79815	14.92096	15.96164
A0A3S5GZJ5	A0A3S5GZJ5_ORENI	Orni-DAB	antigen processing and presentation [GO:0019882]; immune response [GO:0006955]	MHC class II antigen beta chain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; MHC class II protein complex [GO:0042613]	integral component of membrane [GO:0016021]; MHC class II protein complex [GO:0042613]; antigen processing and presentation [GO:0019882]; immune response [GO:0006955]		MASSFLCLSLLFISLSTAGGFK	7.050000191	2365.0849	0	0	0	0	0	0	18.89789	0	0	19.28844	0	0	0	0	0	0	17.96708	0	0	13.73456	16.01767	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.02877	0	0	0	0	16.15931	0	15.2508	16.66988	0	16.14892	0	14.73066	15.08942	0	15.5687	0	0	0
A0A669C043	A0A669C043_ORENI		antigen processing and presentation [GO:0019882]; immune response [GO:0006955]	MHC_II_beta domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	MHC class II protein complex [GO:0042613]	MHC class II protein complex [GO:0042613]; antigen processing and presentation [GO:0019882]; immune response [GO:0006955]		MINISYLYIFCLSSDGFK	6.929999828	2171.928783	12.94288	12.32714	13.32832	11.74381	0	0	13.42743	11.78812	0	9.198303	10.95214	0	14.72134	13.14308	0	10.88609	15.32405	10.80091	13.803	10.93834	17.52526	13.90132	10.79468	12.76701	11.0551	13.3517	13.11507	14.6363	11.63021	11.66118	0	0	0	12.14345	10.21702	0	0	12.54562	0	11.29785	0	0	0	0	0	0	11.63567	0	0	0	0	0	0	0
A0A669BLK8	A0A669BLK8_ORENI	LOC100711404	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	MHD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	clathrin adaptor complex [GO:0030131]	clathrin adaptor complex [GO:0030131]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]		GLKPLGFKMSISLIK	8.430000305	1648.810536	15.21875	0	13.13261	16.14453	15.77906	15.42358	0	17.08809	0	0	0	16.13943	16.27417	15.99221	17.01276	15.77116	15.03622	16.52219	15.5973	15.57671	0	0	14.90733	15.80707	14.8599	0	12.4823	17.61607	15.46211	0	17.60413	16.3294	14.96181	16.11947	16.35637	15.99366	17.83601	0	0	16.14125	0	16.98458	0	0	17.91089	0	0	0	0	0	0	0	0	17.44995
A0A669CWS9	A0A669CWS9_ORENI	micos13		MICOS complex subunit MIC13	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	MICOS complex [GO:0061617]	MICOS complex [GO:0061617]		WTISNLSEAPTK	8.5	1345.655699	0	12.50782	0	13.63646	13.40037	0	13.63116	0	13.9011	14.35255	0	0	0	12.69648	15.49502	11.4141	8.862565	11.29824	15.05407	14.18407	11.12009	12.32049	12.67172	15.33294	14.70317	10.21971	14.69706	13.38364	0	0	14.86511	16.25176	15.35969	0	0	13.72203	14.20533	14.97366	0	11.79318	12.05918	0	13.92219	8.960279	15.18259	15.36414	15.32709	14.74676	15.52971	13.47417	14.19077	14.93953	14.56042	13.06147
I3JNC1	I3JNC1_ORENI	APOO	cristae formation [GO:0042407]	MICOS complex subunit	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	MICOS complex [GO:0061617]	MICOS complex [GO:0061617]; cristae formation [GO:0042407]		GSNTSS	4.269999981	552.3767315	14.78426	15.64099	14.67512	0	14.59237	14.17178	16.33277	14.23243	16.29519	13.68177	15.18207	0	0	14.89523	0	14.94075	16.12576	16.40425	16.17161	0	15.39394	16.45345	15.09748	15.53933	0	0	0	17.82442	0	15.31689	17.87931	20.46134	17.61894	14.98989	0	15.24386	15.71518	14.83291	15.89169	15.06458	0	15.37235	16.08292	15.2987	13.52112	16.80258	15.37079	16.54478	13.64783	16.39703	15.90375	15.22224	0	0
I3K8B5	I3K8B5_ORENI	MINAR1		MINAR1_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		IFQSSRPLK	4.269999981	1075.109723	12.64113	12.70353	11.92175	13.66349	10.49478	13.13125	0	0	0	11.24235	14.56293	0	13.61607	0	14.31922	11.77736	15.39543	14.40976	14.33201	14.08671	15.2523	15.10627	15.33336	12.43155	15.56015	0	16.73289	0	14.20613	14.67723	13.88266	0	0	0	17.25665	0	0	0	11.85417	14.96982	0	0	8.893229	0	11.6561	0	14.10569	13.59645	0	0	0	0	16.01029	15.14888
A0A669BIM7	A0A669BIM7_ORENI	LOC100692187		MIT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GAEYTGIAIHK	8.760000229	1159.025083	14.04616	14.43842	12.61829	0	10.40597	0	12.33853	14.79267	0	0	0	13.77396	10.66904	14.03237	0	13.82508	0	0	15.10981	14.0515	0	12.19972	19.35126	17.7823	13.3722	0	10.56985	0	12.70981	16.08333	13.29838	15.02438	11.24787	0	13.17017	11.40057	13.69221	12.89908	13.22569	0	0	0	14.15902	0	10.52203	0	12.69529	0	17.21663	0	0	0	15.0539	11.88879
A0A669EYQ5	A0A669EYQ5_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	MLLT1 super elongation complex subunit a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; regulation of transcription, DNA-templated [GO:0006355]"		KDSESK	1.899999976	692.8508985	13.1904	12.82639	13.64218	10.43562	12.32226	13.44641	12.78889	13.39023	0	0	0	13.75432	13.88459	13.69169	14.36537	12.92216	12.46147	13.83178	14.67442	14.57725	13.40807	12.89289	14.29764	16.13013	15.08266	0	0	0	0	14.96197	0	17.04796	17.94703	13.28336	0	0	14.21973	0	13.03919	15.20764	0	10.80811	12.388	13.51169	0	13.92242	0	14.18533	13.54701	15.27687	13.28822	0	12.69749	13.30549
I3K6J8	I3K6J8_ORENI			MOB kinase activator 1A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				HAEATLGSGNLR	3.980000019	1225.256364	11.80408	0	14.89045	0	12.68639	12.81713	12.07189	14.54035	11.68482	13.18821	8.673244	0	14.50922	14.60258	13.74942	13.8005	0	14.27569	0	12.2538	0	14.40355	0	14.01868	13.32308	9.853204	12.65442	13.92833	13.94112	10.09908	0	0	15.51174	0	0	0	0	9.039474	0	14.11262	13.69138	12.64772	13.56577	15.43356	9.946502	15.43876	14.82657	14.92483	12.25043	13.81565	14.91238	15.32806	0	0
I3JUY7	I3JUY7_ORENI			MOB kinase activator 3A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SMALKQVFNK	5.110000134	1181.279822	13.94243	0	0	13.40034	12.04978	13.51475	0	0	0	9.026739	0	0	13.93884	13.46019	17.6358	14.68877	0	18.05066	13.17489	13.71157	12.83717	17.09191	12.75587	13.58774	14.01512	12.7163	12.97275	0	18.60405	11.84388	0	0	0	11.7038	15.40607	0	14.89406	0	14.47946	0	0	0	0	12.3476	0	0	0	0	0	0	0	13.18548	13.94022	0
A0A669EMN2	A0A669EMN2_ORENI	abraxas2		MPN domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		NTQQQMSFR	13.40999985	1152.606637	14.74946	0	10.81523	14.82912	0	0	11.56083	17.8283	15.11988	9.905235	12.4566	17.19448	13.21696	0	14.99731	17.60872	0	14.81883	13.20169	0	0	11.47069	12.94526	0	0	10.64277	15.19763	8.460538	14.26884	14.29594	12.78267	18.05861	14.28692	12.19328	18.12922	12.65485	13.47018	0	12.86908	17.04743	14.94621	14.41506	13.60229	14.12272	10.87109	14.56489	12.60111	0	8.990214	14.7586	14.05112	13.1494	8.557742	17.27767
I3K6A5	I3K6A5_ORENI	LOC100691845	"chromatin organization [GO:0006325]; regulation of transcription, DNA-templated [GO:0006355]"	MRG domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	NuA4 histone acetyltransferase complex [GO:0035267]; Sin3 complex [GO:0016580]	"NuA4 histone acetyltransferase complex [GO:0035267]; Sin3 complex [GO:0016580]; chromatin organization [GO:0006325]; regulation of transcription, DNA-templated [GO:0006355]"		NSSTLFSASDYEVAPPEYHRK	2.210000038	2396.838066	0	12.17721	10.17287	0	13.91621	12.65613	0	0	0	12.35383	11.7485	11.97821	12.74143	8.432164	0	12.45216	13.16637	13.58194	13.38548	13.87453	12.64302	13.26987	10.39825	0	12.99428	11.45144	11.82238	0	0	10.92158	0	0	0	13.99688	0	0	0	11.52643	11.37778	0	9.516401	0	8.624108	0	14.65023	10.31188	12.63691	9.554938	17.24477	0	0	0	0	14.47986
A0A669EC26	A0A669EC26_ORENI	LOC100711919		MSP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]		RLQMEVQR	2.450000048	1072.671547	12.22361	11.16767	15.43701	0	13.87196	13.22388	0	14.78752	13.43284	9.668228	12.63521	0	13.90937	15.4908	0	0	15.92629	0	0	16.6834	0	0	15.70613	16.88886	0	0	13.87385	0	0	0	16.21271	0	0	0	0	0	0	0	14.39451	0	0	0	0	16.44729	0	0	0	0	0	0	0	0	0	0
I3KQH8	I3KQH8_ORENI	LOC102076640		MULTIHEME_CYTC domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		heat shock protein binding [GO:0031072]; unfolded protein binding [GO:0051082]	heat shock protein binding [GO:0031072]; unfolded protein binding [GO:0051082]	VPHSSFVK	5.349999905	900.1392241	14.55309	13.0141	13.4385	14.15315	0	13.00337	0	15.13425	15.22049	14.24452	15.15982	16.75175	16.24887	14.33195	16.49123	15.85123	16.30776	14.41811	0	0	17.00224	0	13.83388	0	14.33309	17.65241	13.75244	16.57966	15.2523	17.19274	0	13.86484	0	16.23267	17.20094	12.72515	0	13.09733	15.01481	14.90583	15.48813	0	14.63813	14.81309	0	0	15.96929	15.09863	17.47318	0	15.31014	0	15.1944	17.91924
A0A669BTM4	A0A669BTM4_ORENI			MYC-associated zinc finger protein a (purine-binding transcription factor)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AHLIRHEEK	26.29000092	1131.73617	17.33155	0	16.63011	16.83406	0	17.20724	16.34521	0	16.44462	0	17.3951	0	17.29675	16.78493	0	16.56211	0	17.05542	0	16.07546	0	0	0	0	0	0	16.32445	16.11753	0	16.69897	18.58291	17.27224	18.36551	17.40098	17.02835	16.46856	17.07779	0	0	0	0	0	16.51161	0	16.66204	16.97799	16.5302	16.62706	16.35149	0	15.50737	0	16.17173	16.68823
A0A669C2L9	A0A669C2L9_ORENI	zmynd19		MYND-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MEVDADGNGAK	3.049999952	1119.940084	10.92628	13.43031	12.10396	14.16504	13.39023	0	13.51627	14.72409	0	0	15.06458	13.10402	13.32119	11.81584	0	0	0	16.96564	0	14.87294	12.38554	12.57688	13.56254	13.99426	14.31401	14.94204	14.63491	13.17255	15.25574	0	11.82252	12.46634	11.74171	14.85786	17.33964	10.55378	0	13.48651	13.09752	13.34676	17.64741	12.87694	14.32959	0	16.64511	0	15.09028	14.52227	0	10.64685	14.64363	14.2154	0	13.83704
A0A669BYC9	A0A669BYC9_ORENI	LOC109204785		Mab-21 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NEICAGK	12.31000042	787.3841454	12.24572	14.54362	13.9007	15.57983	14.83216	13.83908	14.07929	11.56359	0	0	17.82841	14.41278	13.61395	13.67912	0	12.75528	13.84351	13.57028	0	0	12.30402	0	0	14.55095	0	12.93295	13.2636	0	10.71672	9.582738	0	0	0	11.95444	0	10.67663	14.78438	0	11.87777	14.75981	10.97727	13.28964	14.51642	14.40858	13.44702	13.47714	0	0	15.10965	0	14.08757	10.05393	13.01514	0
A0A669DLU0	A0A669DLU0_ORENI	LOC100697517		Macrophage-expressed gene 1 protein (Perforin-2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasmic vesicle membrane [GO:0030659]; integral component of membrane [GO:0016021]	cytoplasmic vesicle membrane [GO:0030659]; integral component of membrane [GO:0016021]		NFLYTAKAYPDFTLDTR	9.029999733	2031.735968	11.51191	13.28768	13.06812	13.41275	13.39121	0	12.06214	12.71402	9.497957	0	0	0	7.461336	13.26796	0	13.2143	13.31609	12.46064	0	0	0	11.26663	15.58611	14.6786	0	12.74085	0	0	11.94001	12.93757	14.76162	0	12.65914	0	0	7.399144	0	0	17.23283	0	0	13.98672	0	12.86331	13.86964	13.00469	11.69793	6.669191	15.52026	12.31838	11.63251	0	0	13.70519
A0A669D8K1	A0A669D8K1_ORENI	park7	autophagy [GO:0006914]; single fertilization [GO:0007338]	Maillard deglycase (EC 3.5.1.124) (Parkinsonism-associated deglycase) (Protein/nucleic acid deglycase DJ-1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane raft [GO:0045121]; plasma membrane [GO:0005886]	membrane raft [GO:0045121]; plasma membrane [GO:0005886]; autophagy [GO:0006914]; single fertilization [GO:0007338]		GAEEMETVIPVDIMRR	4.070000172	1877.491395	12.65549	8.785506	12.79305	0	0	15.36593	15.38987	0	13.64481	0	0	0	0	13.20614	0	0	14.95388	0	15.17966	0	14.74636	14.62143	0	14.82862	14.30859	14.47117	0	12.47774	0	0	0	0	0	14.77267	0	14.73138	13.26154	8.745764	0	0	13.03931	16.04474	0	0	0	0	15.69231	0	0	0	15.37965	0	0	15.6202
A0A669DQ83	A0A669DQ83_ORENI	LOC100711262	carbohydrate metabolic process [GO:0005975]; malate metabolic process [GO:0006108]; tricarboxylic acid cycle [GO:0006099]	Malate dehydrogenase (EC 1.1.1.37)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		L-malate dehydrogenase activity [GO:0030060]; carbohydrate metabolic process [GO:0005975]; malate metabolic process [GO:0006108]; tricarboxylic acid cycle [GO:0006099]	L-malate dehydrogenase activity [GO:0030060]	KLSSAMSAAK	7.960000038	1008.533335	0	0	0	0	13.29527	10.63165	0	0	11.75861	0	0	15.08741	0	0	0	0	0	0	15.07229	14.49624	12.99057	15.32576	14.89002	14.77077	0	12.28568	0	15.62031	13.88474	0	16.9633	13.47704	14.31402	0	12.24491	0	13.65569	0	13.12866	0	0	0	13.78321	15.19302	0	13.5109	0	12.96309	14.46863	12.66229	15.42771	0	14.44483	13.74403
I3J2X3	I3J2X3_ORENI	mcts1		Malignant T-cell-amplified sequence	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; RNA binding [GO:0003723]	RNA binding [GO:0003723]	ADTVVAIMAEGK	6.28000021	1220.307198	12.61726	9.476499	11.69501	12.45355	0	13.14039	0	13.81629	0	0	12.4292	14.12359	7.080063	13.71377	13.8572	0	11.16397	15.18783	14.9799	9.418659	12.74756	11.24918	14.86771	0	10.55045	17.08018	13.54501	0	11.8254	13.75334	0	0	14.23833	14.67639	0	13.41095	0	8.754704	0	11.31177	14.24368	0	0	0	0	0	13.47256	0	12.82213	0	0	0	14.15478	0
I3JEC6	I3JEC6_ORENI	maml2	Notch signaling pathway [GO:0007219]; positive regulation of transcription by RNA polymerase II [GO:0045944]	MamL-1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nuclear speck [GO:0016607]	nuclear speck [GO:0016607]; transcription coactivator activity [GO:0003713]; Notch signaling pathway [GO:0007219]; positive regulation of transcription by RNA polymerase II [GO:0045944]	transcription coactivator activity [GO:0003713]	EPCEIQSCDQSNAEMMFDFK	4.829999924	2480.91417	16.90199	0	0	13.76304	11.699	13.69381	10.89705	13.10069	0	13.04597	12.26576	12.16278	13.77344	13.38211	0	14.25954	16.75506	0	0	0	0	0	0	0	15.99543	0	14.60543	0	0	0	0	0	0	16.55133	0	0	0	0	0	0	0	0	0	0	14.05378	0	0	0	0	0	15.76329	0	0	0
I3KKW9	I3KKW9_ORENI		cranial skeletal system development [GO:1904888]; heart development [GO:0007507]; neural crest cell migration [GO:0001755]	Mannan-binding lectin serine peptidase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; extracellular space [GO:0005615]	cytoplasm [GO:0005737]; extracellular space [GO:0005615]; calcium ion binding [GO:0005509]; serine-type endopeptidase activity [GO:0004252]; cranial skeletal system development [GO:1904888]; heart development [GO:0007507]; neural crest cell migration [GO:0001755]	calcium ion binding [GO:0005509]; serine-type endopeptidase activity [GO:0004252]	SSEPGFFPWQVLLSVEDLSR	14.94999981	2292.032381	0	11.9787	10.31022	12.20486	10.81118	13.37834	12.27106	0	12.95732	15.03439	13.44158	0	0	14.68346	14.05072	14.72154	0	10.05753	0	0	0	18.25547	4.664628	12.61934	0	0	13.88922	0	0	0	0	0	0	0	0	0	0	0	0	17.64918	0	10.44069	0	0	0	0	13.28662	12.22239	14.51985	0	0	0	0	12.90177
I3JRP8	I3JRP8_ORENI		endocytosis [GO:0006897]	"Mannose receptor, C type 1b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; endocytosis [GO:0006897]		FDSSEKR	7.670000076	869.1265083	14.11364	0	12.43515	13.03479	12.59648	13.16982	12.98744	12.35519	0	13.8214	12.14533	0	0	13.81423	13.5881	13.64389	15.62294	0	12.75881	13.27113	12.88786	0	8.972388	0	0	0	0	12.7889	0	0	0	0	0	14.04529	0	0	0	14.78408	15.11374	0	0	0	14.06637	15.62101	0	0	0	13.68149	0	0	0	0	0	0
I3JG52	I3JG52_ORENI	engase	metabolic process [GO:0008152]	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase (EC 3.2.1.96)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]	cytosol [GO:0005829]; mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity [GO:0033925]; metabolic process [GO:0008152]	mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity [GO:0033925]	EPPLDR	1.919999957	725.597546	14.6946	14.02217	13.70104	14.64748	14.59858	14.12896	0	13.61121	12.91319	0	15.02927	0	12.73057	12.70459	15.54661	13.87813	13.58923	13.95848	14.69086	0	0	0	14.56974	0	13.51904	15.11572	14.54823	0	0	0	21.6296	21.28862	20.58387	15.30454	15.75179	0	14.62887	15.10083	13.58801	0	0	0	0	0	0	14.08924	15.18323	13.31159	16.10593	0	0	13.58772	0	0
I3KVD4	I3KVD4_ORENI		cell cycle [GO:0007049]	Marker of proliferation Ki-67	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; cell cycle [GO:0007049]		SAQQSSK	16.56999969	735.5150042	15.9139	16.55868	15.1027	15.31249	16.47567	16.70027	16.37737	16.71261	16.40103	17.94057	16.34184	16.65166	17.29351	15.26743	15.99779	19.39724	19.54398	19.87136	18.04667	14.80854	17.24401	19.37878	19.84808	20.19345	17.3598	17.15872	16.08641	21.59458	21.29408	21.15929	18.44363	17.22173	18.1399	17.97976	16.25438	15.88802	17.11149	14.42128	17.47458	19.66017	19.78819	19.29195	17.72648	15.43974	18.14455	18.09653	18.36901	17.30717	16.9965	18.1359	16.97106	18.60951	17.90258	17.78926
A0A669DVI0	A0A669DVI0_ORENI	melk		Maternal embryonic leucine zipper kinase (EC 2.7.11.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	GGDDSSK	9.640000343	664.4748389	14.33085	15.98278	15.90137	15.68824	16.67232	16.23976	12.77508	13.5182	15.03094	16.01218	14.36108	13.92144	16.3494	15.15214	15.00549	17.2438	17.19925	15.48873	15.53035	14.87637	15.621	14.959	14.57762	16.62483	14.27846	15.03747	14.5288	13.43272	17.99708	18.72956	18.26875	19.47299	18.8482	17.77399	14.93707	14.46381	13.91835	14.59445	14.93269	14.92665	14.157	10.61444	13.55683	13.97631	14.50364	14.08681	13.23772	15.21814	11.7097	15.79081	15.26558	0	13.38033	14.13167
I3J1V3	I3J1V3_ORENI		cartilage development [GO:0051216]	Matrilin 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	collagen-containing extracellular matrix [GO:0062023]	collagen-containing extracellular matrix [GO:0062023]; calcium ion binding [GO:0005509]; extracellular matrix structural constituent [GO:0005201]; cartilage development [GO:0051216]	calcium ion binding [GO:0005509]; extracellular matrix structural constituent [GO:0005201]	AGLIKAVTK	12.44999981	900.4783262	0	14.17989	16.46657	13.95923	0	0	0	0	12.57862	0	13.82812	0	0	0	0	13.72645	0	0	14.31187	16.65072	16.15995	0	14.43543	12.54968	0	14.25481	0	14.60458	0	0	17.27955	13.29993	0	0	0	12.36697	13.65492	0	0	0	9.143329	0	0	15.48823	17.20325	10.23497	0	13.54799	0	17.49822	14.13104	0	0	14.10713
I3JCZ2	I3JCZ2_ORENI			Matrilin 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]	calcium ion binding [GO:0005509]	CPVAANATEKR	5.840000153	1215.769624	13.43371	15.26723	15.00697	13.75038	0	15.1553	15.73191	16.20553	15.56843	16.67381	17.39186	0	0	16.68352	0	12.30232	11.54353	14.90738	13.29878	12.3365	14.80006	15.47058	14.07674	14.29544	0	0	14.95641	14.75787	13.74906	14.65108	16.32399	16.01053	18.44213	13.32151	0	0	15.79042	15.1271	0	14.09796	0	12.84508	0	0	0	14.44095	0	13.73554	0	15.69527	11.43991	0	13.28608	16.47646
A0A669EIH8	A0A669EIH8_ORENI	LOC100710086		Matrin-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	KATENDSSR	2.569999933	1006.524382	13.00894	14.99294	15.2226	10.84782	13.72225	12.68685	13.47224	12.02913	12.30258	0	12.45255	14.63658	14.6448	4.998789	13.67554	13.60446	0	13.85144	14.31203	0	11.33245	15.77912	12.54885	15.18675	14.95558	8.596334	0	13.83159	0	0	14.56154	14.56246	14.11062	0	13.27234	13.17378	13.07679	0	13.17628	13.13237	13.98154	13.66549	14.90908	7.074209	0	0	14.02914	9.97904	13.01114	15.13053	0	0	14.66315	18.73518
A0A669CH30	A0A669CH30_ORENI			Matrix metalloproteinase-14 (EC 3.4.24.80)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular matrix [GO:0031012]; integral component of plasma membrane [GO:0005887]; melanosome [GO:0042470]	extracellular matrix [GO:0031012]; integral component of plasma membrane [GO:0005887]; melanosome [GO:0042470]; metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	AMQSAVAAMQR	9.340000153	1194.514561	11.52284	11.3063	10.75372	0	0	0	10.97269	0	14.10881	0	13.55232	14.76892	0	0	11.47387	0	0	0	0	0	0	0	0	0	0	0	0	0	17.79098	12.24589	0	14.71282	14.24022	5.602815	0	12.7643	10.93849	10.46086	11.78454	0	0	11.18242	0	0	11.81206	13.6312	0	12.29511	0	0	14.29017	0	0	0
I3KT70	I3KT70_ORENI	LOC100697129	cell adhesion [GO:0007155]	Matrix remodeling-associated protein 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; cell adhesion [GO:0007155]		AYPDYAMER	2.940000057	1132.008355	0	0	0	13.81928	12.3254	10.03457	16.26583	14.51191	0	17.40827	12.39369	11.78049	13.70659	0	14.24066	11.97163	13.39054	12.66047	12.94421	0	13.14176	14.32786	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.69399	0	0	0	0	0	0	0	0	0	0	0	0
I3JK66	I3JK66_ORENI			Matrix-remodelling associated 5a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		AAPSPPKIQNK	21.43000031	1149.594281	13.45646	12.02197	0	14.76232	14.80491	0	0	0	17.61611	15.01159	0	0	10.3755	0	0	0	0	12.88594	0	15.02026	14.00233	0	0	0	0	0	0	11.94578	0	0	0	12.62929	0	0	12.78305	0	17.31587	0	18.63479	0	15.43272	0	14.44714	14.24572	0	0	0	13.27369	20.0538	0	19.369	0	15.00964	18.34679
A0A669CUE3	A0A669CUE3_ORENI		regulation of transcription by RNA polymerase II [GO:0006357]	Med12 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mediator complex [GO:0016592]	mediator complex [GO:0016592]; beta-catenin binding [GO:0008013]; transcription coregulator activity [GO:0003712]; regulation of transcription by RNA polymerase II [GO:0006357]	beta-catenin binding [GO:0008013]; transcription coregulator activity [GO:0003712]	QLLPLPK	16.87999916	808.7200443	16.94436	0	16.64408	17.06697	16.25311	0	15.75789	0	0	15.72846	14.88239	0	0	16.35823	15.62244	15.52765	16.12659	16.39224	15.68929	15.46964	15.6576	0	0	14.2752	16.99347	16.65995	15.387	16.07363	15.06587	0	12.39463	15.46531	0	0	16.33507	15.54699	15.34262	16.59822	15.97921	16.38584	16.09358	15.94609	15.03841	16.4626	16.24273	16.24869	13.95134	15.49466	13.97516	14.83726	14.80308	14.20235	16.49288	14.50451
A0A669B9N4	A0A669B9N4_ORENI			Mediator complex subunit 23 (Mediator of RNA polymerase II transcription subunit 23)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		FLELLPVSK	6.730000019	1039.740377	14.95016	14.21492	15.43382	16.27986	0	14.55839	16.10189	15.0505	16.16122	0	15.84404	15.16033	0	17.71244	17.77461	14.99668	15.53773	17.5584	15.96389	15.70421	15.22004	15.03639	0	0	16.32635	15.87374	0	0	16.36037	0	0	0	16.88311	14.75902	15.92338	14.70631	15.32011	16.13916	16.0805	16.39855	0	15.88693	15.38665	15.49567	13.69347	0	15.81514	0	16.03421	0	15.35243	0	0	0
I3K7F9	I3K7F9_ORENI	LOC100707994		Mediator complex subunit 30 (Mediator of RNA polymerase II transcription subunit 30)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		VLMDQMR	9.630000114	909.1066454	13.5477	13.1703	11.3685	15.48064	16.90432	0	15.79659	14.22843	15.35574	0	0	15.82201	0	0	0	0	0	0	16.20323	0	0	0	15.52617	15.62778	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.3195	0	0	0	0	0	0	0	0	0	0	0	0
A0A669E9Z0	A0A669E9Z0_ORENI			Mediator of DNA damage checkpoint 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]	chromosome [GO:0005694]		ITPVETRPLTTK	10.38000011	1355.101507	0	11.48789	0	0	0	0	0	0	16.86102	4.284896	0	0	12.22625	0	4.73631	12.92765	0	11.79918	11.3246	12.74951	0	0	12.53928	10.66382	11.59098	0	11.90006	10.19745	0	0	0	0	0	13.95263	12.8862	0	0	0	0	13.60712	12.35693	12.78617	0	0	11.35008	0	7.380183	0	0	0	0	0	12.07623	12.80142
A0A669BV18	A0A669BV18_ORENI	med1	regulation of transcription by RNA polymerase II [GO:0006357]	Mediator of RNA polymerase II transcription subunit 1 (Mediator complex subunit 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mediator complex [GO:0016592]	mediator complex [GO:0016592]; transcription coregulator activity [GO:0003712]; regulation of transcription by RNA polymerase II [GO:0006357]	transcription coregulator activity [GO:0003712]	GGTMAAGPGVSMQSCSPAR	8.18999958	1836.762992	12.84679	11.78765	15.01244	14.16619	0	0	14.30465	0	19.02213	0	15.43666	14.96576	15.1979	13.52865	0	14.82945	13.91015	14.56625	14.49388	14.76976	13.44095	12.32727	14.962	14.28411	11.4654	12.74078	15.6223	16.21115	0	0	15.4277	16.93202	14.59154	0	12.40866	14.12587	10.83625	11.16544	14.67715	0	15.82386	11.57458	14.06957	10.76108	13.75753	15.3023	14.07373	10.14662	0	0	15.50765	0	15.19875	11.9779
A0A669F122	A0A669F122_ORENI	med11 MED11	regulation of transcription by RNA polymerase II [GO:0006357]	Mediator of RNA polymerase II transcription subunit 11 (Mediator complex subunit 11)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mediator complex [GO:0016592]	mediator complex [GO:0016592]; transcription coregulator activity [GO:0003712]; regulation of transcription by RNA polymerase II [GO:0006357]	transcription coregulator activity [GO:0003712]	KDCQMALNR	11.47999954	1135.656602	12.13428	0	14.33403	6.659452	14.68722	13.62421	0	13.27855	11.20928	11.95232	14.03732	12.61585	18.62113	0	0	12.30487	9.277713	13.12896	0	11.13485	17.50935	11.62581	0	14.44871	18.19439	9.767476	13.51583	0	0	13.94648	0	0	0	14.29233	13.6396	13.05694	14.08442	0	10.13364	11.23185	14.23672	17.50702	13.65976	13.16874	0	0	13.52714	12.93213	0	14.27218	0	13.39797	12.54592	14.58866
A0A669F736	A0A669F736_ORENI	med17 MED17	regulation of transcription by RNA polymerase II [GO:0006357]	Mediator of RNA polymerase II transcription subunit 17 (Mediator complex subunit 17)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mediator complex [GO:0016592]	mediator complex [GO:0016592]; transcription coregulator activity [GO:0003712]; regulation of transcription by RNA polymerase II [GO:0006357]	transcription coregulator activity [GO:0003712]	EVHWSKMEGR	4.019999981	1275.044043	0	0	13.99857	6.580399	0	0	0	0	0	9.192727	12.11098	0	12.70314	0	13.04916	14.31201	0	0	12.67782	13.05453	6.281903	12.8055	10.50476	12.01881	11.38102	0	10.59092	11.50165	11.78516	0	0	0	0	10.03156	13.84122	13.46958	13.04392	0	0	15.7462	0	0	0	0	0	0	13.84227	0	0	0	8.812194	12.21962	0	12.53336
A0A669ECS2	A0A669ECS2_ORENI	med6	regulation of transcription by RNA polymerase II [GO:0006357]	Mediator of RNA polymerase II transcription subunit 6 (Mediator complex subunit 6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mediator complex [GO:0016592]	mediator complex [GO:0016592]; transcription coregulator activity [GO:0003712]; regulation of transcription by RNA polymerase II [GO:0006357]	transcription coregulator activity [GO:0003712]	AKPKTK	2.5	671.9039721	13.47336	14.20956	15.3489	15.03078	15.14445	14.66753	15.51666	14.27116	14.20842	17.18213	0	16.33604	12.78827	10.91325	13.89221	9.740762	14.04781	11.16622	14.16779	15.97583	14.39307	14.553	0	15.64274	13.37274	10.86726	13.32794	14.29209	11.90965	0	0	18.89841	0	16.30586	15.54072	14.4205	14.31461	13.05492	14.06912	13.89727	12.15993	14.17128	14.43599	12.46628	14.89574	13.63956	13.71803	14.31365	14.63033	14.60351	13.98894	14.70093	14.85612	16.19098
I3IV61	I3IV61_ORENI	sfr1	double-strand break repair via homologous recombination [GO:0000724]	Meiosis protein 5 homolog (Swi5-dependent recombination DNA repair protein 1 homolog)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Swi5-Sfr1 complex [GO:0032798]	Swi5-Sfr1 complex [GO:0032798]; nuclear receptor coactivator activity [GO:0030374]; double-strand break repair via homologous recombination [GO:0000724]	nuclear receptor coactivator activity [GO:0030374]	SFISPLSVAK	3.619999886	1047.340681	14.09387	14.47803	0	15.49604	11.60326	15.73123	19.99079	0	12.13331	14.15404	14.49942	14.29184	12.64923	0	16.13841	13.5176	13.85079	15.20784	13.54007	0	15.21501	13.49923	14.11851	14.20453	13.78921	13.93941	14.08975	14.65624	15.69329	13.41895	20.41844	15.86906	14.23361	18.92886	12.70553	12.2599	0	13.4615	13.85479	17.80115	17.35427	6.945275	0	15.00476	10.05367	14.87611	13.45418	13.77645	15.42912	15.72989	16.49524	0	12.30631	13.70769
A0A669EDE8	A0A669EDE8_ORENI			Meiosis-specific nuclear structural protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		QRLMMQQTFQEQLAFK	1.710000038	2042.417969	0	0	0	12.62477	0	11.70865	0	0	12.46103	14.05924	0	15.02438	0	13.15889	10.77826	13.24907	11.80349	12.52958	15.2664	14.71775	0	0	0	0	14.29327	12.30597	0	11.39664	12.14088	13.45664	15.24679	14.94114	14.15408	15.45863	13.1627	11.1047	12.96615	11.33432	0	0	0	13.35601	12.63489	0	11.64726	0	12.63239	11.55772	11.6796	15.2322	0	13.00615	15.1943	12.72602
I3KZ13	I3KZ13_ORENI	LOC100708685	chemical synaptic transmission [GO:0007268]; neuropeptide signaling pathway [GO:0007218]	Melanin-concentrating hormone	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	synapse [GO:0045202]	synapse [GO:0045202]; melanin-concentrating hormone activity [GO:0030354]; chemical synaptic transmission [GO:0007268]; neuropeptide signaling pathway [GO:0007218]	melanin-concentrating hormone activity [GO:0030354]	VYRPCWEV	3.549999952	1108.217749	10.87421	12.39385	11.16571	0	12.49034	13.00105	12.56407	13.16539	0	0	0	0	12.43633	11.09024	14.35917	14.61481	0	0	12.3424	14.92333	14.88096	0	13.53874	14.43693	0	0	15.14415	9.508858	0	16.95129	0	11.45635	0	0	15.63207	0	0	13.61403	0	0	14.47086	0	0	0	0	12.68728	14.50096	10.11775	13.5038	14.10535	12.59694	0	15.05405	13.02613
I3KKZ0	I3KKZ0_ORENI			"Membrane associated guanylate kinase, WW and PDZ domain containing 1a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell junction [GO:0030054]; membrane [GO:0016020]	cell junction [GO:0030054]; membrane [GO:0016020]		KTVCTDAMGR	11.13000011	1138.340485	11.62898	11.05231	12.86378	13.76159	0	15.84122	0	11.67409	0	11.92927	0	0	0	0	14.46894	0	0	0	0	0	0	0	0	0	0	13.36122	0	0	0	0	0	0	0	13.99382	0	13.73702	14.59335	0	14.47582	0	0	0	0	0	0	0	0	0	0	0	0	0	16.56929	0
I3KIK6	I3KIK6_ORENI	MAGI3	regulation of JNK cascade [GO:0046328]; signal transduction [GO:0007165]	"Membrane-associated guanylate kinase inverted 3 (Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	bicellular tight junction [GO:0005923]; plasma membrane [GO:0005886]	bicellular tight junction [GO:0005923]; plasma membrane [GO:0005886]; molecular adaptor activity [GO:0060090]; regulation of JNK cascade [GO:0046328]; signal transduction [GO:0007165]	molecular adaptor activity [GO:0060090]	VGDRISAVNGR	3.869999886	1144.354795	14.91744	0	15.27908	0	12.57307	15.2091	13.04487	10.56812	13.30666	14.78769	0	0	16.59058	0	0	0	0	11.65086	0	13.56376	12.52875	11.4671	15.47018	15.27103	14.5431	13.245	0	13.10115	13.584	0	14.40926	17.14806	16.07054	13.54715	15.27285	11.97946	15.00029	14.45897	13.75779	15.01002	13.09694	12.07949	15.48005	13.32437	11.34025	15.70318	13.33249	13.68165	0	12.61828	0	0	0	0
A0A669E8V3	A0A669E8V3_ORENI			Membrane-associated ring finger (C3HC4) 7	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		KDNSTFR	1.710000038	868.2547259	13.60147	13.58557	0	0	12.08251	12.90655	14.39711	15.71095	12.92898	0	15.0601	16.41789	10.92949	13.46577	12.62515	13.7706	0	11.42516	0	11.93364	14.20268	15.15933	10.58398	13.57701	12.82876	14.90361	13.5923	14.79738	0	15.71141	0	13.3782	11.52562	14.96121	13.19813	13.1025	11.50612	13.85346	0	0	11.57459	0	14.92024	14.77658	0	14.65286	15.65923	13.15471	14.58805	12.95031	0	14.16669	14.28682	14.01144
A0A669E7E1	A0A669E7E1_ORENI	LOC100706095		Metabotropic glutamate receptor 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; G protein-coupled receptor activity [GO:0004930]	G protein-coupled receptor activity [GO:0004930]	DLAMDK	10.93000031	708.4549799	15.09862	15.26593	14.76704	0	0	15.24706	0	13.58992	15.48253	15.89059	15.82634	13.46714	14.08438	15.21267	14.88989	15.82818	13.774	14.39298	12.98079	14.06717	15.30916	17.44122	13.5158	12.31544	13.21698	14.01307	10.00997	17.57488	17.13514	17.21727	17.47456	19.59181	18.91914	15.12896	14.99522	16.02065	15.28446	15.09667	15.04801	16.04605	0	16.02645	14.48855	14.91464	14.90105	14.5916	15.19567	14.96506	12.7343	10.99815	16.84116	17.70807	15.9745	13.21361
I3JWN2	I3JWN2_ORENI			Metal response element binding transcription factor 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	ALSAIRLDMK	8.75	1117.770769	0	16.11957	0	12.75538	15.15035	0	17.15196	0	14.05019	14.86574	14.2139	14.9448	14.0548	0	0	12.74924	0	17.6311	0	14.22271	0	0	15.51311	0	14.58402	14.62187	14.15075	14.1381	10.32862	0	14.55918	14.23039	0	0	0	9.507488	0	0	13.70858	0	14.04115	0	14.2274	0	0	0	0	0	0	0	17.47624	0	0	17.21866
I3IVW4	I3IVW4_ORENI	mblac1		Metallo-beta-lactamase domain-containing protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DLSMNAAVHEVSR	4.03000021	1428.787296	14.60328	13.91418	0	15.20574	14.18336	0	13.39397	12.74111	16.35284	16.40855	0	14.10786	0	0	0	12.43104	0	16.41055	16.04774	15.54669	14.9951	15.5285	13.76908	17.33838	17.13795	16.91134	15.60586	16.53935	16.00067	15.75312	0	0	15.10267	14.62527	0	15.22055	13.64344	15.48265	14.90061	15.99836	15.15658	0	14.6301	15.90693	16.69512	0	16.28902	0	15.77172	0	14.98377	17.17247	0	18.28766
A0A669CLF6	A0A669CLF6_ORENI	tll1		Metalloendopeptidase (EC 3.4.24.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]; metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	calcium ion binding [GO:0005509]; metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	DKDECSK	9.81000042	881.726421	11.77775	11.53834	14.0112	15.15759	0	12.22272	0	13.59908	0	0	10.04705	15.77296	13.73351	14.29716	12.95534	0	13.65127	0	0	0	0	0	0	0	15.95829	0	14.50507	0	0	0	13.28545	0	0	0	0	0	0	0	15.76222	0	0	0	0	0	0	0	0	0	0	15.11041	0	17.73562	0	0
I3JUK1	I3JUK1_ORENI	TIMP3		Metalloproteinase inhibitor 3 (Tissue inhibitor of metalloproteinases 3)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; metalloendopeptidase inhibitor activity [GO:0008191]	metalloendopeptidase inhibitor activity [GO:0008191]	VQHVQHIYTDASESLCGVK	6.03000021	2171.500376	12.13082	11.71776	0	0	14.22892	13.50567	0	10.88579	0	14.04855	12.16993	0	14.40313	16.57663	17.52879	0	14.37175	20.53656	0	12.73787	16.27622	17.65892	0	19.91666	0	0	12.41624	19.59777	0	0	0	0	0	0	12.80053	0	14.20008	0	13.94263	0	12.85428	16.8988	0	14.28903	11.10061	0	0	0	17.76965	0	13.44298	0	13.87712	0
I3KA82	I3KA82_ORENI	timp4		Metalloproteinase inhibitor 4 (Tissue inhibitor of metalloproteinases 4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; metal ion binding [GO:0046872]; metalloendopeptidase inhibitor activity [GO:0008191]	metal ion binding [GO:0046872]; metalloendopeptidase inhibitor activity [GO:0008191]	KNLNYR	19.04000092	806.8002886	15.98247	16.54729	14.29397	15.81602	16.24621	15.6088	0	14.38773	15.05521	15.35982	0	15.75121	14.78083	13.96836	14.73904	14.71802	13.34324	14.93472	15.42668	0	14.59055	0	13.64815	11.87006	14.40254	0	0	13.06299	0	14.56491	15.16938	15.02613	0	15.14605	0	16.06403	14.34228	15.62916	15.42603	15.41651	12.47607	13.47161	13.82633	14.79506	16.11489	15.78971	15.32175	15.02105	13.54975	0	0	0	15.35607	0
I3IX87	I3IX87_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	Metastasis associated 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; chromatin binding [GO:0003682]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	chromatin binding [GO:0003682]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	AAAVLTQLR	2.150000095	942.4945949	13.39714	14.24276	13.8246	0	0	14.5824	14.68471	0	14.06008	15.41896	15.61018	15.88544	13.57737	12.90348	0	17.43623	0	0	0	0	17.30774	0	0	0	16.49643	0	14.71479	14.97439	15.35759	13.95471	0	15.2024	15.84701	0	15.04117	15.16218	13.63849	14.71445	16.07538	16.28234	0	16.28205	0	14.92788	13.78222	14.49603	14.30288	14.4931	0	0	18.74145	17.34271	16.23922	0
A0A669ELQ2	A0A669ELQ2_ORENI		cell adhesion [GO:0007155]	Metavinculin (Vinculin)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	actin cytoskeleton [GO:0015629]; adherens junction [GO:0005912]; cytoplasm [GO:0005737]; sarcolemma [GO:0042383]	actin cytoskeleton [GO:0015629]; adherens junction [GO:0005912]; cytoplasm [GO:0005737]; sarcolemma [GO:0042383]; actin filament binding [GO:0051015]; structural molecule activity [GO:0005198]; cell adhesion [GO:0007155]	actin filament binding [GO:0051015]; structural molecule activity [GO:0005198]	SVGEIAAMTAK	4.25	1094.384736	15.65471	0	15.33478	17.46389	0	0	0	0	0	11.8818	15.50859	0	0	0	16.02883	0	14.71135	17.68165	0	15.1975	0	15.45849	16.73657	0	0	0	0	0	13.7155	13.0904	0	0	15.50922	14.93898	0	0	0	15.20969	14.14539	0	0	0	0	11.86627	11.87833	14.21604	0	0	0	0	15.17575	0	16.62311	0
A0A669D734	A0A669D734_ORENI			Methanethiol oxidase (EC 1.8.3.4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		methanethiol oxidase activity [GO:0018549]; selenium binding [GO:0008430]	methanethiol oxidase activity [GO:0018549]; selenium binding [GO:0008430]	EPDGPVLAHELR	2.819999933	1332.524275	0	0	13.43917	0	0	0	0	0	12.45425	0	13.77746	0	0	15.77973	0	8.209135	0	0	12.19871	7.992707	0	13.07963	0	14.04432	17.83572	0	12.60738	9.269857	0	9.374628	18.80187	18.2141	19.05966	0	0	0	9.587481	13.16447	0	0	0	0	0	0	12.90254	0	13.8073	0	14.04245	0	0	13.88539	0	13.66125
I3K9W5	I3K9W5_ORENI	LOC100709995	one-carbon metabolic process [GO:0006730]	Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		methenyltetrahydrofolate cyclohydrolase activity [GO:0004477]; methylenetetrahydrofolate dehydrogenase (NADP+) activity [GO:0004488]; one-carbon metabolic process [GO:0006730]	methenyltetrahydrofolate cyclohydrolase activity [GO:0004477]; methylenetetrahydrofolate dehydrogenase (NADP+) activity [GO:0004488]	NTVTAARNALMH	19.54000092	1312.214972	14.66356	6.249685	13.57578	9.807034	12.57326	13.21177	0	12.59836	0	0	0	11.73259	12.09472	12.13952	13.3821	0	12.84188	0	11.64773	0	13.98907	11.8146	0	12.54777	14.54821	19.01057	0	0	11.9507	0	0	0	0	0	0	0	0	0	13.35979	0	12.58363	0	11.5328	0	0	0	0	0	0	0	0	0	11.9463	9.027684
A0A669DMY8	A0A669DMY8_ORENI		one-carbon metabolic process [GO:0006730]; S-adenosylmethionine biosynthetic process [GO:0006556]	Methionine adenosyltransferase 2 subunit beta (Methionine adenosyltransferase II beta)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		one-carbon metabolic process [GO:0006730]; S-adenosylmethionine biosynthetic process [GO:0006556]		LGLINKMVAR	7.239999771	1115.011564	17.09846	13.57986	13.76784	0	0	14.62821	12.26519	14.04628	0	13.53086	0	18.56516	15.34179	19.46319	15.21549	13.51495	14.61505	12.55416	14.89389	0	0	19.47052	4.505719	17.16001	15.59329	17.41141	19.28635	11.40241	13.98281	14.29523	11.26557	0	14.73054	13.03486	13.87821	0	13.24684	10.58161	12.75205	0	14.31916	10.66566	11.658	13.60646	18.55779	13.3329	0	12.75944	19.0802	20.70841	19.71842	12.47837	12.55369	10.27028
A0A669EYR4	A0A669EYR4_ORENI	mars2	methionyl-tRNA aminoacylation [GO:0006431]	Methionine--tRNA ligase (EC 6.1.1.10)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; methionine-tRNA ligase activity [GO:0004825]; methionyl-tRNA aminoacylation [GO:0006431]	ATP binding [GO:0005524]; methionine-tRNA ligase activity [GO:0004825]	LEPHNADK	7.239999771	923.0030163	0	16.49192	0	15.66025	16.79779	14.94397	0	0	14.9269	16.11089	0	15.85431	0	0	17.88251	16.34135	16.24013	17.1791	0	16.30478	0	14.52049	0	0	12.78549	11.90115	15.06006	15.50353	15.59125	14.27212	14.63148	0	14.73058	13.05308	0	16.22745	14.84551	16.54455	14.78891	0	16.45036	15.53383	0	15.82602	15.17702	0	0	15.95471	16.15403	0	16.07397	0	0	15.73513
A0A669DSP3	A0A669DSP3_ORENI	mars1	glutathione metabolic process [GO:0006749]; methionyl-tRNA aminoacylation [GO:0006431]	"Methionine--tRNA ligase, cytoplasmic (EC 6.1.1.10) (Methionyl-tRNA synthetase)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; methionine-tRNA ligase activity [GO:0004825]; glutathione metabolic process [GO:0006749]; methionyl-tRNA aminoacylation [GO:0006431]	ATP binding [GO:0005524]; methionine-tRNA ligase activity [GO:0004825]	DALKHILNISR	16.21999931	1280.430766	0	0	0	0	0	16.90044	16.63445	20.094	0	0	0	0	19.45161	12.98595	12.67595	17.71296	0	0	0	0	0	19.60985	0	0	13.19755	0	14.14328	0	0	10.6539	0	0	14.41714	0	13.8415	0	10.13769	0	0	0	0	0	12.91847	0	0	19.58858	12.16102	19.42338	0	0	0	18.50513	0	0
A0A669BFH9	A0A669BFH9_ORENI		5-methylcytosine catabolic process [GO:0006211]; DNA demethylation [GO:0080111]	Methylcytosine dioxygenase TET (EC 1.14.11.n2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; methylcytosine dioxygenase activity [GO:0070579]; zinc ion binding [GO:0008270]; 5-methylcytosine catabolic process [GO:0006211]; DNA demethylation [GO:0080111]	DNA binding [GO:0003677]; methylcytosine dioxygenase activity [GO:0070579]; zinc ion binding [GO:0008270]	KAWTLPR	24.67000008	869.7459596	0	21.17324	20.73062	0	19.48757	0	0	0	0	13.49696	0	0	20.7895	0	0	0	0	0	17.22176	0	0	0	0	0	0	0	0	0	0	0	0	0	15.9386	0	14.21296	0	0	0	13.4331	16.74693	0	13.79995	0	0	0	16.45428	0	12.2637	16.5287	15.26502	14.30443	0	0	0
I3JEZ5	I3JEZ5_ORENI	APIP apip	apoptotic process [GO:0006915]; L-methionine salvage from methylthioadenosine [GO:0019509]; L-methionine salvage from S-adenosylmethionine [GO:0019284]	Methylthioribulose-1-phosphate dehydratase (MTRu-1-P dehydratase) (EC 4.2.1.109) (APAF1-interacting protein homolog)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; methylthioribulose 1-phosphate dehydratase activity [GO:0046570]; zinc ion binding [GO:0008270]; apoptotic process [GO:0006915]; L-methionine salvage from methylthioadenosine [GO:0019509]; L-methionine salvage from S-adenosylmethionine [GO:0019284]	methylthioribulose 1-phosphate dehydratase activity [GO:0046570]; zinc ion binding [GO:0008270]	GTSGTNYR	9.590000153	854.0809674	15.1868	15.21634	12.84953	0	0	14.50563	19.24344	17.65716	17.00682	15.08139	16.22822	15.39958	14.67043	14.99019	0	0	0	0	0	15.52831	16.00575	0	13.38379	0	0	0	0	16.75626	0	0	0	0	16.99688	15.50245	0	15.89797	0	0	0	15.53687	0	0	0	14.85528	14.11383	0	0	0	0	0	16.19359	0	0	0
I3KSI7	I3KSI7_ORENI	METTL7A		Methyltransf_11 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		methyltransferase activity [GO:0008168]	methyltransferase activity [GO:0008168]	FADADGTLR	5.079999924	964.5713258	11.78232	13.70924	18.87017	0	20.11392	0	14.2835	14.35694	0	15.25999	3.098567	0	15.27286	13.59491	0	0	15.21689	0	16.36366	16.42489	0	14.55435	17.202	14.10064	0	15.53251	0	0	0	14.02035	0	0	14.7584	16.18345	0	0	0	0	17.50987	15.91369	17.16919	14.60758	15.73531	0	15.46603	0	15.60052	0	0	0	0	0	15.24014	14.1306
I3K761	I3K761_ORENI		"cholesterol biosynthetic process [GO:0006695]; isopentenyl diphosphate biosynthetic process, mevalonate pathway [GO:0019287]"	Mevalonate kinase (MK) (EC 2.7.1.36)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	"cytoplasm [GO:0005737]; ATP binding [GO:0005524]; mevalonate kinase activity [GO:0004496]; cholesterol biosynthetic process [GO:0006695]; isopentenyl diphosphate biosynthetic process, mevalonate pathway [GO:0019287]"	ATP binding [GO:0005524]; mevalonate kinase activity [GO:0004496]	MQVTDFYVSAPGK	4.059999943	1458.785413	0	0	14.12161	14.25771	0	0	0	0	0	0	13.38569	0	16.15981	0	0	10.74798	0	0	0	0	0	13.26541	0	14.32944	13.31619	0	15.63626	16.44239	0	0	20.60989	21.19437	14.729	0	0	0	0	15.86416	0	0	0	13.1056	14.21042	15.68128	0	0	14.57068	0	17.7761	17.68714	16.59225	0	0	0
A0A669BKQ8	A0A669BKQ8_ORENI			Microcephalin 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QVSLTLQKMVNK	2.910000086	1404.517147	14.86637	14.60739	0	14.8729	15.32452	0	15.04651	14.61261	0	0	14.88721	0	12.92474	0	0	0	0	11.50984	0	0	12.79461	0	0	14.81421	12.88552	11.31167	14.09603	8.493655	14.21974	13.81106	23.50217	21.28083	20.3951	14.94745	15.1255	0	14.52987	14.82312	0	0	0	0	0	0	0	0	0	0	0	14.41344	0	0	0	0
A0A669CT93	A0A669CT93_ORENI			Microtubule associated tumor suppressor 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		LTAKGLFR	19.10000038	905.7056024	15.63721	16.27746	16.76152	15.9564	15.87452	16.15126	16.08959	15.22587	15.79247	16.26562	16.22967	0	15.93355	17.24597	16.66067	16.92262	0	16.95758	0	16.4088	0	16.41009	14.62365	0	0	16.21977	0	16.4201	0	0	14.97352	18.14175	0	0	0	16.85879	16.38934	17.06316	16.53067	15.39462	15.82054	16.46432	17.11069	16.80954	15.30422	16.43504	16.56666	15.72087	17.08483	18.02795	0	0	0	0
A0A669DEE0	A0A669DEE0_ORENI		regulation of autophagy [GO:0010506]	Microtubule crosslinking factor 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]	extracellular space [GO:0005615]; regulation of autophagy [GO:0010506]		LLLLQPK	21.43000031	822.1875376	14.87248	0	0	0	0	17.09309	16.58871	0	18.38014	0	0	0	0	0	0	0	18.22014	0	0	0	0	0	17.14553	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18.58945	0	0	0	0	0	0	0	0	0
I3JZ87	I3JZ87_ORENI		microtubule cytoskeleton organization [GO:0000226]; neural plate development [GO:0001840]; neural tube development [GO:0021915]; regulation of microtubule depolymerization [GO:0031114]	Microtubule-associated protein 1B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	microtubule [GO:0005874]	microtubule [GO:0005874]; microtubule binding [GO:0008017]; microtubule cytoskeleton organization [GO:0000226]; neural plate development [GO:0001840]; neural tube development [GO:0021915]; regulation of microtubule depolymerization [GO:0031114]	microtubule binding [GO:0008017]	AGALPTASEER	3.819999933	1100.225786	15.70868	14.03098	15.62247	11.76793	0	12.10607	13.47491	15.47686	14.26471	11.41901	0	15.07066	0	16.32302	11.9501	0	0	0	16.40031	0	14.84963	0	0	15.4516	0	12.85581	15.75011	13.48364	16.09606	13.06012	13.04775	15.69396	14.26872	12.89496	14.05274	0	15.12571	10.63461	11.13345	15.29969	14.49851	12.47979	14.42399	14.22243	13.06422	18.45632	19.22944	16.28284	13.08362	16.00432	15.83914	15.51002	0	13.98408
I3JR34	I3JR34_ORENI		epiboly involved in gastrulation with mouth forming second [GO:0055113]; mitotic cytokinesis [GO:0000281]; spindle assembly [GO:0051225]	Microtubule-associated protein 9	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centrosome [GO:0005813]; microtubule [GO:0005874]; mitotic spindle [GO:0072686]	centrosome [GO:0005813]; microtubule [GO:0005874]; mitotic spindle [GO:0072686]; epiboly involved in gastrulation with mouth forming second [GO:0055113]; mitotic cytokinesis [GO:0000281]; spindle assembly [GO:0051225]		TEQEYGTLAYSK	13.68000031	1390.06905	17.87801	17.20223	17.004	16.25492	19.23524	0	0	0	0	20.07288	0	0	0	19.62829	0	19.41182	21.66698	17.31221	0	0	0	0	0	0	0	0	0	0	0	0	15.66038	0	0	15.74947	15.79742	0	14.34739	0	16.71377	0	15.93483	0	0	16.57892	0	14.94813	15.06123	14.5827	0	0	16.69048	0	0	0
A0A669F2W7	A0A669F2W7_ORENI	LOC100712406	microtubule cytoskeleton organization [GO:0000226]	Microtubule-associated protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; microtubule binding [GO:0008017]; microtubule cytoskeleton organization [GO:0000226]	microtubule binding [GO:0008017]	TPRPINAPTPDLK	2.380000114	1419.215648	12.64007	13.19754	13.63665	0	11.71409	16.2159	0	13.15061	14.26549	13.34027	14.01954	12.49269	13.09874	0	13.43857	0	10.25316	0	0	0	0	0	0	0	0	0	0	0	0	11.57864	20.60446	20.68074	0	0	0	0	15.24227	0	0	0	0	16.95885	0	0	0	0	0	0	0	0	0	0	0	0
I3KEX5	I3KEX5_ORENI			Milk fat globule-EGF factor 8 protein b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]	calcium ion binding [GO:0005509]	CHCPSPYVGK	4.199999809	1203.57576	14.2433	0	8.70837	8.840452	9.730497	9.353559	11.60612	0	12.26315	8.17531	9.235958	16.68916	11.86701	0	13.92281	13.23207	11.78558	0	12.23878	0	13.42994	13.39639	0	13.53445	13.4865	0	0	0	0	13.28406	18.62177	10.27837	0	0	0	0	0	0	0	10.83346	13.53725	0	16.96785	0	0	11.31927	11.25723	0	16.93024	0	0	0	0	0
I3KL46	I3KL46_ORENI	LOC100698114		Mimecan (Osteoglycin)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		growth factor activity [GO:0008083]	growth factor activity [GO:0008083]	TQGVKANAFK	4.570000172	1063.114448	0	0	14.5661	0	15.05385	11.54162	11.80154	0	0	13.16445	0	8.416083	13.8721	0	0	18.86621	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669EW19	A0A669EW19_ORENI	LOC100534553	cellular response to fatty acid [GO:0071398]; mitochondrial transmembrane transport [GO:1990542]	Mitochondrial brown fat uncoupling protein 1 (Solute carrier family 25 member 7) (Thermogenin)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; mitochondrial membrane [GO:0031966]	integral component of membrane [GO:0016021]; mitochondrial membrane [GO:0031966]; oxidative phosphorylation uncoupler activity [GO:0017077]; cellular response to fatty acid [GO:0071398]; mitochondrial transmembrane transport [GO:1990542]	oxidative phosphorylation uncoupler activity [GO:0017077]	AVGGIR	4.320000172	572.8573569	0	0	14.64716	14.60618	14.24519	0	0	16.15453	14.67845	16.11648	0	15.0943	15.41136	15.26945	10.45491	13.57843	15.54456	14.77106	12.50312	14.25869	13.6237	14.34119	14.85586	16.53846	15.48695	14.32937	14.03092	13.23142	15.32658	13.77544	16.69598	17.2957	17.60813	0	0	15.29511	0	12.54963	14.40934	0	13.93162	14.15991	0	14.33813	15.02526	14.65292	15.22001	15.06621	0	13.50648	0	15.23889	15.00017	16.02662
I3JS69	I3JS69_ORENI	fis1	lipid homeostasis [GO:0055088]; mitochondrial fission [GO:0000266]	Mitochondrial fission 1 protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; mitochondrial outer membrane [GO:0005741]	integral component of membrane [GO:0016021]; mitochondrial outer membrane [GO:0005741]; lipid homeostasis [GO:0055088]; mitochondrial fission [GO:0000266]		GAAKS	6.329999924	430.9531036	16.94193	16.63041	16.56022	16.98321	16.455	0	17.14108	0	0	16.4467	16.22552	16.2151	0	15.82576	15.95659	16.31525	15.95048	15.59257	15.86114	0	0	15.14004	16.7471	15.07714	0	15.7635	15.50829	16.46986	0	16.47722	16.04395	16.48207	14.73623	16.60882	0	0	17.23385	16.77221	16.25678	16.47425	0	16.50662	17.60921	16.41289	17.42999	16.45781	16.05949	0	15.70228	0	0	16.77146	15.73401	16.79738
A0A669C9X2	A0A669C9X2_ORENI	timm13	chaperone-mediated protein transport [GO:0072321]	Mitochondrial import inner membrane translocase subunit	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial inner membrane [GO:0005743]; mitochondrial intermembrane space [GO:0005758]	mitochondrial inner membrane [GO:0005743]; mitochondrial intermembrane space [GO:0005758]; chaperone-mediated protein transport [GO:0072321]		MDTGTIMEQVK	5.699999809	1267.571636	14.01295	13.07554	14.0261	13.61878	12.7478	0	0	10.9394	0	0	0	15.20541	0	12.97773	12.28262	0	12.64923	0	0	15.08955	0	0	0	0	0	0	0	0	0	0	17.57755	0	0	0	11.10687	0	0	0	0	0	0	0	12.75088	15.07507	0	9.431155	0	0	15.3805	15.02716	0	8.378811	0	0
I3JW74	I3JW74_ORENI	TIMM44	protein import into mitochondrial matrix [GO:0030150]	Mitochondrial import inner membrane translocase subunit TIM44	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial inner membrane [GO:0005743]	mitochondrial inner membrane [GO:0005743]; chaperone binding [GO:0051087]; protein import into mitochondrial matrix [GO:0030150]	chaperone binding [GO:0051087]	ASRALTDR	3.559999943	887.4860777	0	15.48047	15.83019	13.69312	14.48863	15.1885	14.29336	12.66821	15.23316	14.48766	15.33681	0	13.85943	15.13225	13.43083	16.24317	15.14725	16.07631	17.79172	0	0	0	0	0	0	16.23941	15.60637	0	0	0	0	16.91989	0	0	0	0	15.41583	15.50543	15.16692	15.70744	16.84062	15.31845	0	15.39362	0	16.24065	0	0	17.28424	16.59085	0	0	16.63828	17.66658
A0A669BPC1	A0A669BPC1_ORENI	LOC100693558	mitochondrial respiratory chain complex III assembly [GO:0034551]	Mitochondrial nucleoid factor 1 (Mitochondrial protein M19) (Ubiquinol-cytochrome-c reductase complex assembly factor 2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial nucleoid [GO:0042645]	mitochondrial nucleoid [GO:0042645]; mitochondrial respiratory chain complex III assembly [GO:0034551]		SATRYR	3.299999952	753.6896399	0	13.76143	0	13.61923	0	13.56951	12.16721	12.14694	8.855186	15.22267	14.51501	13.09397	14.94472	12.85074	16.13033	18.08453	11.11406	12.37142	13.80917	14.25046	16.30967	12.31342	16.50303	0	0	0	0	0	17.42101	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.10351	0	0	14.4441	15.0449	0	17.94333	0
I3J4Y0	I3J4Y0_ORENI	trmt10c		Mitochondrial ribonuclease P protein 1 (EC 2.1.1.218) (EC 2.1.1.221) (RNA (guanine-9-)-methyltransferase domain-containing protein 1) (mRNA methyladenosine-N(1)-methyltransferase) (tRNA (adenine(9)-N(1))-methyltransferase) (tRNA (guanine(9)-N(1))-methyltransferase) (tRNA methyltransferase 10 homolog C)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial nucleoid [GO:0042645]	mitochondrial nucleoid [GO:0042645]; tRNA (guanine(9)-N(1))-methyltransferase activity [GO:0052905]	tRNA (guanine(9)-N(1))-methyltransferase activity [GO:0052905]	EHRESGFTGR	5.920000076	1175.867623	0	14.65548	13.96511	18.2406	11.05031	5.094872	11.95883	11.96548	12.55807	12.91843	9.318102	0	8.332302	0	13.55541	12.87384	10.54517	0	12.86986	17.83335	10.23586	18.02737	18.89206	18.18082	10.94169	13.29929	0	13.40061	0	13.15065	14.4519	0	0	14.82424	0	0	14.13	11.90578	12.00868	12.83922	0	12.7309	0	14.83115	11.14302	0	0	13.99697	17.49164	0	0	0	13.60362	0
I3KY67	I3KY67_ORENI			Mitochondrial ribosomal protein S28	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DAVVVGR	10.06000042	715.4389768	15.94536	16.09764	16.26303	15.38902	14.78059	14.24508	13.77933	15.17655	14.17659	15.99911	16.78511	16.08109	15.10779	15.11518	16.27105	16.00628	13.84764	14.23142	16.71191	15.66916	15.93842	16.71431	14.92541	15.71442	15.61	15.58931	15.23267	15.40608	15.96552	13.95665	0	0	17.84019	17.13747	16.68565	15.79479	13.00564	15.37786	0	15.3842	15.46394	14.0519	12.2574	15.74794	16.22456	16.1134	15.80971	14.82178	15.87088	15.84912	15.57837	15.96965	15.81981	15.2465
I3KTG9	I3KTG9_ORENI			Mitogen-activated protein kinase 8 interacting protein 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; MAP-kinase scaffold activity [GO:0005078]	MAP-kinase scaffold activity [GO:0005078]	AKNYSDQITR	11.82999992	1194.462399	0	0	0	12.75331	0	0	0	15.19897	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22.45435	20.61012	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3K1A4	I3K1A4_ORENI	LOC100699484		Mitogen-activated protein kinase (EC 2.7.11.24)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; MAP kinase activity [GO:0004707]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ATP binding [GO:0005524]; MAP kinase activity [GO:0004707]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	LHALLKMCK	20.45999908	1128.931988	16.95395	0	16.68672	16.20945	17.12387	16.40329	0	0	16.71939	16.2544	0	17.24965	0	16.11204	16.4705	0	0	15.36399	16.29322	15.53247	15.80128	0	17.00896	0	16.34602	15.2628	0	0	0	13.89728	16.48686	12.37966	15.82612	14.39759	16.36751	16.6041	0	0	16.76116	15.97252	0	16.86066	0	15.41773	16.39652	15.06228	0	0	0	0	15.47827	0	15.89107	15.66833
I3KP91	I3KP91_ORENI			Mitogen-activated protein kinase kinase 7	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	IQGPIPER	7.869999886	910.5160599	14.0006	16.37329	15.63918	14.24625	15.34712	10.53976	12.50192	13.20671	17.31517	14.09338	12.35315	0	15.55042	15.00716	14.81112	14.98304	16.61615	15.27592	16.40559	14.56388	15.22711	16.64262	13.64989	13.6741	14.49879	12.88258	13.75349	0	16.06688	14.48496	13.33819	13.30017	15.67546	15.15599	13.34446	14.69095	9.268131	12.02141	14.60856	13.26807	12.69256	13.32247	13.35084	14.69765	14.36796	12.45353	15.94932	0	16.32974	13.73707	0	0	14.68745	11.72041
I3JH41	I3JH41_ORENI		MAPK cascade [GO:0000165]	Mitogen-activated protein kinase kinase kinase 15	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; metal ion binding [GO:0046872]; protein kinase activity [GO:0004672]; MAPK cascade [GO:0000165]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; protein kinase activity [GO:0004672]	VMAATISK	2.180000067	837.143529	15.61496	13.44908	13.41945	15.50838	15.4391	0	0	15.09993	0	0	16.9204	0	0	0	0	16.53436	0	0	16.93496	0	0	0	15.00657	16.33127	0	0	0	0	0	0	16.74939	16.43592	15.83323	0	0	0	0	0	17.09815	16.20339	16.87375	0	0	0	0	0	16.93603	16.98033	0	0	0	0	0	0
A0A669CG24	A0A669CG24_ORENI			Mitogen-activated protein kinase kinase kinase 7 (EC 2.7.11.25)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]; MAP kinase kinase kinase activity [GO:0004709]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]; MAP kinase kinase kinase activity [GO:0004709]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	TASFGTILDVPK	4.840000153	1248.142379	13.2792	15.37109	0	0	11.87543	13.45742	0	0	16.05334	13.19798	14.18478	0	0	0	0	11.30389	0	11.38229	0	0	13.27549	0	0	0	0	0	0	0	0	0	18.12722	0	15.41934	17.06939	0	0	0	0	14.9931	0	0	0	0	0	14.42431	0	0	14.70928	0	0	0	0	0	0
A0A669CSM1	A0A669CSM1_ORENI	MAP3K13	protein autophosphorylation [GO:0046777]	Mitogen-activated protein kinase kinase kinase (EC 2.7.11.25)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; MAP kinase kinase kinase activity [GO:0004709]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; protein autophosphorylation [GO:0046777]	ATP binding [GO:0005524]; MAP kinase kinase kinase activity [GO:0004709]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ILRPLRK	2.150000095	896.358564	13.27508	15.3091	14.78735	0	14.87621	16.31643	12.10468	11.99268	0	0	12.13321	15.67265	14.61002	0	12.50806	0	0	15.54964	16.62436	16.75655	12.17361	14.81252	15.68822	15.08075	0	14.27278	8.607428	15.01794	12.8918	0	13.78901	0	17.6233	12.86201	13.6966	0	12.73145	14.08672	14.03069	12.90263	0	13.87657	0	0	0	0	13.91215	0	15.0082	15.7067	15.85078	14.34563	0	14.07695
I3IXY4	I3IXY4_ORENI			Mitogen-activated protein kinase kinase kinase kinase 3 (EC 2.7.11.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; MAP kinase kinase kinase kinase activity [GO:0008349]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ATP binding [GO:0005524]; MAP kinase kinase kinase kinase activity [GO:0008349]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	MMGMGACFSKVFNGCPLK	5.230000019	2083.468284	12.93883	13.38197	0	12.85514	14.61453	12.5334	14.49031	15.05294	12.29361	6.162357	18.69508	12.51501	0	13.71585	0	9.274471	13.64673	12.83095	0	0	0	15.61578	11.55915	0	11.53409	12.26605	14.09092	0	0	8.459631	9.175078	0	14.74045	0	0	14.97501	14.11705	8.96885	13.06517	0	12.62168	12.15353	0	14.1059	13.81141	14.06146	12.89196	10.25511	0	0	14.20879	12.4129	0	13.05683
A0A669EQX6	A0A669EQX6_ORENI	map4k5		Mitogen-activated protein kinase kinase kinase kinase 5 (EC 2.7.11.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; MAP kinase kinase kinase kinase activity [GO:0008349]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ATP binding [GO:0005524]; MAP kinase kinase kinase kinase activity [GO:0008349]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ITATIAK	5.389999866	717.8383874	13.17835	14.24453	12.37984	11.31427	12.14642	14.17059	0	14.38181	0	14.96854	13.42559	0	14.30201	0	14.67561	0	0	0	13.16643	15.80711	13.74845	13.56214	13.84463	15.11927	13.31521	14.3163	12.84106	14.34956	0	14.37536	18.84899	0	17.55162	0	0	15.07685	0	0	0	13.95164	0	13.44645	0	0	0	13.75113	0	0	0	0	0	0	0	0
A0A669DES8	A0A669DES8_ORENI	LOC102081481		"Modulator of non-genomic activity of estrogen receptor (Proline-, glutamic acid- and leucine-rich protein 1)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]		MDSTNRK	11.18999958	851.2850554	15.14214	14.63867	13.33753	0	13.40016	12.57436	14.51737	15.16173	14.20959	14.26892	14.6441	11.90915	14.31074	13.77208	13.84756	14.45281	14.16856	12.59422	13.07321	14.52719	13.57297	0	14.20466	13.55068	14.73441	8.829898	15.22261	15.31275	11.9959	12.88773	17.1664	0	14.15353	15.24538	14.3937	14.13941	0	14.97721	14.40951	14.15475	0	0	0	0	0	0	0	0	0	0	0	0	0	14.18491
I3K6F8	I3K6F8_ORENI	LOC100698095	"regulation of transcription, DNA-templated [GO:0006355]; transforming growth factor beta receptor signaling pathway [GO:0007179]"	Mothers against decapentaplegic homolog (MAD homolog) (Mothers against DPP homolog) (SMAD family member)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	"cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; regulation of transcription, DNA-templated [GO:0006355]; transforming growth factor beta receptor signaling pathway [GO:0007179]"	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	GAMCVPEHR	4.829999924	1071.664099	14.25356	13.49866	14.71208	0	13.05669	0	16.55172	14.39303	14.25136	14.03091	13.59336	12.2184	0	0	16.33159	14.69536	0	0	14.0254	0	13.71725	0	0	15.72368	0	9.49176	15.82339	16.68358	0	0	0	16.66072	0	0	0	15.34517	0	0	0	13.37129	15.40623	0	13.85788	13.52915	0	0	18.87397	0	0	15.07881	13.62161	0	15.6017	0
G4V2C8	G4V2C8_ORENI	ABCC1		Multidrug-resistance associated protein 1 (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	FYVSSSR	5.650000095	844.9351905	0	0	13.74037	12.0822	0	15.27271	0	14.61049	0	14.08176	0	0	14.6064	11.27106	0	12.09413	0	0	16.00807	16.03217	13.97379	0	14.26223	14.86753	0	13.70889	0	14.52414	15.57404	13.98453	16.6719	15.39026	0	15.69494	0	15.57128	15.68216	0	0	0	0	11.6025	0	13.93809	0	0	0	13.98245	0	0	0	15.17314	0	0
A0A669DHV9	A0A669DHV9_ORENI			"Multiple C2 domains, transmembrane 1b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GHNLAVRDR	10.88000011	1037.51283	14.57275	0	0	11.04288	14.24692	0	13.2127	0	0	0	15.29684	14.91191	0	15.51448	0	0	0	14.09697	14.33935	0	15.43515	17.3278	16.22133	0	15.8833	18.24628	13.9892	14.2032	15.2478	18.66112	14.74557	0	15.39815	16.02409	0	19.02696	15.27979	15.32564	15.60797	14.37213	12.96598	13.20865	11.90494	0	0	14.41862	12.74487	14.42354	16.1788	14.48702	15.45332	18.71988	0	15.12647
A0A669BY95	A0A669BY95_ORENI	MPDZ		Multiple PDZ domain crumbs cell polarity complex component	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	bicellular tight junction [GO:0005923]	bicellular tight junction [GO:0005923]		SLVPNGVAEK	11.77000046	1011.722145	9.834944	14.56	13.62949	0	13.79676	12.52768	12.2244	0	15.75077	15.99535	17.50338	0	0	0	15.04027	8.133363	13.45562	13.07558	14.49717	14.13926	10.62044	0	11.65919	0	16.1041	12.0426	15.0022	0	15.16115	0	16.28203	12.10126	15.03752	0	13.40753	0	14.59707	11.22268	0	0	15.50159	13.80368	14.92401	0	0	0	13.76155	11.30326	10.94183	14.05895	15.22192	0	0	15.06697
B7SU43	B7SU43_ORENI			Muscarinic acetylcholine receptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of plasma membrane [GO:0005887]; postsynaptic membrane [GO:0045211]	integral component of plasma membrane [GO:0005887]; postsynaptic membrane [GO:0045211]; G protein-coupled acetylcholine receptor activity [GO:0016907]	G protein-coupled acetylcholine receptor activity [GO:0016907]	SCSSYELTR	7.670000076	1103.446817	11.52599	0	12.33498	0	4.994403	11.67631	0	0	10.48944	13.77348	0	17.28864	12.07685	18.06483	0	14.48144	13.39198	14.03786	13.31497	14.59678	14.63343	15.10431	13.52059	13.48068	16.19338	10.76741	16.27046	14.34763	17.5386	0	0	11.47699	0	0	16.14271	12.8577	14.44757	9.544311	12.86101	15.04008	12.33059	14.60371	0	11.38761	10.01632	0	14.5825	0	0	12.48034	15.18885	17.89941	14.05044	15.30205
A0A669DC37	A0A669DC37_ORENI			"Muskelin 1, intracellular mediator containing kelch motifs"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MGNILVDKPNDQSSR	17.78000069	1689.861504	15.10084	0	0	0	0	0	15.27079	16.36735	0	0	17.1575	0	0	0	15.33104	0	16.08361	0	0	13.93864	0	8.12094	11.79739	11.82709	0	0	13.26562	18.09237	0	0	16.5011	16.391	18.36203	19.39418	17.71596	17.83697	0	0	0	0	16.30289	0	0	0	0	0	15.55042	0	0	14.56201	0	0	0	0
I3KWD3	I3KWD3_ORENI		mismatch repair [GO:0006298]	MutL homolog 3 (E. coli)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mismatch repair complex [GO:0032300]; nucleus [GO:0005634]	mismatch repair complex [GO:0032300]; nucleus [GO:0005634]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; mismatched DNA binding [GO:0030983]; mismatch repair [GO:0006298]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]; mismatched DNA binding [GO:0030983]	MIKCLPK	10.38000011	889.5502181	16.0359	16.07141	0	0	14.3823	0	0	13.53671	13.74718	0	17.16251	12.15007	0	17.03119	17.07939	16.65612	0	12.86122	16.2949	16.68802	0	15.21266	12.77053	0	0	14.0765	11.50241	13.39334	16.83034	0	12.42626	12.37214	0	16.99782	16.30921	14.06014	0	13.97375	0	0	13.06729	0	0	0	0	12.6672	16.19489	14.06402	17.28068	0	0	0	0	16.58328
A0A669C0Y1	A0A669C0Y1_ORENI		mismatch repair [GO:0006298]	MutS homolog 3 (E. coli)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; mismatched DNA binding [GO:0030983]; mismatch repair [GO:0006298]	ATP binding [GO:0005524]; mismatched DNA binding [GO:0030983]	ASGANR	7.449999809	574.7825674	0	12.38679	0	0	15.00019	11.58948	16.38605	0	16.28139	14.93718	0	15.16943	15.46701	9.022917	12.72382	16.37769	17.14164	16.26919	0	14.34103	13.9595	14.14116	0	0	0	16.01934	16.35472	15.39185	0	0	12.60632	0	15.70236	15.42185	15.30821	0	13.89838	0	12.24927	0	16.9783	0	0	17.35582	0	0	15.3444	15.51407	0	0	0	0	0	0
I3IYP6	I3IYP6_ORENI		"notochord morphogenesis [GO:0048570]; regulation of transcription, DNA-templated [GO:0006355]"	Myb-like domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; notochord morphogenesis [GO:0048570]; regulation of transcription, DNA-templated [GO:0006355]"		ALQIGQDLSPTSVHELK	4.510000229	1836.415668	12.17536	12.72144	0	15.16088	14.57831	0	11.95464	0	13.95479	0	14.37664	0	15.05799	13.63146	0	0	0	14.22017	14.10162	0	16.20857	14.62211	16.45155	0	14.00511	0	0	16.36757	0	0	0	0	14.52305	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3K895	I3K895_ORENI	LOC100692985		Myelin basic protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	myelin sheath [GO:0043209]	myelin sheath [GO:0043209]; structural constituent of myelin sheath [GO:0019911]	structural constituent of myelin sheath [GO:0019911]	DVLGLATSPR	11.19999981	1029.501489	14.61424	12.42984	15.02013	14.2802	16.26635	12.24125	15.57961	16.29875	15.50498	12.21613	0	0	18.14545	0	14.39356	0	15.4447	14.88517	0	0	15.51688	17.39181	13.09971	14.78842	15.66594	0	13.11076	0	0	14.07718	0	0	0	14.90913	0	0	0	10.90475	0	0	14.76397	12.36758	13.37778	0	14.07125	12.97485	0	12.56308	0	15.73712	17.41627	0	0	0
I3KEI7	I3KEI7_ORENI		protein autoprocessing [GO:0016540]	Myelin regulatory factor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; protein autoprocessing [GO:0016540]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	GKPNPDQR	1.830000043	912.0880772	0	0	14.75011	15.9456	14.4888	14.47857	0	0	16.13846	14.72528	0	15.02232	0	0	12.62282	0	17.59735	16.89619	16.02998	14.88456	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.93607	0	14.70889	0	0	0	17.87977	0	0	0
A0A669DJQ9	A0A669DJQ9_ORENI	MYT1L	"regulation of transcription, DNA-templated [GO:0006355]"	Myelin transcription factor 1 like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; zinc ion binding [GO:0008270]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]; zinc ion binding [GO:0008270]	CPTPGCTGR	11.85000038	1005.953353	0	0	0	14.693	15.60508	0	14.95675	15.61085	0	16.43141	15.86096	0	15.78255	15.19296	16.24739	0	0	0	16.05374	15.90253	0	0	15.80056	14.66296	16.40392	15.3366	16.19757	15.75612	0	15.55941	0	18.36592	0	0	15.40105	15.32831	0	0	16.22457	15.8473	0	0	0	0	0	0	0	0	0	0	0	16.27415	16.08661	15.17084
I3JFQ6	I3JFQ6_ORENI			Myeloid leukemia factor 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]		SFSEPFGGALMPSLMDGR	11.92000008	1915.426276	11.88183	13.74403	15.12327	13.21867	16.85941	14.69887	12.19141	0	12.94023	13.10133	12.58834	0	13.4138	12.03455	13.09075	13.00005	11.59077	15.14864	0	14.0041	12.4514	15.09706	14.85548	14.36495	0	14.76167	15.82487	14.14131	13.03748	11.27568	15.0202	16.16148	15.34945	0	0	10.05579	0	13.61982	14.45884	12.89635	14.59659	10.41197	0	0	13.01468	14.62651	13.79937	13.17126	0	0	13.71949	12.45008	13.97089	14.13207
I3KQ66	I3KQ66_ORENI		myoblast fusion [GO:0007520]	Myoferlin like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasmic vesicle membrane [GO:0030659]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	cytoplasmic vesicle membrane [GO:0030659]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; metal ion binding [GO:0046872]; myoblast fusion [GO:0007520]	metal ion binding [GO:0046872]	AEDMPQMDDAFVQTVK	11.56999969	1840.697946	14.03029	16.31691	14.70548	13.0421	13.8668	10.86285	0	0	0	0	16.89087	0	0	15.69897	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.2048	0	0	0	0	0	0	0	16.87638	0	0	0	0	0	0	16.21876	0	19.21404	0	0	0	0	0	19.83405	0
A0A669D1A6	A0A669D1A6_ORENI			Myomesin 1a (skelemin)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		IPLNAGWG	4.369999886	826.2548791	16.9806	13.18825	0	0	15.91033	16.01781	15.23037	11.48105	14.73751	12.13631	16.2347	14.23398	14.53508	0	0	14.25274	16.66232	13.53525	0	0	14.11976	0	15.16094	0	0	13.30546	14.99116	13.99214	16.76535	0	15.84636	0	15.08881	14.82752	14.91007	13.0274	13.92917	14.61631	16.04401	13.87605	0	13.28085	15.40454	0	14.55499	0	16.15663	14.93548	14.2814	16.68294	15.79382	15.78347	15.04122	0
A0A669D9U8	A0A669D9U8_ORENI	MYO1D		Myosin ID	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	myosin complex [GO:0016459]	myosin complex [GO:0016459]; actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]	actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]	VASLEALKGQR	9.729999542	1171.651836	14.81926	14.8694	13.63708	14.6786	14.92816	14.1363	0	0	13.72995	0	11.54628	13.67808	11.68078	13.34213	14.36623	0	14.38943	15.87478	14.9038	0	0	12.66237	15.32371	12.78286	0	0	11.7369	0	10.18791	15.22567	19.51058	19.81655	20.08607	0	15.88519	14.40849	13.28742	14.13712	13.38206	13.60113	12.49348	13.94138	0	13.17631	10.8743	13.29217	0	14.34051	12.8192	8.466006	14.92636	0	0	14.83074
I3JQ79	I3JQ79_ORENI		response to stimulus [GO:0050896]; visual perception [GO:0007601]	Myosin IIIB	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	myosin complex [GO:0016459]	myosin complex [GO:0016459]; actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]; protein kinase activity [GO:0004672]; response to stimulus [GO:0050896]; visual perception [GO:0007601]	actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]; protein kinase activity [GO:0004672]	DMQCKQGPVMK	2.559999943	1352.977939	0	0	11.09367	0	0	14.01749	0	0	0	12.28559	0	0	13.37339	0	0	0	0	0	13.13998	14.04164	0	0	16.44315	0	14.60947	0	14.32022	0	0	0	0	0	0	0	0	0	0	0	13.53846	0	0	0	0	0	0	13.62061	0	0	0	0	0	0	13.69727	0
I3KQL8	I3KQL8_ORENI		actin filament-based movement [GO:0030048]; Rho protein signal transduction [GO:0007266]	Myosin IXb	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	myosin complex [GO:0016459]	myosin complex [GO:0016459]; actin binding [GO:0003779]; ATP binding [GO:0005524]; GTPase activator activity [GO:0005096]; microfilament motor activity [GO:0000146]; actin filament-based movement [GO:0030048]; Rho protein signal transduction [GO:0007266]	actin binding [GO:0003779]; ATP binding [GO:0005524]; GTPase activator activity [GO:0005096]; microfilament motor activity [GO:0000146]	SPDSDDPLLCMKDVSR	7.409999847	1850.070914	0	0	16.01193	11.14152	13.64361	12.34128	13.6048	14.72721	16.0599	11.28247	0	0	0	0	13.71428	15.20599	12.74807	0	16.56545	0	14.87059	0	14.13975	0	0	0	0	15.45871	14.87661	0	0	14.86226	0	0	0	9.494812	13.2639	0	0	0	15.70999	0	0	0	0	0	0	15.07802	14.18197	0	0	0	14.53865	0
A0A669DYM5	A0A669DYM5_ORENI			Myosin VIIAa	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; myosin complex [GO:0016459]	cytoplasm [GO:0005737]; myosin complex [GO:0016459]; actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	SNFLKMK	8.100000381	864.316521	0	0	0	14.0897	15.61653	0	0	0	14.84299	0	0	15.2485	15.78528	13.83979	0	14.95254	13.50788	16.69348	12.43998	13.81905	0	16.55279	16.6969	15.75404	17.16739	13.92115	0	0	0	0	0	14.70071	0	0	0	0	14.32565	16.30564	0	0	0	0	0	0	0	15.12735	0	0	16.03824	14.42994	0	15.63269	0	0
A0A669DIY7	A0A669DIY7_ORENI			Myosin VIIAb	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; myosin complex [GO:0016459]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; myosin complex [GO:0016459]; actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	ISNWSSGNTYFHITIGNLVRGSK	4.460000038	2551.624302	7.876473	5.797361	10.78658	0	0	0	11.6237	0	0	16.82886	16.66351	10.93747	0	10.21623	0	13.5835	0	8.683928	0	11.63329	0	10.67629	0	0	18.35271	0	12.36094	0	0	0	15.35261	14.21019	6.684913	0	0	12.73449	0	12.52404	10.02697	10.68373	10.22152	12.1321	0	0	9.206941	0	12.52417	9.880162	0	13.60455	0	0	0	0
I3KQX6	I3KQX6_ORENI			Myosin VIIBb	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; myosin complex [GO:0016459]	cytoplasm [GO:0005737]; myosin complex [GO:0016459]; actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	TLTKVGSNQCK	8.609999657	1234.608565	14.24138	11.67786	10.71375	13.84729	14.72849	0	13.48175	14.79277	13.50715	13.82674	15.29812	14.54779	14.84342	15.15448	15.70291	13.92013	11.24479	0	15.31747	15.36157	12.3426	0	0	14.5543	14.28766	14.53422	0	14.0576	14.90813	0	17.07294	16.92931	15.70207	14.96522	14.38735	0	0	14.85067	14.57253	0	0	0	0	14.51518	0	12.47676	15.10005	15.64934	14.89909	15.82088	0	14.65592	0	0
A0A669AX64	A0A669AX64_ORENI		signal transduction [GO:0007165]	Myosin X	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; myosin complex [GO:0016459]	cytoplasm [GO:0005737]; myosin complex [GO:0016459]; actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]; signal transduction [GO:0007165]	actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]	LTREAEEAR	6.929999828	1075.719728	14.21043	0	0	0	0	0	0	14.04317	12.85654	15.1933	14.02268	14.76157	13.80789	0	11.9687	0	14.3156	15.50433	14.80601	11.10687	11.47324	12.1505	12.22192	14.13553	14.26532	11.45773	13.48107	12.91498	10.74132	12.52874	17.81569	17.23005	18.37746	14.88377	13.81345	14.02963	15.00927	13.1174	0	11.45114	14.18908	12.50006	0	13.10737	0	14.17596	14.17703	0	14.10555	0	0	14.59156	13.68306	0
I3IYE9	I3IYE9_ORENI		signal transduction [GO:0007165]	"Myosin X, like 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; myosin complex [GO:0016459]	cytoplasm [GO:0005737]; myosin complex [GO:0016459]; actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]; signal transduction [GO:0007165]	actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]	VPTAGDDK	1.730000019	801.8846482	15.23631	15.97687	15.41841	15.8132	13.12201	15.34463	15.54697	15.51685	15.24288	16.29206	14.38253	0	16.57915	13.03703	0	17.25796	17.70516	15.54853	17.07375	15.45373	16.59207	17.99561	16.08575	0	16.75604	16.54875	14.01012	16.19671	14.1331	15.73501	0	15.77755	16.54079	14.58369	0	16.52713	13.85404	12.94209	15.39295	0	15.72077	16.32541	15.70031	15.45699	14.41112	15.0082	16.28181	14.2965	0	18.72469	16.84501	15.36833	16.45166	15.84535
I3KF02	I3KF02_ORENI	MYO15A	sensory perception of sound [GO:0007605]	Myosin XVAa	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; myosin complex [GO:0016459]	cytoplasm [GO:0005737]; myosin complex [GO:0016459]; actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]; sensory perception of sound [GO:0007605]	actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]	GCALGENPPHLFAIANAAHSQMMDAKK	8.359999657	2895.633788	0	12.61068	11.26817	13.62866	13.33222	0	14.88185	0	13.54457	0	13.23948	14.34115	13.18228	0	14.18792	15.12761	0	12.23631	0	14.24964	0	0	0	12.93178	16.97163	12.83745	0	0	0	15.00875	0	0	13.74883	13.90705	0	0	0	0	0	0	11.67994	13.11937	0	17.26228	0	0	11.32399	11.275	0	0	0	0	11.86987	12.62758
I3J548	I3J548_ORENI		sensory perception of sound [GO:0007605]	Myosin XVAb	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; myosin complex [GO:0016459]	cytoplasm [GO:0005737]; myosin complex [GO:0016459]; actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]; sensory perception of sound [GO:0007605]	actin binding [GO:0003779]; ATP binding [GO:0005524]; motor activity [GO:0003774]	KTFQFGGR	4.119999886	941.549499	14.96613	16.20585	14.56867	15.56127	18.38295	15.76004	15.12225	15.4431	16.31855	16.80143	16.50953	15.56401	15.98081	15.49283	15.38862	14.08142	15.40368	15.37154	14.04266	15.48661	15.17466	16.57485	15.9632	15.78039	16.4406	18.15354	17.85285	17.68322	13.41549	18.8791	17.5331	15.99472	15.90627	14.27784	15.63636	14.75696	14.63744	16.43114	15.30557	16.15509	15.96937	15.73477	14.95512	16.54667	15.64626	15.55081	17.26824	19.26976	15.86271	14.75253	16.42719	16.50809	15.39814	17.15148
A0A669DA91	A0A669DA91_ORENI			Myosin XVIIIAb	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	myosin complex [GO:0016459]	myosin complex [GO:0016459]; actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	VMNMFKGCR	8.529999733	1157.984786	12.61836	14.37367	0	11.30027	0	12.98303	0	0	0	15.61476	0	13.22319	12.56758	12.3523	17.16111	12.62903	14.1583	0	10.73517	0	0	19.34874	0	0	13.76629	14.64553	0	0	0	0	0	0	0	13.47659	0	0	0	15.14491	14.28062	14.86966	14.54477	13.64522	15.44373	0	0	0	14.35956	0	0	0	0	14.26771	13.37448	0
A0A669D651	A0A669D651_ORENI			"Myosin binding protein C, cardiac"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SNFVVTEGDGR	3.589999914	1177.720403	14.91492	14.1468	14.14624	13.8024	15.4613	15.55838	13.64427	14.04102	13.87625	15.1546	15.33436	13.51481	14.66112	14.60643	15.28539	0	16.14576	14.72653	13.92069	12.12445	15.83065	11.45546	16.38563	12.96507	15.53335	14.93905	15.35621	13.0925	0	12.3858	19.55749	19.02098	19.52797	13.63731	14.67726	0	15.15235	14.46988	15.35817	15.18403	15.60478	14.97567	12.7765	9.056014	13.3826	14.68024	16.26294	13.39475	13.63483	15.7518	14.13235	15.40746	15.37642	15.57094
A0A669F0K5	A0A669F0K5_ORENI	LOC100690391		Myosin motor domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	myosin complex [GO:0016459]	myosin complex [GO:0016459]; actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	TEVISAVLQFGNISFMKEK	3.039999962	2156.732113	11.4763	14.15815	0	14.16521	11.06239	0	12.80624	17.29528	0	13.91572	0	0	14.19827	16.74346	0	14.34943	12.16149	14.86423	12.51282	13.40576	14.76415	0	0	14.6854	14.79705	13.92667	18.69304	10.95269	0	0	7.106614	0	11.16768	17.71287	0	12.75345	0	0	0	0	0	0	0	0	8.655588	0	0	0	21.23263	0	0	0	0	14.61254
A0A669E2I7	A0A669E2I7_ORENI			Myosin phosphatase Rho interacting protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GGYDIMK	7.5	799.2153451	15.02038	0	14.81511	0	15.4612	13.64811	15.58443	15.71108	0	16.00541	15.41626	16.69334	16.43384	16.83068	15.81442	16.78588	15.50075	0	15.21528	16.37189	17.84781	15.99561	14.48609	14.63251	0	16.68662	16.55272	16.42093	16.26364	16.32615	16.20514	17.73591	15.72081	15.09773	15.24912	14.51142	16.40238	15.97485	16.20356	15.98751	16.51289	0	0	16.06082	16.79041	15.77003	0	15.48194	17.00516	15.07124	0	16.74301	0	17.46724
I3KZL6	I3KZL6_ORENI		atrial cardiac myofibril assembly [GO:0055004]; cardiac atrium development [GO:0003230]; heart contraction [GO:0060047]; heart morphogenesis [GO:0003007]	"Myosin, heavy chain 6, cardiac muscle, alpha"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	myosin complex [GO:0016459]	myosin complex [GO:0016459]; actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]; atrial cardiac myofibril assembly [GO:0055004]; cardiac atrium development [GO:0003230]; heart contraction [GO:0060047]; heart morphogenesis [GO:0003007]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	GDSLMAEFGK	5.130000114	1071.39699	13.76884	10.16377	0	15.41154	15.25808	13.00486	0	14.33076	19.11064	12.95092	12.80308	13.5586	14.39857	15.40088	13.87699	14.30683	12.66532	0	15.04288	10.73137	14.30508	13.96201	13.9971	12.96349	18.19616	12.58077	11.12771	12.67793	11.81761	0	15.68572	19.54444	12.36744	14.03136	13.01416	10.64708	14.52543	14.6231	13.9104	12.4087	12.04893	12.04405	11.21796	12.84597	15.49317	14.06058	13.40649	0	13.79125	16.19283	12.74187	13.57996	9.465162	13.26477
A0A669F7M7	A0A669F7M7_ORENI	LOC100710904		Myosin_tail_1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	myosin complex [GO:0016459]	myosin complex [GO:0016459]		MMSGRR	4.869999886	751.5638836	0	14.70256	15.92053	15.41236	0	15.22995	15.87988	0	17.16708	15.97623	16.8884	0	17.14448	17.01238	18.40127	0	16.68892	0	0	16.40639	16.32668	17.21548	0	17.8735	16.44524	16.99895	16.67027	17.39658	0	0	0	0	0	15.88708	16.94119	0	0	0	16.40887	0	15.70904	18.68524	0	0	0	0	0	17.01827	0	17.01465	16.89927	0	0	0
A0A669DRL5	A0A669DRL5_ORENI		endosome to lysosome transport [GO:0008333]; intermediate filament organization [GO:0045109]; mitochondrion distribution [GO:0048311]; muscle cell cellular homeostasis [GO:0046716]; phosphatidylinositol dephosphorylation [GO:0046856]; regulation of vacuole organization [GO:0044088]	"Myotubularin (EC 3.1.3.64) (EC 3.1.3.95) (Phosphatidylinositol-3,5-bisphosphate 3-phosphatase) (Phosphatidylinositol-3-phosphate phosphatase)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	filopodium [GO:0030175]; late endosome [GO:0005770]; plasma membrane [GO:0005886]; ruffle [GO:0001726]; sarcomere [GO:0030017]	"filopodium [GO:0030175]; late endosome [GO:0005770]; plasma membrane [GO:0005886]; ruffle [GO:0001726]; sarcomere [GO:0030017]; phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity [GO:0052629]; phosphatidylinositol-3-phosphatase activity [GO:0004438]; protein tyrosine phosphatase activity [GO:0004725]; endosome to lysosome transport [GO:0008333]; intermediate filament organization [GO:0045109]; mitochondrion distribution [GO:0048311]; muscle cell cellular homeostasis [GO:0046716]; phosphatidylinositol dephosphorylation [GO:0046856]; regulation of vacuole organization [GO:0044088]"	"phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity [GO:0052629]; phosphatidylinositol-3-phosphatase activity [GO:0004438]; protein tyrosine phosphatase activity [GO:0004725]"	FASRIGHGDK	5.21999979	1087.436107	0	0	0	0	0	14.43307	0	15.26517	0	12.6437	10.36901	0	11.28727	0	12.16995	15.49336	0	14.76112	15.83431	0	0	0	0	13.43683	0	14.22225	14.29715	15.00598	0	0	0	0	0	15.9442	0	0	0	0	0	0	0	0	0	0	0	17.00947	0	0	12.60305	14.94287	0	0	14.47855	0
A0A669C0D7	A0A669C0D7_ORENI	LOC100702538		Myotubularin phosphatase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QPLQPPSR	10.86999989	918.9942321	19.31347	19.24975	17.35958	19.47788	0	0	0	0	0	18.93786	18.48368	16.75712	17.95508	0	16.76387	17.31431	17.35251	18.23897	17.08991	16.26407	18.26313	0	18.72464	17.33027	16.73778	16.65124	17.45447	17.09782	17.16057	17.62033	0	18.11143	17.58756	0	19.29624	0	17.74226	18.42586	0	19.83732	19.22493	0	0	18.85138	18.43873	18.10961	18.39563	0	17.48775	18.01576	17.13767	0	17.09377	17.74407
I3K549	I3K549_ORENI	nat8l		N-acetyltransferase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		N-acetyltransferase activity [GO:0008080]	N-acetyltransferase activity [GO:0008080]	SLTLTCCAPLILMGAR	6.289999962	1778.039988	10.9654	0	13.24306	13.94777	0	11.09736	12.98389	15.09121	14.11957	0	0	0	13.05616	12.37095	0	11.63168	11.38566	0	15.43793	13.30689	10.94285	0	14.97203	13.84703	0	14.91403	12.71578	12.59951	12.71876	14.90014	0	14.60746	17.21117	12.21711	13.71381	0	13.96807	0	13.73994	14.54355	14.30782	14.62147	11.13912	14.47834	0	14.58216	15.29059	0	11.42048	15.53969	14.74402	11.13492	15.5768	15.37154
A0A669EN93	A0A669EN93_ORENI	acy1	cellular amino acid metabolic process [GO:0006520]	N-acyl-L-amino-acid amidohydrolase (EC 3.5.1.14)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; aminoacylase activity [GO:0004046]; cellular amino acid metabolic process [GO:0006520]	aminoacylase activity [GO:0004046]	DAEGNIYAR	6.710000038	1006.85474	0	13.48012	0	13.29499	9.845462	0	0	0	0	13.83842	11.92462	0	0	0	13.94011	14.74453	0	11.21969	0	14.64621	13.83315	11.75209	0	0	0	0	14.70703	16.08647	15.12832	0	0	14.65798	0	11.5052	0	12.77646	12.92945	12.40911	12.75692	0	13.49628	0	0	11.10852	10.48913	14.18251	7.086752	13.11323	13.28525	14.16871	19.20432	0	13.70916	18.70183
A0A669E3U5	A0A669E3U5_ORENI	LOC100691152	N-acetylneuraminate metabolic process [GO:0006054]	N-acylneuraminate cytidylyltransferase (EC 2.7.7.43)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		N-acylneuraminate cytidylyltransferase activity [GO:0008781]; N-acetylneuraminate metabolic process [GO:0006054]	N-acylneuraminate cytidylyltransferase activity [GO:0008781]	SLDWKHVAFMGFDQADEK	5.139999866	2140.169688	0	13.6677	0	0	11.60401	0	12.00701	13.43513	12.69274	14.37109	12.63766	14.83461	0	11.78835	14.12946	0	13.14664	17.30579	12.27899	13.56412	11.28847	0	12.81316	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.94743	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669CZJ7	A0A669CZJ7_ORENI	naa35	N-terminal peptidyl-methionine acetylation [GO:0017196]	"N-alpha-acetyltransferase 35, NatC auxiliary subunit (Protein MAK10 homolog)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	NatC complex [GO:0031417]	NatC complex [GO:0031417]; N-terminal peptidyl-methionine acetylation [GO:0017196]		EITMSQAYQNMCAGMYKTMVALDMDGK	5.739999771	3104.518825	16.44429	0	0	12.70792	0	0	0	15.09855	0	14.82776	0	0	17.01399	0	18.33763	10.81815	0	0	0	10.9838	0	0	0	15.40048	12.80698	0	0	0	11.20114	0	0	12.96412	0	0	11.17301	13.97004	0	0	0	0	14.93047	0	0	0	0	13.51842	0	0	0	0	0	0	0	0
A0A669CZZ5	A0A669CZZ5_ORENI			NACHT and WD repeat domain containing 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				RDSGQCMASLIEISGAIVK	7.300000191	2051.29165	14.03638	10.65758	0	13.10618	14.26327	13.08593	12.34559	12.74438	10.97026	8.984337	13.73326	16.69528	10.66852	17.33343	13.18485	0	8.09727	0	14.00315	13.83219	10.17043	0	0	10.57082	0	10.56082	0	0	15.21365	0	13.22641	15.92421	0	0	0	0	14.39383	14.42421	12.55751	0	12.69529	0	12.94586	13.9729	10.04328	13.88331	15.11151	11.3273	14.43787	13.6497	11.30161	15.08657	15.12738	19.20965
I3JQZ1	I3JQZ1_ORENI	LOC102080519		NACHT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GVSDLLLRFMFGLIK	10.65999985	1708.390402	13.96751	15.75753	14.31891	13.0272	14.02116	14.91853	19.23922	17.65692	0	0	16.77998	14.67514	0	14.86158	16.34925	14.84039	0	0	0	0	17.02291	0	0	0	0	15.33663	0	0	0	0	16.54385	17.284	0	14.93831	0	0	14.35281	0	0	14.69458	0	17.91505	13.18718	0	17.70611	17.09866	17.30297	0	0	15.99857	0	17.13488	17.28396	0
A0A669F3G8	A0A669F3G8_ORENI	LOC100706290	NAD metabolic process [GO:0019674]; NADP biosynthetic process [GO:0006741]	NAD(+) kinase (EC 2.7.1.23)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		NAD+ kinase activity [GO:0003951]; NAD metabolic process [GO:0019674]; NADP biosynthetic process [GO:0006741]	NAD+ kinase activity [GO:0003951]	MSESPRASK	10.22999954	1009.16507	14.28434	14.67697	13.07127	12.70797	0	11.82604	13.73912	0	17.73323	13.80641	14.44819	0	12.2066	0	17.84948	13.42045	13.33551	11.55081	14.07449	12.41549	13.98518	0	0	14.92285	0	0	15.56689	14.37006	14.09639	12.80267	14.22132	18.44222	0	0	14.49627	0	12.21947	0	14.75629	0	0	11.66247	12.65926	8.797011	13.07196	13.85865	12.54471	0	0	15.14034	17.71219	10.96234	11.3162	13.08262
A0A669B6D4	A0A669B6D4_ORENI	sirt2		NAD-dependent protein deacetylase (EC 2.3.1.286)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		NAD+ binding [GO:0070403]; NAD-dependent histone deacetylase activity [GO:0017136]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270]	NAD+ binding [GO:0070403]; NAD-dependent histone deacetylase activity [GO:0017136]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270]	AGQVNPMMGLFGFGEGMDFDSDK	6.650000095	2482.734834	0	13.70956	0	0	0	0	0	0	0	0	19.34733	11.23016	15.64604	16.79084	10.59796	10.10973	0	6.773291	18.15318	0	0	10.52671	18.91746	0	0	18.95069	0	0	17.41364	0	12.6102	12.81365	14.2117	11.50407	0	0	0	12.12882	0	0	0	0	0	0	0	0	0	7.334079	0	14.60577	0	14.36722	0	18.13561
I3KN05	I3KN05_ORENI	ndufa12	mitochondrial respiratory chain complex I assembly [GO:0032981]	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]	mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]; mitochondrial respiratory chain complex I assembly [GO:0032981]		IHEWVPPK	9.970000267	1004.866822	12.97813	18.19972	12.16342	16.27828	12.62882	15.02384	16.94874	17.0949	17.27029	15.92724	15.80092	16.98949	16.66243	9.134297	14.03558	15.96857	16.83961	0	14.8654	16.52603	18.22062	17.75341	16.20784	15.65146	16.85596	0	17.58886	14.18154	0	17.89176	17.02798	11.00418	16.85312	0	16.87326	17.61316	0	17.27461	16.65537	0	0	0	18.11497	0	0	19.55337	19.33458	18.77316	14.96424	16.85713	17.28677	17.32355	0	16.77419
I3ITR4	I3ITR4_ORENI	LOC100694258		NADH-cytochrome b5 reductase (EC 1.6.2.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"cytochrome-b5 reductase activity, acting on NAD(P)H [GO:0004128]"	"cytochrome-b5 reductase activity, acting on NAD(P)H [GO:0004128]"	GGFDSIINLIFR	14.89000034	1350.883173	12.61753	15.6227	13.22106	13.83125	13.03898	12.61535	14.80092	0	13.7765	0	12.84167	0	9.866663	0	13.4552	12.84736	12.92256	13.82916	10.08501	10.8036	13.44789	0	14.54342	15.06166	0	12.99757	0	14.26149	10.91045	13.83067	15.05391	15.52109	0	0	0	8.196305	13.73338	13.8934	0	0	0	14.61627	0	13.52919	0	14.47093	13.12586	15.47848	14.2612	0	14.80167	11.56262	13.76423	13.43829
I3JPG1	I3JPG1_ORENI	NDUFS1	ATP synthesis coupled electron transport [GO:0042773]	"NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial inner membrane [GO:0005743]	"mitochondrial inner membrane [GO:0005743]; 4 iron, 4 sulfur cluster binding [GO:0051539]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]; ATP synthesis coupled electron transport [GO:0042773]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]"	VLFLLGADAGSITRPNLPK	4.869999886	1982.313916	13.78867	11.01972	9.220698	12.5624	12.55661	13.56522	13.87065	0	0	14.58127	14.20058	15.66137	0	13.02866	12.6409	0	0	16.63202	0	0	15.36492	13.33572	14.37519	0	11.86561	13.62768	0	0	12.24882	0	14.48763	13.31606	14.3009	0	13.29423	0	13.00729	0	12.40792	0	0	13.66792	15.47007	0	12.76538	12.76904	0	13.38464	14.37039	0	15.02128	12.69918	14.25564	13.62262
A0A669DKI1	A0A669DKI1_ORENI			NADH:ubiquinone oxidoreductase subunit A9a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GGRSSFSGIAATVFGATGFLGR	3.369999886	2116.949707	10.89566	0	13.53913	13.61652	0	0	15.09106	11.79511	0	18.22524	0	13.33241	18.12185	14.56838	12.48264	14.13349	12.10215	11.29373	12.1125	12.56762	16.66601	12.06261	13.60741	0	15.37171	15.07611	10.70421	16.95679	12.10238	13.88104	16.21714	16.42159	15.90237	12.87358	10.82311	0	12.26227	11.33644	0	0	0	0	13.7863	12.76213	12.67962	0	13.16356	12.70276	0	0	14.73527	0	14.46827	12.16969
I3J608	I3J608_ORENI			NBR1 autophagy cargo receptor b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MTAAFLDENLPDGTR	3.769999981	1665.872319	9.022374	13.56026	13.49668	0	13.54702	14.24644	15.93795	16.51069	17.36275	16.03661	18.30032	18.49313	0	14.76632	15.82333	0	16.15407	15.40241	0	0	13.04727	16.59391	15.83783	16.95067	14.77963	15.25734	0	0	0	0	15.96984	0	14.91451	13.46517	0	0	0	0	13.38144	0	11.47669	13.0922	0	0	0	0	0	0	0	0	0	0	0	0
A0A669D3F3	A0A669D3F3_ORENI			NCK interacting protein with SH3 domain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GDDPVCMFKHTPPAPHSVLK	6.300000191	2245.637239	13.65607	10.45099	13.53069	12.60189	11.32298	9.976261	11.58549	11.97042	12.11012	0	0	9.999067	13.37223	13.88185	0	0	14.55871	17.99417	13.21142	0	0	0	14.18498	0	0	0	0	12.13809	14.16409	0	0	0	0	0	14.08419	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669AYK5	A0A669AYK5_ORENI	NCKAP5		NCKAP5 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NSNEGIYSLGIKSSSK	4.010000229	1684.712053	0	12.73142	0	0	16.32774	0	16.32444	15.40854	0	0	16.74686	0	15.51146	16.46109	0	0	0	0	0	0	0	18.30821	0	0	0	17.43877	0	0	0	16.2314	0	0	0	0	0	0	0	13.51601	0	0	0	0	0	0	16.55412	0	0	0	0	0	0	0	0	0
I3JDK4	I3JDK4_ORENI			NEDD4 binding protein 2-like 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				HGVPQEKIAQMMDR	4.78000021	1656.808347	0	0	0	15.9418	12.45916	13.89649	0	11.48124	0	0	15.31981	11.15541	14.04233	14.80235	0	0	0	0	0	14.99958	0	0	15.65309	0	0	15.1325	14.64223	0	0	0	0	0	0	17.77556	17.58907	0	0	15.94359	0	0	17.56574	0	0	17.19361	14.6671	0	12.71378	15.53662	0	15.448	14.61475	0	14.16472	0
A0A669BCD8	A0A669BCD8_ORENI		protein neddylation [GO:0045116]	NEDD8-activating enzyme E1 regulatory subunit	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		NEDD8 activating enzyme activity [GO:0019781]; protein neddylation [GO:0045116]	NEDD8 activating enzyme activity [GO:0019781]	AMQDAAAVSK	10.61999989	1007.703339	0	0	0	0	13.11916	0	0	13.83251	0	0	15.45662	0	0	0	14.83846	0	0	0	0	0	0	0	0	14.22003	0	0	0	0	0	0	0	0	0	0	0	0	15.45531	0	0	0	17.27044	15.60764	14.95869	0	0	0	14.38739	0	0	15.11833	0	0	0	16.1277
A0A669BJT0	A0A669BJT0_ORENI	nfrkb		NFRKB_winged domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Ino80 complex [GO:0031011]	Ino80 complex [GO:0031011]		TSLNTNISSLGR	3.160000086	1262.470615	0	13.69839	0	12.02239	12.34506	0	9.719484	0	9.01553	14.23779	13.09015	11.60115	10.88165	14.01876	7.36705	14.23127	13.04173	12.33815	16.95572	17.32489	13.69695	11.86093	17.81943	0	0	0	0	0	0	10.25637	0	0	16.89274	0	0	0	0	11.83185	0	0	0	12.23635	13.19869	14.26802	0	0	0	11.71933	0	0	0	0	0	0
A0A669B0I1	A0A669B0I1_ORENI			NHS-like 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ESEEDK	11.71000004	735.7658464	0	15.15876	15.57693	14.39964	14.80307	0	16.75185	18.61864	17.03974	15.88334	15.22706	15.89065	0	0	15.51887	0	0	16.28639	16.12745	0	16.94678	16.42841	16.74797	0	0	0	16.80846	18.08067	16.82553	0	18.25805	16.47844	17.80641	0	16.43717	18.33828	16.21732	0	16.97808	16.04266	16.2257	14.13703	18.90247	0	16.66793	16.35143	16.53436	15.97921	16.46675	15.55531	16.34363	16.77082	0	0
A0A669B4A8	A0A669B4A8_ORENI			NLR family member X1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QRAYFTSR	4.639999866	1028.993085	13.55549	0	0	0	14.28832	0	15.22704	0	0	13.86438	18.34555	0	17.23568	0	0	0	0	0	0	0	0	12.59466	13.85985	13.97669	0	0	15.1863	11.11707	13.11941	18.14908	14.67299	0	12.36902	15.1981	0	0	0	14.48596	14.67873	14.12524	12.03129	18.3945	15.33508	17.25311	0	0	0	15.25129	16.98212	15.44026	15.44416	0	0	0
A0A669C5P8	A0A669C5P8_ORENI	nsun2		NOL1/NOP2/Sun domain family member 2 (EC 2.1.1.203) (mRNA cytosine C(5)-methyltransferase) (tRNA cytosine C(5)-methyltransferase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]; nucleus [GO:0005634]	extracellular region [GO:0005576]; nucleus [GO:0005634]; mRNA (cytidine-5-)-methyltransferase activity [GO:0062152]; tRNA (cytosine-5-)-methyltransferase activity [GO:0016428]; tRNA binding [GO:0000049]	mRNA (cytidine-5-)-methyltransferase activity [GO:0062152]; tRNA (cytosine-5-)-methyltransferase activity [GO:0016428]; tRNA binding [GO:0000049]	ELGLVPEGEFEQFMEAMREPLPATIR	4.429999828	3020.734542	11.20605	13.47034	11.57955	9.440328	13.95236	10.39565	14.92398	13.12889	0	0	13.67234	13.89102	13.04887	14.14147	11.93016	13.46611	12.227	8.943923	13.38486	0	0	0	0	0	0	0	0	0	0	0	0	0	14.46074	0	12.56694	13.57771	0	12.10677	14.86332	0	0	13.36804	0	0	12.09078	14.4645	0	11.78549	13.41937	0	11.85622	0	0	14.3569
A0A669EGA8	A0A669EGA8_ORENI		ribosome biogenesis [GO:0042254]	NOP14 nucleolar protein homolog (yeast)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]; small-subunit processome [GO:0032040]	nucleolus [GO:0005730]; small-subunit processome [GO:0032040]; ribosome biogenesis [GO:0042254]		AMQSILGDAAHSMEETLEVK	5.900000095	2193.120908	13.20563	0	0	11.56622	13.04731	0	0	0	10.61096	8.309095	0	11.92044	11.18087	6.834406	0	0	0	0	13.37831	13.79047	14.54401	0	0	10.51956	13.74308	0	12.27783	0	11.30922	0	0	10.81013	14.73024	0	11.36169	0	0	15.08257	0	12.14698	13.07124	0	0	0	0	8.368451	14.14487	12.15335	0	0	0	15.22768	0	13.56165
A0A669DLS4	A0A669DLS4_ORENI		cellular response to amino acid starvation [GO:0034198]; negative regulation of TOR signaling [GO:0032007]	"NPR3-like, GATOR1 complex subunit"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cellular response to amino acid starvation [GO:0034198]; negative regulation of TOR signaling [GO:0032007]		QILPKCK	21.37999916	885.8207506	16.13326	0	15.04113	0	0	16.07781	0	0	0	15.23998	0	0	0	0	0	0	14.62429	0	0	0	14.40333	0	0	0	0	0	0	12.96348	0	0	18.19826	0	18.74674	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.19739	0	0	0	0	0
A0A669CZ34	A0A669CZ34_ORENI	nr5a2		NR LBD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; nuclear receptor activity [GO:0004879]	DNA binding [GO:0003677]; nuclear receptor activity [GO:0004879]	FPMAAVRQITHGPR	17.65999985	1580.328496	13.58316	0	0	0	12.70715	0	13.51048	0	13.22397	10.65859	13.86664	12.28845	15.53025	14.67304	0	13.78848	0	12.5911	14.19556	0	15.50688	17.38314	0	12.84943	0	0	14.64093	14.07185	15.48907	0	15.40579	0	15.31598	0	15.66118	0	0	0	0	0	0	15.29745	0	0	10.86787	16.32935	14.12492	15.75127	15.32456	14.76142	14.55383	16.02883	15.49906	0
A0A669EGC2	A0A669EGC2_ORENI	rrp12		NUC173 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		VLATNPELK	4.980000019	982.9513427	14.5285	13.61415	0	12.28545	13.00033	0	14.56921	16.14345	0	15.50066	0	14.14193	15.67157	12.96933	15.52528	13.26651	12.87188	13.13619	17.0646	11.61457	13.53085	13.82067	13.00005	11.90726	12.98114	12.2576	14.1364	14.10649	4.880923	0	15.53042	0	13.08631	13.97804	11.79161	14.35463	14.49162	12.77255	14.63145	15.40031	11.40305	0	0	13.73741	10.99182	0	14.96024	12.17266	14.19599	15.55452	0	0	14.79028	0
I3KP58	I3KP58_ORENI	LOC100701289	mitotic centrosome separation [GO:0007100]; nervous system development [GO:0007399]; neurofilament cytoskeleton organization [GO:0060052]; regulation of microtubule motor activity [GO:2000574]	NUDE_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule [GO:0005874]; spindle [GO:0005819]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; spindle [GO:0005819]; mitotic centrosome separation [GO:0007100]; nervous system development [GO:0007399]; neurofilament cytoskeleton organization [GO:0060052]; regulation of microtubule motor activity [GO:2000574]		LKNEVETLK	11.68999958	1073.984662	12.73924	12.8889	13.18754	12.25826	13.11052	18.48371	12.31773	13.68116	11.62418	12.6432	14.00694	0	12.74412	0	18.17325	14.61552	0	13.85712	14.79638	17.34629	0.3818133	0	13.35936	14.68891	12.43629	15.44201	14.34965	0	0	0	0	14.86839	15.52126	13.5282	14.70744	0	13.90263	0	14.84839	0	13.71703	0	14.35449	14.09338	11.31463	13.9021	0	14.75637	13.25241	15.0505	0	0	16.67233	0
I3KYA3	I3KYA3_ORENI	LOC100701575		NUDIX_5 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DFQAIHTK	21.67000008	958.2947308	14.39137	12.6612	14.35245	0	13.56111	0	0	0	14.21915	15.7501	13.26864	0	11.63965	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.63186	0	16.52443	0	0	0	0	0	0	0	0	0	0	16.51898	0
I3KJX0	I3KJX0_ORENI	ILRUN		N_BRCA1_IG domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EGMDLDQELMQK	8.43999958	1451.643237	0	0	0	0	0	0	0	13.37342	15.48635	0	13.77449	10.71762	0	0	0	0	10.61582	0	10.36601	0	0	0	0	0	0	0	0	0	11.32913	0	15.15409	0	10.72343	0	0	0	0	0	11.45297	0	0	0	0	16.57923	0	11.92267	0	0	0	0	0	0	0	0
I3K5J7	I3K5J7_ORENI	LOC100693999	sodium-dependent phosphate transport [GO:0044341]	Na(+)-dependent phosphate cotransporter 2A (Sodium-dependent phosphate transport protein 2A) (Sodium/phosphate cotransporter 2A) (Solute carrier family 34 member 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	apical plasma membrane [GO:0016324]; integral component of membrane [GO:0016021]	apical plasma membrane [GO:0016324]; integral component of membrane [GO:0016021]; sodium:phosphate symporter activity [GO:0005436]; sodium-dependent phosphate transport [GO:0044341]	sodium:phosphate symporter activity [GO:0005436]	MSSRSITIVSSGR	5.849999905	1396.544434	0	0	14.97729	12.60439	14.76828	0	14.78793	0	0	17.61093	0	0	15.19614	15.7709	15.5399	15.55295	11.72743	0	14.25681	0	0	12.92326	13.6769	14.4655	13.61855	0	13.97073	0	14.68007	15.30735	19.3761	19.29792	0	0	14.84454	0	14.02105	14.04433	0	14.24011	11.95266	11.64268	0	0	0	0	0	0	15.64797	15.51212	13.91096	15.88399	0	15.17543
I3KTW2	I3KTW2_ORENI	LOC100707955		Na(+)/H(+) exchange regulatory cofactor NHE-RF	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endomembrane system [GO:0012505]; filopodium [GO:0030175]; membrane [GO:0016020]; microvillus [GO:0005902]; ruffle [GO:0001726]	endomembrane system [GO:0012505]; filopodium [GO:0030175]; membrane [GO:0016020]; microvillus [GO:0005902]; ruffle [GO:0001726]; molecular adaptor activity [GO:0060090]	molecular adaptor activity [GO:0060090]	LMFVNGESVEGDSHQQVVAK	4.679999828	2190.943788	12.02489	14.32405	12.67143	10.11012	0	13.68253	0	13.55737	12.34075	0	11.91293	0	15.19162	0	16.23653	18.88879	19.65033	20.51982	14.41532	18.22333	11.67962	0	11.65817	12.15344	10.3961	0	18.78974	0	12.082	9.748156	14.02052	14.05287	12.94451	14.79905	18.07889	14.22243	14.07673	12.12784	15.14389	0	8.925041	13.07149	17.83079	0	12.69167	0	0	5.821537	14.53981	20.11477	0	12.40415	11.19211	0
A0A669DFB1	A0A669DFB1_ORENI		flagellated sperm motility [GO:0030317]	Na_H_Exchanger domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; sodium:proton antiporter activity [GO:0015385]; flagellated sperm motility [GO:0030317]	sodium:proton antiporter activity [GO:0015385]	EITVMPR	5.260000229	860.6457009	16.33678	14.26869	13.80832	16.75743	0	13.627	17.80337	18.92454	18.55135	17.16045	15.00339	17.60366	16.00539	15.21228	0	15.92636	0	14.30812	14.28659	16.60417	15.64065	15.50929	15.14172	15.08312	16.39683	15.99307	17.05371	0	17.8651	14.15484	18.27152	19.3213	14.91292	13.03842	17.84568	15.82146	16.30215	15.07179	0	16.09874	16.0315	0	16.80186	18.20917	17.03089	16.55503	14.14719	17.10948	15.94831	15.97459	0	16.60205	0	15.85841
I3J507	I3J507_ORENI			Nance-Horan syndrome a (congenital cataracts and dental anomalies)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SNSQVITSCVIPINVTGVGFDR	3.309999943	2363.962133	0	0	14.47906	13.41537	14.67249	0	12.01165	12.41304	12.3793	14.80611	13.47813	0	0	14.52257	14.21526	0	13.90232	0	14.47356	0	12.45393	12.44042	0	0	0	0	13.62395	0	0	11.50906	0	0	16.46523	0	0	9.912833	13.44035	0	0	11.79774	0	15.9209	14.54514	11.45637	0	12.29955	0	14.3687	0	0	16.21875	0	0	13.97613
A0A669DHQ0	A0A669DHQ0_ORENI			Nance-Horan syndrome b (congenital cataracts and dental anomalies)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KATSTGEGEGSEVLGSNR	11.76000023	1777.500256	11.07137	0	15.24144	15.1353	10.93567	14.63172	13.94866	0	0	0	15.25797	15.32467	0	16.22126	14.22615	0	0	15.2835	11.19029	0	0	13.41762	0	0	0	17.36549	0	0	16.00892	0	15.5166	16.10723	14.68308	16.17677	0	0	14.87233	0	14.7044	12.64362	12.96242	0	14.55589	0	0	15.84937	16.9556	0	0	0	15.78198	0	15.17877	16.40358
A0A669BU46	A0A669BU46_ORENI	naca		Nascent polypeptide-associated complex subunit alpha	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nascent polypeptide-associated complex [GO:0005854]	nascent polypeptide-associated complex [GO:0005854]		AANPGK	6.519999981	555.2707816	13.72864	14.21679	13.02276	13.66248	14.07133	13.36621	14.80079	0	13.42116	17.87891	17.73162	15.81431	0	0	14.42655	12.80711	15.97573	14.34733	11.44236	14.63828	14.2136	13.97424	14.34907	15.16224	15.822	15.04664	15.38173	15.49751	17.79037	14.41584	15.56529	16.01302	15.30702	14.50699	14.59906	15.28739	15.51309	0	13.47453	14.17154	15.01515	15.22154	13.5629	16.28422	15.60981	14.37734	14.63274	14.50557	10.86791	14.56088	13.5574	15.06998	14.7414	14.92443
I3JQ87	I3JQ87_ORENI	LOC102078792		Nbl1_Borealin_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LASCKTNDPSPLSQSR	6.980000019	1761.584191	14.81261	15.05629	12.14529	16.07721	0	13.53223	0	11.09643	0	14.89621	0	0	15.32213	15.8569	0	0	15.73549	15.60334	15.06082	14.03201	15.10766	0	12.62708	0	0	14.84466	0	0	0	0	0	0	16.12298	12.88129	0	0	0	14.64604	13.01445	15.73406	15.84136	0	0	14.88298	15.45876	0	15.03923	0	13.73966	15.4323	0	17.24311	16.60265	0
A0A669CKX5	A0A669CKX5_ORENI			Nebulin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]	actin binding [GO:0003779]	VGGQIQSEK	3.880000114	944.9823978	13.38783	16.66415	14.52861	13.65313	15.22662	13.12477	13.22366	14.40729	13.51978	15.29764	15.22076	0	15.36737	13.28084	0	13.21955	13.53199	12.43119	14.00014	0	0	14.18662	13.14499	12.8936	11.90917	15.04856	11.93157	7.920059	11.8965	14.80787	17.11639	16.13198	0	9.964969	14.55279	14.39217	14.9473	13.43332	14.41673	12.87434	12.42788	14.63978	14.44579	14.31855	0	13.75331	15.31581	15.69248	15.32612	0	13.18383	14.97899	14.31188	13.44202
A0A669EAX6	A0A669EAX6_ORENI			Nebulin-related anchoring protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]; metal ion binding [GO:0046872]	actin binding [GO:0003779]; metal ion binding [GO:0046872]	IVSEVEYKK	10.39000034	1090.346619	15.71193	15.53356	13.66803	13.14985	13.94879	16.33292	16.33902	15.44662	14.84661	14.89645	16.06313	16.29474	16.36143	14.97446	0	15.94771	0	14.48511	0	0	17.46305	16.93092	18.36876	14.90839	13.24096	12.75139	0	12.58738	0	16.87839	0	13.85161	15.66544	0	15.31689	14.49741	14.92012	14.71195	0	0	0	15.35842	0	0	0	0	0	18.66606	20.50375	21.46329	14.92029	0	14.66982	20.41577
A0A669ESQ4	A0A669ESQ4_ORENI	nelfe	"regulation of transcription, DNA-templated [GO:0006355]"	Negative elongation factor E	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	NELF complex [GO:0032021]	"NELF complex [GO:0032021]; RNA binding [GO:0003723]; regulation of transcription, DNA-templated [GO:0006355]"	RNA binding [GO:0003723]	ALVALKK	2.849999905	743.1122553	0	15.29527	0	8.704499	0	14.0512	14.66883	9.630396	0	14.3301	15.18343	12.96002	13.34786	14.5648	10.07861	15.70956	16.33639	13.0717	13.17553	11.93269	15.2637	0	0	0	15.50389	15.52251	12.66124	0	15.89871	15.30929	19.07351	22.2684	19.39033	15.25286	15.42143	14.93129	13.1607	13.61177	0	9.772801	12.44263	0	11.4423	12.33364	0	0	13.06798	12.71434	10.33088	15.26241	16.09802	14.45733	14.64389	0
I3KL74	I3KL74_ORENI			Negative regulator of ubiquitin-like proteins 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NHSKVMVLR	6.429999828	1099.411999	14.83145	13.98903	11.22627	16.42197	14.74416	14.13637	0	0	0	15.0242	0	12.24415	0	0	18.41487	14.52613	9.577264	12.80374	8.746014	14.53551	12.81295	0	0	12.17205	15.01807	11.61539	0	0	14.76199	0	17.28646	10.73299	16.09753	10.15836	13.65938	13.08949	16.39778	14.94125	14.00987	13.15795	0	13.97303	12.45427	17.19797	17.06344	13.94375	13.32135	0	0	17.03066	12.16337	0	0	14.0284
I3KMZ0	I3KMZ0_ORENI		blood vessel morphogenesis [GO:0048514]	Netrin 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; blood vessel morphogenesis [GO:0048514]		GEVIYRTLPK	2.819999933	1175.253026	13.42382	10.03085	9.538691	12.87002	0	0	14.44598	0	14.62675	13.6747	13.43542	12.30225	8.40801	8.958078	0	12.7251	15.87875	0	0	0	16.2831	0	18.28023	18.0367	0	15.43036	15.94189	14.41639	13.46866	11.64411	14.82971	10.23105	13.37037	8.75346	14.34013	0	10.47302	9.456192	13.24035	13.83679	13.98175	14.08394	13.26231	12.92249	11.341	11.39566	12.74858	10.29362	14.18359	0	14.45823	11.11725	14.7289	9.755681
I3IWL0	I3IWL0_ORENI	NTNG2		Netrin G2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SLHGSK	6.420000076	627.8426202	0	15.44664	14.28946	13.5582	14.79525	15.46137	14.80962	15.30927	16.08897	15.57171	15.20481	12.55505	0	15.91903	15.62166	16.71089	0	0	17.09163	16.90741	16.14092	17.86067	17.68721	17.18961	16.6294	15.5911	15.18084	15.2192	15.56239	0	0	0	0	0	0	15.72377	0	16.4743	16.14076	0	16.311	0	16.49899	16.27341	0	15.07308	0	0	19.13161	17.21553	18.77789	0	0	16.30085
A0A669B2L0	A0A669B2L0_ORENI	LOC100698253	multicellular organism development [GO:0007275]	Netrin receptor UNC5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; netrin receptor activity [GO:0005042]; multicellular organism development [GO:0007275]	netrin receptor activity [GO:0005042]	LLELSFQQVWSGSQR	7.460000038	1778.119762	14.75097	15.17285	0	15.45246	15.90259	15.18019	0	15.10335	14.32494	15.2628	14.15428	13.47313	0	15.08862	12.38354	12.6191	15.69614	0	14.44489	0	0	12.94772	14.76345	14.86387	15.40155	15.44891	14.87929	13.92343	0	0	17.71465	13.72729	17.14137	15.59875	16.35249	16.18611	14.47294	14.6863	0	0	13.49473	13.84902	18.32228	16.0909	0	0	16.07355	12.98262	0	14.51888	14.34566	16.88591	14.64343	0
I3KVS8	I3KVS8_ORENI	LOC100698643		Netrin-1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]		ELVLGAGGNTGGR	8.300000191	1201.968291	14.38353	13.98884	14.43037	15.02751	0	0	16.21691	14.0433	0	14.05651	0	15.53905	15.0849	0	14.78269	15.97048	15.54271	15.37786	0	0	0	14.82262	0	15.3519	14.36241	14.83665	0	15.36094	0	0	15.14541	16.67163	15.92178	0	16.00117	0	13.48762	0	14.67396	16.54423	0	17.1476	15.46472	16.10282	0	14.22254	14.62474	16.33266	17.17511	17.53575	0	16.59855	16.38674	0
A0A669EHI5	A0A669EHI5_ORENI			Neurobeachin a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]		ILNILTNK	34.38000107	927.6964139	18.33734	19.65267	17.48971	17.90065	19.37103	16.62657	19.30215	18.6131	17.38308	19.70868	19.32617	17.66932	18.22919	19.33412	19.12479	18.04942	17.76206	15.79703	17.26022	18.72058	16.67717	17.95972	17.40374	18.88345	18.68145	18.01418	0	16.53868	19.41009	19.15432	16.65935	17.49679	14.84325	17.07938	19.33179	18.22515	19.59352	19.30831	19.0719	16.1174	17.15289	17.10206	16.04595	15.50226	16.49984	16.62054	18.31625	16.73485	17.00937	17.04634	20.28593	16.73447	17.08237	18.8031
A0A669E207	A0A669E207_ORENI	NBEA		Neurobeachin b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]		TAGRGR	3.319999933	616.3672198	0	0	14.23289	0	17.75541	14.04952	0	0	0	13.61186	0	15.83563	16.30506	14.82454	13.4059	0	0	13.48444	0	14.81724	14.98181	0	15.64046	15.38198	13.05378	0	14.64187	0	0	0	0	0	0	14.33177	0	15.49383	15.02932	13.99535	0	15.33332	0	16.34924	17.29045	16.08531	16.74364	15.96127	13.6247	14.07251	16.63441	14.76137	14.0182	16.04389	0	15.39596
I3K7Q9	I3K7Q9_ORENI	ncdn		Neurochondrin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	postsynapse [GO:0098794]	postsynapse [GO:0098794]		DFCESTDETR	5.849999905	1259.029507	14.38946	11.17572	11.35104	10.07586	0	0	13.88137	5.463133	13.37138	0	13.89699	12.39158	10.9247	0	8.055286	11.65187	14.21063	0	0	0	14.65561	15.39166	13.53483	0	0	0	13.04222	0	0	0	17.51277	0	19.87897	14.54361	13.77873	0	0	0	12.00407	13.73625	12.28292	12.06117	0	0	14.14736	0	0	0	10.84974	0	14.75395	14.71003	0	0
I3KC28	I3KC28_ORENI		blood vessel development [GO:0001568]; habituation [GO:0046959]; heart development [GO:0007507]; memory [GO:0007613]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; oligodendrocyte progenitor proliferation [GO:0070444]; regulation of cell cycle [GO:0051726]; regulation of glial cell differentiation [GO:0045685]; regulation of glial cell proliferation [GO:0060251]; regulation of GTPase activity [GO:0043087]; signal transduction [GO:0007165]	Neurofibromin 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; blood vessel development [GO:0001568]; habituation [GO:0046959]; heart development [GO:0007507]; memory [GO:0007613]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; oligodendrocyte progenitor proliferation [GO:0070444]; regulation of cell cycle [GO:0051726]; regulation of glial cell differentiation [GO:0045685]; regulation of glial cell proliferation [GO:0060251]; regulation of GTPase activity [GO:0043087]; signal transduction [GO:0007165]		EVELADSMQTLFR	5.070000172	1555.803613	13.06231	0	14.1488	0	0	0	15.60122	15.45906	0	0	0	0	0	16.03928	12.89484	15.27448	14.41881	12.18427	13.5055	15.62932	14.46361	16.63263	15.79977	17.41811	12.53269	14.10592	0	15.50022	13.20354	14.31214	13.79939	0	16.10837	0	0	10.4718	13.48702	15.94947	0	15.29806	0	10.62403	10.26034	14.66325	0	14.41696	0	12.81714	0	0	0	0	0	0
A0A669DJI6	A0A669DJI6_ORENI	LOC100703553	"angiogenesis [GO:0001525]; cell differentiation [GO:0030154]; Notch signaling pathway [GO:0007219]; regulation of developmental process [GO:0050793]; regulation of transcription, DNA-templated [GO:0006355]"	Neurogenic locus notch homolog protein 1 (Notch 1 extracellular truncation) (Notch 1 intracellular domain)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	"integral component of membrane [GO:0016021]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; signaling receptor activity [GO:0038023]; angiogenesis [GO:0001525]; cell differentiation [GO:0030154]; Notch signaling pathway [GO:0007219]; regulation of developmental process [GO:0050793]; regulation of transcription, DNA-templated [GO:0006355]"	calcium ion binding [GO:0005509]; signaling receptor activity [GO:0038023]	VLLEHFANR	9.710000038	1097.761606	0	14.03086	14.09449	14.36712	0	14.33497	16.5995	12.7034	12.48876	15.8133	0	12.06386	12.9203	15.35628	0	13.62265	0	13.55404	11.73473	0	16.32719	13.89934	15.35375	0	13.70842	13.96086	13.93644	13.77223	15.59476	11.48176	15.07518	0	16.45712	11.57641	15.84428	13.65764	12.8166	0	14.91682	12.84542	13.98112	0	0	17.46812	13.16639	6.877772	9.441456	13.18663	0	0	11.57619	12.50739	0	0
A0A669EIH1	A0A669EIH1_ORENI		cell adhesion [GO:0007155]; modulation of chemical synaptic transmission [GO:0050804]; synapse organization [GO:0050808]	Neuroligin 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	inhibitory synapse [GO:0060077]; integral component of plasma membrane [GO:0005887]	inhibitory synapse [GO:0060077]; integral component of plasma membrane [GO:0005887]; neurexin family protein binding [GO:0042043]; cell adhesion [GO:0007155]; modulation of chemical synaptic transmission [GO:0050804]; synapse organization [GO:0050808]	neurexin family protein binding [GO:0042043]	HDESSMNKPR	9	1201.330257	0	0	0	0	15.75772	17.37462	16.43357	14.99411	14.60314	0	0	0	13.7366	0	14.81472	0	11.58246	14.45743	0	0	14.94972	0	13.31568	13.60969	8.291787	13.25428	0	0	6.538477	0	0	0	14.2254	0	0	13.75183	0	13.1894	12.46399	0	11.80937	0	0	0	10.81118	0	12.52426	0	13.25874	0	0	0	13.86813	0
I3KBN6	I3KBN6_ORENI		neurogenesis [GO:0022008]	Neuron navigator 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		neurogenesis [GO:0022008]		GLEYSEESKPGRR	4.130000114	1508.077192	12.67746	0	12.91164	12.53167	11.51381	0	14.11335	7.952928	0	14.47518	0	13.81605	12.89293	12.01415	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11.042	0	17.23807	20.7523	14.25225	0	0	13.85382	7.565237	0	0	0	13.17351	0	13.01924	13.50985	0	0	0	0	13.88698	0	0	0	12.48266	0
A0A669C9A8	A0A669C9A8_ORENI			Neuronal PAS domain protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]	CRPALVPGSTRSVR	5.460000038	1557.579494	15.21456	13.67909	11.45376	12.18664	14.58949	13.83878	13.15154	14.56633	15.95755	13.31175	16.31927	13.91326	11.84118	12.68867	13.37795	13.51692	0	14.78637	0	15.44221	14.74662	0	10.81052	16.94353	12.61304	0	0	0	8.99849	11.38424	0	18.01595	13.49273	13.91531	13.80978	12.63045	0	0	13.76291	0	0	12.00726	15.93209	14.65328	14.64555	0	0	15.0014	13.49532	13.50855	11.0703	0	13.7381	14.54511
A0A669DWH6	A0A669DWH6_ORENI			Neuronal cell adhesion molecule a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		EKEDAHQDPEIQPMK	1.649999976	1795.581131	15.49873	16.09367	14.87557	0	0	14.82664	15.29696	13.14119	0	16.50913	14.33786	14.84294	0	16.73274	8.845055	14.2573	14.75801	14.36301	14.85649	15.27374	0	13.58859	15.94783	0	14.50819	14.63769	15.58755	0	0	16.90653	17.40998	15.56375	15.53755	16.14767	0	16.01259	0	0	0	0	0	0	0	0	0	0	0	15.91554	0	0	0	0	17.33331	0
I3JPI9	I3JPI9_ORENI			Neuronal pentraxin receptor a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KAHKPPSAYK	13.48999977	1126.390893	13.9733	13.84339	0	15.83928	0	14.20162	0	13.70659	12.51432	12.19127	16.05699	15.38032	14.39122	18.80076	12.15838	18.83693	20.30138	0	0	0	0	0	17.77945	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.23286	15.81339	0	14.9221	16.14923	0	0	0	17.66373	13.57673	0	0	0	0	19.84641	0
A0A669BLF2	A0A669BLF2_ORENI	NRP1	angiogenesis [GO:0001525]; animal organ morphogenesis [GO:0009887]; axon guidance [GO:0007411]; endothelial cell chemotaxis [GO:0035767]; vascular endothelial growth factor receptor signaling pathway [GO:0048010]	Neuropilin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; growth factor binding [GO:0019838]; heparin binding [GO:0008201]; metal ion binding [GO:0046872]; semaphorin receptor activity [GO:0017154]; vascular endothelial growth factor-activated receptor activity [GO:0005021]; angiogenesis [GO:0001525]; animal organ morphogenesis [GO:0009887]; axon guidance [GO:0007411]; endothelial cell chemotaxis [GO:0035767]; vascular endothelial growth factor receptor signaling pathway [GO:0048010]	growth factor binding [GO:0019838]; heparin binding [GO:0008201]; metal ion binding [GO:0046872]; semaphorin receptor activity [GO:0017154]; vascular endothelial growth factor-activated receptor activity [GO:0005021]	LLTGRSGWTGQSTK	4.650000095	1491.979248	0	12.11887	0	15.4718	0	14.20488	14.80996	13.5629	0	0	0	14.22747	0	0	15.28821	9.302941	15.19246	0	12.74824	0	14.65918	13.20134	0	0	0	0	0	0	0	0	21.80895	17.96131	22.89893	16.48466	15.75435	15.73807	0	0	0	15.23141	0	0	14.10502	0	0	0	0	0	0	0	15.66422	0	0	0
I3K602	I3K602_ORENI	LOC100694100		Neurotrypsin (Serine protease 12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]; membrane [GO:0016020]	extracellular space [GO:0005615]; membrane [GO:0016020]; scavenger receptor activity [GO:0005044]; serine-type endopeptidase activity [GO:0004252]	scavenger receptor activity [GO:0005044]; serine-type endopeptidase activity [GO:0004252]	LVGGLEEFEGR	8.539999962	1206.112986	0	0	0	0	15.11041	16.59266	13.58559	14.20259	11.28125	13.42747	15.47367	14.12644	12.95188	14.75784	0	12.33979	0	0	0	15.12201	0	0	0	0	0	12.36129	0	0	0	15.32623	13.63462	0	0	0	0	0	0	0	0	0	0	0	0	0	14.15371	0	0	14.72392	0	10.13439	15.06757	0	0	0
A0A669ERJ4	A0A669ERJ4_ORENI			Neutral sphingomyelinase (N-SMase) activation associated factor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VNSSAHK	4.730000019	740.4260416	15.83035	16.2514	17.37538	17.10294	17.84737	17.62047	16.41475	16.13065	16.87961	17.26205	17.85421	17.2018	15.67363	17.87781	16.2049	17.57687	17.22093	16.41499	19.07619	17.56976	16.20284	13.45814	17.06059	17.37176	16.77011	17.54268	17.65066	15.82111	17.39944	16.3609	16.72059	18.43714	16.93499	15.42739	17.98931	16.56652	18.05488	17.84075	17.845	16.54649	16.16228	17.87909	15.78731	14.54487	9.441554	13.9274	16.16979	16.72552	17.86618	16.30276	16.11505	16.58216	17.09182	17.34821
A0A3G1RS69	A0A3G1RS69_ORENI	NCF4	phagocytosis [GO:0006909]; respiratory burst [GO:0045730]	Neutrophil cytosol factor 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	NADPH oxidase complex [GO:0043020]	NADPH oxidase complex [GO:0043020]; phosphatidylinositol binding [GO:0035091]; superoxide-generating NADPH oxidase activator activity [GO:0016176]; phagocytosis [GO:0006909]; respiratory burst [GO:0045730]	phosphatidylinositol binding [GO:0035091]; superoxide-generating NADPH oxidase activator activity [GO:0016176]	DLLSRMR	27.93000031	905.3839879	18.90927	18.7921	18.96454	18.90096	18.755	18.68222	18.30979	18.0046	18.49984	18.5447	17.88482	17.11247	18.69008	18.4187	18.37041	18.56423	18.46391	18.37235	18.54444	18.19206	17.97473	18.10548	17.52046	17.80945	18.46425	18.18142	18.4297	17.92209	18.26719	17.50863	18.47034	17.61205	18.20756	18.13429	18.37801	18.32235	18.50896	18.33482	18.96216	18.69663	18.07218	18.62367	18.63686	18.64201	18.81287	18.45182	18.09107	18.66434	17.97235	17.56706	18.37633	18.76684	17.60298	17.65146
I3IZX5	I3IZX5_ORENI		axon guidance [GO:0007411]; cardiac muscle fiber development [GO:0048739]; cell adhesion [GO:0007155]	Nexilin (F actin binding protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; Z disc [GO:0030018]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; Z disc [GO:0030018]; axon guidance [GO:0007411]; cardiac muscle fiber development [GO:0048739]; cell adhesion [GO:0007155]		THVNGLEHK	1.820000052	1035.802245	0	13.37616	0	0	0	14.44403	13.37917	13.79597	15.0688	14.52252	0	13.89424	17.04512	11.31487	13.6516	0	0	14.71609	15.69776	0	12.68425	0	0	13.38393	0	0	15.5142	12.93852	13.83012	0	0	15.00064	15.12932	13.48233	9.892534	15.51725	14.80439	0	0	13.6183	16.31731	16.22133	0	0	0	0	0	0	14.16711	0	0	13.41964	0	17.0095
A0A669CSC7	A0A669CSC7_ORENI			Niban apoptosis regulator 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AVVLPK	4.190000057	626.9626452	14.85815	14.56428	13.13717	0	13.76186	0	12.45218	14.43215	0	16.69789	16.39465	15.8582	16.92854	0	0	13.47808	13.91746	14.65354	0	0	15.7891	0	16.13873	15.57579	0	0	0	19.23714	0	0	0	13.6696	0	15.36271	14.96643	0	0	0	0	0	0	0	0	0	0	0	0	13.65516	0	0	0	0	0	0
I3K1N7	I3K1N7_ORENI		cell-matrix adhesion [GO:0007160]; closure of optic fissure [GO:0061386]; fin regeneration [GO:0031101]	Nidogen 2a (osteonidogen)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	basement membrane [GO:0005604]; membrane [GO:0016020]	basement membrane [GO:0005604]; membrane [GO:0016020]; calcium ion binding [GO:0005509]; cell-matrix adhesion [GO:0007160]; closure of optic fissure [GO:0061386]; fin regeneration [GO:0031101]	calcium ion binding [GO:0005509]	ANLDGSGRR	9.170000076	946.2310699	13.32795	0	13.79309	14.13699	13.77474	13.09402	0	13.59189	12.50358	12.19162	14.31348	0	12.29517	12.02437	10.20786	12.53992	12.62583	12.72	14.61285	9.731761	15.29342	0	14.40702	13.86861	14.05631	12.67738	11.99047	10.83283	10.52606	15.28433	15.37836	15.34152	14.96134	14.24801	11.81588	12.30278	11.15028	12.47774	14.9666	13.78941	12.23143	13.39287	0	12.53488	12.01944	13.2958	13.62801	13.01368	14.45856	12.35428	0	10.43619	13.71006	0
A0A669EGU7	A0A669EGU7_ORENI	LOC100699860	cell cycle [GO:0007049]; regulation of gene expression [GO:0010468]	Nipped-B protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; chromatin binding [GO:0003682]; cell cycle [GO:0007049]; regulation of gene expression [GO:0010468]	chromatin binding [GO:0003682]	AVAGLKMSYQVQQAINGSK	2.960000038	2008.503473	13.13388	14.73959	8.653045	0	0	13.98063	14.9412	11.538	15.04226	17.491	14.03946	11.31681	12.91323	14.84786	0	16.79324	10.44145	0	13.71371	0	0	0	0	0	0	15.21779	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669CNR9	A0A669CNR9_ORENI			Nipsnap homolog 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NEESNLYK	3.809999943	996.4826917	0	0	11.20992	14.03351	0	12.9992	15.02943	13.47435	14.50102	11.76294	0	11.44193	12.64774	11.55873	15.01797	12.56127	0	14.39511	14.16069	14.00459	0	13.32966	0	0	12.99451	14.85958	0	15.9725	10.14788	0	14.60031	13.03518	16.64754	0	12.4717	8.790299	0	0	0	0	0	14.60785	12.13894	11.37369	14.56434	14.97412	0	0	0	0	11.49207	12.62453	12.65903	0
A0A669BRA8	A0A669BRA8_ORENI	nos1	nitric oxide biosynthetic process [GO:0006809]	Nitric oxide synthase (EC 1.14.13.39)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calmodulin binding [GO:0005516]; flavin adenine dinucleotide binding [GO:0050660]; FMN binding [GO:0010181]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; NADP binding [GO:0050661]; nitric-oxide synthase activity [GO:0004517]; nitric oxide biosynthetic process [GO:0006809]	calmodulin binding [GO:0005516]; flavin adenine dinucleotide binding [GO:0050660]; FMN binding [GO:0010181]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; NADP binding [GO:0050661]; nitric-oxide synthase activity [GO:0004517]	NLMEIFGKK	6.21999979	1078.814709	13.37068	14.5705	13.80662	15.46251	13.39776	0	17.29693	13.64676	13.77108	15.61828	14.42444	12.19028	12.69653	12.50616	13.32607	15.62329	15.20058	13.20257	0	0	14.90107	16.3255	13.65747	18.36564	14.42666	13.34124	14.49949	15.2518	17.79433	14.03153	0	9.818179	18.64733	14.4465	13.66099	0	14.47397	0	0	0	0	14.00788	0	0	13.884	15.11197	14.68702	13.93958	0	13.03368	15.56433	15.02675	0	14.6512
A0A669DFZ4	A0A669DFZ4_ORENI	rnf19b		RBR-type E3 ubiquitin transferase (EC 2.3.2.31)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]	metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]	AAGKR	2.940000057	501.5588189	15.54797	15.3475	16.21836	15.23443	14.34212	0	0	14.38524	15.54626	14.60794	15.88059	0	0	15.3427	13.89848	16.14739	15.26465	15.85863	0	13.5696	14.66795	14.22072	0	0	0	0	16.20229	14.15147	14.50045	0	19.05702	18.60629	0	15.98178	0	0	15.04059	16.0107	15.83505	14.73575	14.99702	15.87983	0	14.80042	0	0	15.76392	15.89852	0	0	0	0	0	0
A0A669BI40	A0A669BI40_ORENI	ptk2b	regulation of actin cytoskeleton reorganization [GO:2000249]; regulation of angiogenesis [GO:0045765]; regulation of bone mineralization [GO:0030500]; regulation of cell adhesion [GO:0030155]; regulation of cell population proliferation [GO:0042127]; regulation of leukocyte chemotaxis [GO:0002688]; signal complex assembly [GO:0007172]; signal transduction [GO:0007165]	Non-specific protein-tyrosine kinase (EC 2.7.10.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell projection [GO:0042995]; cytoskeleton [GO:0005856]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]; focal adhesion [GO:0005925]	cell projection [GO:0042995]; cytoskeleton [GO:0005856]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]; focal adhesion [GO:0005925]; ATP binding [GO:0005524]; non-membrane spanning protein tyrosine kinase activity [GO:0004715]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]; regulation of actin cytoskeleton reorganization [GO:2000249]; regulation of angiogenesis [GO:0045765]; regulation of bone mineralization [GO:0030500]; regulation of cell adhesion [GO:0030155]; regulation of cell population proliferation [GO:0042127]; regulation of leukocyte chemotaxis [GO:0002688]; signal complex assembly [GO:0007172]; signal transduction [GO:0007165]	ATP binding [GO:0005524]; non-membrane spanning protein tyrosine kinase activity [GO:0004715]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	DMNAKGLEK	10.61999989	1020.71473	9.915016	11.23077	13.76919	11.46401	12.98801	11.44901	14.07399	14.61647	14.16024	13.18829	14.47522	11.74752	13.66438	15.54273	13.03548	0	0	14.53871	13.5252	15.39128	11.99806	13.84975	15.74296	13.9657	14.95495	0	11.75441	0	11.2212	9.414449	11.28916	11.28046	15.58793	14.46779	17.09483	11.1047	14.23614	12.63805	0	14.69087	0	8.942006	13.49944	0	14.17945	14.78078	0	13.86775	0	15.75715	0	0	0	0
A0A669ECJ6	A0A669ECJ6_ORENI	LOC100695679	microtubule cytoskeleton organization [GO:0000226]	Non-specific serine/threonine protein kinase (EC 2.7.11.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	dendrite [GO:0030425]	dendrite [GO:0030425]; ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; microtubule cytoskeleton organization [GO:0000226]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	SASGDTK	4.340000153	665.1487998	16.11464	0	0	0	15.2077	14.29598	0	15.59479	16.06856	16.72698	0	0	0	16.21417	15.67454	17.35089	0	13.8328	13.23534	12.64911	13.99165	14.52587	19.04777	18.88706	15.37184	17.38923	0	14.48644	16.18664	14.077	0	0	18.24465	0	17.98805	0	14.27295	15.52142	0	12.43327	16.48585	11.38277	14.09401	15.6389	18.27276	11.51499	15.46078	14.8097	0	18.44457	17.27071	14.16346	0	0
I3KX47	I3KX47_ORENI	nop56	heart development [GO:0007507]; ribosome biogenesis [GO:0042254]	Nop domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]; heart development [GO:0007507]; ribosome biogenesis [GO:0042254]		VVSLAAYR	13.14000034	874.4249017	15.66107	18.22956	15.08558	0	16.44217	15.73378	14.47069	16.9954	16.80182	13.67722	15.45397	15.19756	17.70919	15.42373	14.26907	0	15.65562	15.90456	0	14.641	17.04873	14.50685	14.97257	11.46661	16.49845	0	16.98044	13.91869	15.44868	16.6672	12.8143	14.53598	12.10615	15.6016	15.63862	15.63357	14.31713	0	15.31429	15.16257	13.84252	14.17955	16.60336	0	12.85404	0	13.65621	0	0	17.70349	16.28918	16.12708	12.11398	14.6275
A0A669DPQ2	A0A669DPQ2_ORENI		Notch signaling pathway [GO:0007219]	Notchless protein homolog 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]; Notch signaling pathway [GO:0007219]		TGKYLMSLR	9.710000038	1083.539278	0	0	13.95211	0	17.54924	18.39609	13.0225	14.43558	12.26603	11.86736	10.68413	0	14.98798	14.62425	18.57896	14.08436	10.08318	14.41151	13.25462	0	0	14.05695	0	0	0	0	13.51696	0	0	0	15.9886	0	16.74929	14.07911	12.67299	0	16.07363	13.17242	11.73113	0	0	8.83017	0	11.92772	13.29807	15.12419	14.05025	13.50227	16.30189	12.6241	14.72345	13.72185	0	0
I3IW17	I3IW17_ORENI		notochord cell development [GO:0060035]; notochord morphogenesis [GO:0048570]	Notochord granular surface	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	intermediate filament [GO:0005882]	intermediate filament [GO:0005882]; structural constituent of cytoskeleton [GO:0005200]; notochord cell development [GO:0060035]; notochord morphogenesis [GO:0048570]	structural constituent of cytoskeleton [GO:0005200]	AFMLTRTQEK	7.010000229	1239.094726	0	0	0	0	0	15.71524	0	15.16086	0	0	14.10299	0	14.23945	11.19697	0	13.08018	0	0	0	12.96408	0	0	16.69784	0	0	0	0	0	0	0	0	19.96358	19.73123	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KFL7	I3KFL7_ORENI	LOC100707906	apoptotic process [GO:0006915]	Nuclear apoptosis-inducing factor 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; apoptotic process [GO:0006915]		GVPTDMK	2.650000095	748.2328822	0	17.12377	16.04321	0	0	0	22.02529	20.609	19.345	20.83264	0	16.47184	0	0	16.84631	18.39808	0	0	0	0	0	14.60862	0	0	0	0	16.14519	0	0	16.40123	0	0	0	13.41581	0	16.12147	15.81988	14.84026	15.29166	0	13.9683	0	0	0	0	0	0	0	0	15.02298	0	0	0	17.223
A0A669EIY4	A0A669EIY4_ORENI	LOC100702413	"mRNA cis splicing, via spliceosome [GO:0045292]"	Nuclear cap-binding protein subunit 2 (20 kDa nuclear cap-binding protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nuclear cap binding complex [GO:0005846]; nucleus [GO:0005634]	"nuclear cap binding complex [GO:0005846]; nucleus [GO:0005634]; RNA cap binding [GO:0000339]; mRNA cis splicing, via spliceosome [GO:0045292]"	RNA cap binding [GO:0000339]	RIIIGLDK	3.75999999	926.250162	0	0	15.95174	0	0	15.49712	0	0	0	0	0	15.18728	0	14.34375	15.21896	16.19873	0	0	13.26166	0	13.62674	14.99365	14.8959	14.00269	0	0	14.65014	0	0	16.44628	0	0	15.98597	15.06941	15.01918	0	0	16.07028	14.97469	0	13.46463	13.37398	16.30095	16.65482	0	0	15.57337	15.29523	0	15.57872	13.05965	16.25145	0	14.22887
I3JKH5	I3JKH5_ORENI	ncbp3		Nuclear cap-binding protein subunit 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		mRNA binding [GO:0003729]; RNA 7-methylguanosine cap binding [GO:0000340]	mRNA binding [GO:0003729]; RNA 7-methylguanosine cap binding [GO:0000340]	SPSPLSPR	6.510000229	839.3330417	12.14007	13.18139	0	13.5328	13.87273	15.75406	13.57901	15.20957	15.31103	15.68381	0	14.51508	12.89334	15.39898	11.91095	0	0	14.4845	13.49816	0	0	16.81457	14.93092	15.92827	0	14.17972	13.48665	13.98927	11.62818	11.22708	0	15.60347	15.24082	15.84167	14.67427	14.64741	12.73732	15.08448	0	13.91543	13.7753	12.92201	14.88556	14.31291	13.01996	8.876521	14.99246	14.4582	0	15.95284	14.90271	0	15.27885	15.31499
I3JAD1	I3JAD1_ORENI		DNA replication [GO:0006260]	Nuclear factor 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; DNA replication [GO:0006260]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	RLADSVMAGK	3.369999886	1063.259508	12.20508	12.91684	9.23243	15.24286	12.28373	13.3391	13.3294	12.82791	0	15.70346	13.51539	0	0	14.35282	15.42769	15.17918	0	9.782001	0	0	14.35473	0	0	0	0	0	0	0	0	14.33876	0	0	13.41079	13.77637	14.27644	0	0	0	15.967	0	0	0	15.3182	0	15.30462	13.36863	11.37882	15.04863	15.20804	0	0	0	0	0
I3KC48	I3KC48_ORENI		heart development [GO:0007507]; transcription by RNA polymerase II [GO:0006366]	Nuclear factor of activated T cells 5a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; heart development [GO:0007507]; transcription by RNA polymerase II [GO:0006366]	DNA-binding transcription factor activity [GO:0003700]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]	ILVQPETQHRAR	5.380000114	1447.765766	12.64052	0	14.09347	0	13.51719	13.75819	0	0	0	13.45807	13.6877	13.77151	8.650726	0	11.60111	12.2559	14.53133	13.66838	9.699258	12.74647	12.9142	13.94394	13.63982	0	14.10319	14.3829	13.75255	0	0	11.76499	0	0	23.29803	17.75493	13.4718	0	0	12.60827	0	9.162437	14.24594	0	0	0	0	0	0	0	0	0	0	0	0	13.67207
A0A669F9B9	A0A669F9B9_ORENI		regulation of transcription by RNA polymerase II [GO:0006357]	Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; regulation of transcription by RNA polymerase II [GO:0006357]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	RVQSAEHPGGGAAR	11.59000015	1392.108014	0	16.90633	0	0	0	18.71058	0	0	0	16.87943	17.47879	0	18.01373	16.37894	15.81203	15.97014	14.71497	16.63716	0	17.23381	16.5047	0	0	0	0	16.4671	16.58934	0	0	17.47841	17.3743	0	17.18733	15.9573	16.7114	16.11361	16.55587	0	15.20817	16.25501	15.24814	15.86213	0	16.90728	17.43927	17.35869	16.94471	0	15.65612	16.1105	0	0	0	7.399478
A0A669C6H1	A0A669C6H1_ORENI		signal transduction [GO:0007165]	Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; signal transduction [GO:0007165]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	GSQMFGVKGHR	13.27999973	1204.035548	11.69222	13.31367	9.144648	13.27245	10.672	0	14.06668	0	14.44015	0	0	14.95843	0	0	13.67783	0	14.76292	12.32251	10.43165	0	0	18.14856	12.28785	14.26026	13.06357	11.95208	0	12.43194	0	0	12.4502	16.0525	10.76351	12.29575	0	9.96097	9.651114	0	13.22569	15.93994	11.75839	15.00274	13.70878	0	0	13.4759	12.07025	14.3308	14.66031	0	0	0	14.71384	14.94337
A0A669BL51	A0A669BL51_ORENI	nup85	mRNA transport [GO:0051028]; protein transport [GO:0015031]	Nuclear pore complex protein Nup85	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nuclear membrane [GO:0031965]; nuclear pore outer ring [GO:0031080]	nuclear membrane [GO:0031965]; nuclear pore outer ring [GO:0031080]; structural constituent of nuclear pore [GO:0017056]; mRNA transport [GO:0051028]; protein transport [GO:0015031]	structural constituent of nuclear pore [GO:0017056]	KDEDIYSPILR	9.680000305	1349.432272	14.28083	13.20982	12.53223	13.15122	10.94208	13.22467	12.13418	13.32248	11.84903	12.9603	13.13315	12.37996	0	13.86506	14.66692	14.93903	11.29326	0	14.36125	12.60691	13.61077	10.4421	16.47688	0	15.39178	16.4789	14.92846	0	14.12334	0	0	17.08413	0	11.60837	11.76488	12.72863	10.59331	12.33153	16.6292	0	13.7908	11.29981	14.8974	0	0	0	12.7802	11.22975	11.62458	17.29216	17.83777	13.23657	18.17017	13.3128
I3KNM1	I3KNM1_ORENI	mdm1	negative regulation of centriole replication [GO:0046600]	Nuclear protein MDM1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centriole [GO:0005814]; cytoplasm [GO:0005737]; nucleus [GO:0005634]	centriole [GO:0005814]; cytoplasm [GO:0005737]; nucleus [GO:0005634]; microtubule binding [GO:0008017]; negative regulation of centriole replication [GO:0046600]	microtubule binding [GO:0008017]	CMPLAGLRSDQMGVSR	4.920000076	1811.774288	0	0	0	0	0	0	14.81017	0	16.36848	0	0	0	0	17.74288	11.72911	0	15.11265	0	0	15.58266	0	16.50915	0	0	0	0	14.58625	0	0	0	15.29955	0	0	12.83288	0	0	0	0	0	0	15.37757	0	0	16.39364	0	0	0	0	0	17.52758	0	0	0	0
A0A669F234	A0A669F234_ORENI			Nuclear receptor binding SET domain protein 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]; nucleus [GO:0005634]	chromosome [GO:0005694]; nucleus [GO:0005634]; histone-lysine N-methyltransferase activity [GO:0018024]; metal ion binding [GO:0046872]	histone-lysine N-methyltransferase activity [GO:0018024]; metal ion binding [GO:0046872]	MLMYECHPQVCAAGDR	2.799999952	1954.538263	0	0	0	13.50687	12.87191	14.4509	0	0	13.67577	14.01974	13.54934	13.81865	14.14603	0	13.05613	0	16.68937	13.29137	12.23148	11.28498	13.36681	14.43567	13.4424	0	0	0	14.8202	12.24792	0	0	0	0	0	0	14.50886	0	13.6535	0	0	11.81446	14.1171	0	0	13.77629	12.53571	10.80065	13.94082	12.84548	12.89046	15.01195	0	17.66021	0	9.226591
A0A669CDV9	A0A669CDV9_ORENI			Nuclear receptor binding SET domain protein 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]; nucleus [GO:0005634]	chromosome [GO:0005694]; nucleus [GO:0005634]; histone-lysine N-methyltransferase activity [GO:0018024]; metal ion binding [GO:0046872]	histone-lysine N-methyltransferase activity [GO:0018024]; metal ion binding [GO:0046872]	VMDSKGSSLPSMPEPANPISMK	7.179999828	2318.662607	0	14.3394	14.88182	13.61958	12.58808	0	15.66579	12.47851	12.97906	0	0	14.09394	15.33837	0	0	10.59406	13.78534	0	12.65533	0	14.79629	13.67649	13.59497	0	0	14.69908	12.37044	14.67339	0	0	0	17.69591	0	0	13.78915	0	12.94251	0	0	17.23174	14.273	14.31797	0	12.90252	0	0	18.10162	17.20611	15.63516	0	0	13.50933	14.25556	12.61362
A0A669F760	A0A669F760_ORENI			Nuclear receptor binding SET domain protein 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]; nucleus [GO:0005634]	chromosome [GO:0005694]; nucleus [GO:0005634]; histone-lysine N-methyltransferase activity [GO:0018024]; metal ion binding [GO:0046872]	histone-lysine N-methyltransferase activity [GO:0018024]; metal ion binding [GO:0046872]	SAQSPVR	2.049999952	744.3392909	17.84382	0	0	14.2201	0	13.4025	14.40995	0	0	15.17958	15.28642	0	0	0	0	0	14.54276	15.19734	0	0	0	0	17.38229	15.65145	15.27845	12.58696	0	0	13.36116	0	0	0	16.02955	0	8.033007	0	11.99924	0	0	0	0	0	13.96832	14.47365	0	13.77864	0	0	0	0	0	0	0	0
I3JJE7	I3JJE7_ORENI		cellular iron ion homeostasis [GO:0006879]; erythrocyte differentiation [GO:0030218]	Nuclear receptor coactivator 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		transcription coactivator activity [GO:0003713]; cellular iron ion homeostasis [GO:0006879]; erythrocyte differentiation [GO:0030218]	transcription coactivator activity [GO:0003713]	ESKQTSCPEMASMDFMK	5.809999943	2053.723011	13.08182	12.96192	12.0955	0	10.38204	11.22971	0	13.87856	0	14.60521	15.63701	14.48065	15.01679	14.07233	14.09413	10.84646	13.95111	10.79338	11.80621	0	0	0	0	0	0	0	0	0	12.86529	0	16.67826	16.42316	14.10216	12.93702	0	0	12.88988	14.11545	12.12799	0	0	14.02849	15.24274	0	11.84312	14.48289	12.61827	0	13.60115	0	0	15.66263	13.7918	0
I3K2D1	I3K2D1_ORENI	NR4A2		Nuclear receptor subfamily 4 group A member 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; nuclear receptor activity [GO:0004879]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	nuclear receptor activity [GO:0004879]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	IPGFTSLPK	5.579999924	959.376262	0	0	13.21941	0	0	14.97592	0	12.87645	13.21088	12.65183	13.54554	0	0	0	13.0653	13.19338	0	0	0	14.1227	0	0	0	16.78705	13.88829	11.98939	13.74208	13.44697	12.90158	0	0	0	14.76765	0	0	0	15.26193	13.67795	0	0	0	0	0	0	0	12.00682	0	0	0	0	0	12.916	14.50219	0
A0A669EI88	A0A669EI88_ORENI	ncoa6		Nucleic_acid_bd domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; transcription coactivator activity [GO:0003713]	transcription coactivator activity [GO:0003713]	DVMGKDSPK	10.03999996	993.7973013	0	14.15315	0	12.19652	0	0	0	16.47755	14.92096	14.94119	15.29445	14.61632	10.0568	16.505	15.64342	17.59514	14.48252	15.21273	16.55563	17.84411	16.48061	16.11628	15.5151	0	0	15.76683	0	7.634808	16.2811	0	15.11249	14.2467	15.25304	12.30635	14.89395	16.21554	16.21927	15.78491	14.12469	0	0	14.77214	16.68966	0	16.65201	16.24917	13.82293	16.38288	14.17311	13.91289	14.10101	16.55833	13.93822	18.0044
A0A669E5N4	A0A669E5N4_ORENI		ribosome biogenesis [GO:0042254]	Nucleolar GTP-binding protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]; GTP binding [GO:0005525]; ribosome biogenesis [GO:0042254]	GTP binding [GO:0005525]	AALGRMCTILK	8.319999695	1234.198162	14.44322	0	9.718766	13.08677	0	10.09765	12.14508	7.290644	13.58888	13.44874	10.72121	12.30728	0	12.19733	15.23861	0	13.8119	10.85431	14.48024	14.1799	14.31268	11.76008	13.42231	12.40912	14.38309	11.07018	8.33674	10.62866	11.42941	18.57605	13.0266	14.44647	0	0	13.11102	0	13.66412	12.21648	12.56772	14.08788	7.252842	0	0	0	0	10.45855	7.250915	4.049391	0	0	0	14.44027	0	12.92365
A0A669EVA2	A0A669EVA2_ORENI	znf330		Nucleolar autoantigen 36 (Zinc finger protein 330)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]; zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	DLSMSTR	3.880000114	825.6794738	14.58122	12.67138	13.78841	12.13812	12.80903	0	13.97883	13.8602	14.27199	0	13.08787	0	12.29952	14.27233	14.43036	0	13.73667	0	14.72319	15.05174	15.34569	0	12.96806	15.22368	12.49134	0	14.39371	12.89221	0	13.20951	16.63281	17.35726	16.29326	13.79474	0	0	0	15.31425	13.04507	0	14.78717	15.41551	0	15.08956	0	13.75433	0	0	0	0	14.66813	16.28358	0	0
A0A669DYG9	A0A669DYG9_ORENI	noc2l		Nucleolar complex protein 2 homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		MEDLNLPEIKR	13.19999981	1358.047588	0	15.12179	0	13.75857	14.84123	0	0	16.61504	0	0	15.11858	13.37319	15.05983	0	16.6421	0	0	16.01893	0	0	0	14.4755	15.38874	15.89265	0	0	15.41014	0	15.5918	13.82879	0	0	0	0	0	0	0	14.33339	0	0	15.40647	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KU20	I3KU20_ORENI	nol10		Nucleolar protein 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]		NTVLVER	6.940000057	831.0774227	13.4785	14.96211	0	14.92731	14.70594	14.33187	0	14.08829	14.47673	15.20993	14.46961	16.10697	0	14.28953	0	15.30437	14.98738	15.27549	0	14.48807	13.43102	15.26789	15.93622	12.55246	12.80104	14.33316	14.62799	15.58315	14.2954	15.0239	15.13434	14.43704	15.75636	15.08791	15.27117	14.53473	0	0	0	14.29609	13.4529	0	0	13.70916	14.6478	15.29518	14.49022	14.6202	0	0	0	13.07822	0	13.15823
A0A669E9R1	A0A669E9R1_ORENI	nol6		Nucleolar protein 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; nucleolus [GO:0005730]	integral component of membrane [GO:0016021]; nucleolus [GO:0005730]; RNA binding [GO:0003723]	RNA binding [GO:0003723]	YVGAMVDDVIK	4.550000191	1209.918737	14.16963	0	13.0161	0	16.29381	0	13.21837	13.5417	0	13.56794	0	12.90331	0	0	0	14.8104	0	0	0	15.81613	0	0	0	0	0	13.04256	10.4352	0	0	0	0	0	14.90141	0	0	0	15.7928	15.69341	0	0	0	15.38579	0	0	0	14.19593	0	0	0	16.5326	17.4122	0	15.74577	0
A0A669F8N5	A0A669F8N5_ORENI	LOC100694797	protein import into nucleus [GO:0006606]	Nucleoprotein TPR	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; protein import into nucleus [GO:0006606]		ETQTSADQR	6.239999771	1035.957881	14.28713	13.29128	14.38629	11.6921	13.54563	13.42601	15.19887	13.95332	0	0	0	14.45592	11.7061	12.919	14.01538	18.56011	0	18.25765	11.36943	13.01464	0	0	9.839674	14.77931	11.33073	0	0	0	0	11.9945	15.50817	0	15.31254	10.76166	13.86637	14.81551	15.36748	14.55754	12.75591	15.14867	13.84607	14.64406	9.262192	0	14.39278	16.50579	13.37101	12.91981	13.59921	12.51074	18.16799	14.91149	7.297355	11.26938
A0A669E7S6	A0A669E7S6_ORENI	nme6	cell cycle [GO:0007049]; CTP biosynthetic process [GO:0006241]; GTP biosynthetic process [GO:0006183]; UTP biosynthetic process [GO:0006228]	Nucleoside diphosphate kinase (EC 2.7.4.6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; lamellipodium [GO:0030027]; nucleus [GO:0005634]; ruffle [GO:0001726]	cytoplasm [GO:0005737]; lamellipodium [GO:0030027]; nucleus [GO:0005634]; ruffle [GO:0001726]; ATP binding [GO:0005524]; nucleoside diphosphate kinase activity [GO:0004550]; cell cycle [GO:0007049]; CTP biosynthetic process [GO:0006241]; GTP biosynthetic process [GO:0006183]; UTP biosynthetic process [GO:0006228]	ATP binding [GO:0005524]; nucleoside diphosphate kinase activity [GO:0004550]	MLLTSARLSK	2.279999971	1118.999425	0	0	16.19903	13.42027	14.81105	0	13.3337	13.34353	0	11.31005	15.95892	0	15.96752	15.55746	14.51293	0	0	0	16.11958	13.97899	15.10287	11.00599	12.2485	15.72772	12.95467	15.4708	15.38027	16.64204	17.02359	0	16.7931	16.99875	0	14.91746	16.15227	15.75576	15.14383	0	13.74634	13.76623	0	15.56378	14.98843	0	0	19.54424	20.54207	19.69662	0	0	15.72195	16.74943	0	15.80183
A0A669C560	A0A669C560_ORENI	LOC100705759		Nucleoside-diphosphate kinase (EC 2.7.4.6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		adenylate kinase activity [GO:0004017]; ATP binding [GO:0005524]; cytidylate kinase activity [GO:0004127]; nucleoside diphosphate kinase activity [GO:0004550]	adenylate kinase activity [GO:0004017]; ATP binding [GO:0005524]; cytidylate kinase activity [GO:0004127]; nucleoside diphosphate kinase activity [GO:0004550]	NHHSLEK	14.65999985	862.9914936	14.58082	14.33549	16.79777	14.47234	11.77069	15.431	13.21787	14.70227	14.11109	0	13.0607	14.67669	0	14.65291	15.05562	15.83421	0	0	15.40207	0	0	0	0	0	0	0	0	0	15.51056	15.97904	0	0	17.39108	0	0	15.86756	15.28981	0	15.78602	0	16.8899	0	16.08454	0	0	16.91822	16.07584	0	15.74009	17.31737	15.73357	0	0	0
A0A669B8T7	A0A669B8T7_ORENI			NudC domain-containing protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]		GEGPMWPELVMGDK	11.30000019	1561.038953	17.20791	12.7248	0	13.32568	10.02422	13.88302	14.70463	9.94889	14.63549	9.344856	0	13.26523	0	0	11.86757	0	0	0	15.85828	0	16.3257	0	15.59698	15.13672	15.39184	0	14.92393	0	13.4415	14.5193	0	0	14.4508	0	13.82063	0	14.78442	0	13.40095	11.85953	0	14.14055	0	14.12929	0	12.14972	0	12.24536	0	14.73544	14.90023	0	15.32178	0
A0A669DRB0	A0A669DRB0_ORENI	nudc		Nudc_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KNDDEMDFSK	17.25	1243.908018	0	12.72867	0	9.882632	10.82094	11.46266	14.076	13.82166	0	9.336825	9.495836	11.36706	10.65206	0	0	11.48196	14.24999	9.080966	12.8519	0	0	0	0	0	10.69716	13.95157	14.36066	13.73179	0	0	0	0	13.68089	0	13.40261	0	0	0	0	0	14.38807	0	0	15.48636	10.90317	15.57061	11.93102	13.79436	0	13.34252	0	12.21141	10.75195	0
A0A669BXG0	A0A669BXG0_ORENI	dcp2	"deadenylation-dependent decapping of nuclear-transcribed mRNA [GO:0000290]; nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]"	Nudix hydrolase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"m7G(5')pppN diphosphatase activity [GO:0050072]; manganese ion binding [GO:0030145]; RNA binding [GO:0003723]; deadenylation-dependent decapping of nuclear-transcribed mRNA [GO:0000290]; nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]"	m7G(5')pppN diphosphatase activity [GO:0050072]; manganese ion binding [GO:0030145]; RNA binding [GO:0003723]	GKVNEDEAPNDCAVR	9.460000038	1674.60319	11.6289	0	11.49908	14.36503	0	13.95757	13.66967	0	0	13.69762	14.84952	13.32159	12.52247	0	0	0	0	0	12.90824	13.29062	13.74496	14.80163	14.59976	13.21562	15.70804	13.03528	13.58526	14.96349	9.865441	0	15.43098	0	13.49852	14.79499	0	0	11.45387	13.75411	10.74231	12.20572	10.42108	12.61852	0	11.82865	0	0	0	0	15.41263	12.36723	14.76368	13.71904	16.13273	0
I3KCK6	I3KCK6_ORENI			Nup214_FG domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				IEPQPPK	25.78000069	808.6816329	18.90239	19.60496	19.9744	0	19.92604	19.0297	20.52436	19.22517	20.77494	18.94616	17.97613	20.0502	18.81054	19.29028	17.80978	17.91346	19.75307	19.67964	17.599	19.23203	18.88083	19.32623	18.59904	19.07305	0	18.90478	16.76051	18.36605	18.03257	19.15653	20.03509	17.9396	0	19.4428	18.34814	18.49382	0	0	20.09617	19.67727	19.0431	0	0	18.32534	21.02575	0	18.61043	19.34323	0	18.96049	0	17.01192	0	19.45611
A0A669DVF3	A0A669DVF3_ORENI	LOC100691083	triglyceride biosynthetic process [GO:0019432]	O-acyltransferase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; diacylglycerol O-acyltransferase activity [GO:0004144]; retinol O-fatty-acyltransferase activity [GO:0050252]; triglyceride biosynthetic process [GO:0019432]	diacylglycerol O-acyltransferase activity [GO:0004144]; retinol O-fatty-acyltransferase activity [GO:0050252]	SETAETRGPVTR	11.22000027	1302.210288	14.98664	0	0	7.639606	0	0	13.50598	0	0	0	0	12.17969	11.94126	0	10.66642	0	12.68847	11.66408	0	10.07173	0	12.33769	15.19657	0	11.82031	0	0	17.61108	12.78786	0	15.29782	18.04924	0	9.154906	12.44219	0	13.08588	18.13936	12.07969	0	9.502001	0	0	11.72529	13.88249	0	13.72549	0	0	0	14.6469	17.20314	9.41389	11.11105
A0A669E0E7	A0A669E0E7_ORENI	LOC106098040		OGFr_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; opioid receptor activity [GO:0004985]	opioid receptor activity [GO:0004985]	AARDMQNYR	6.809999943	1125.422787	0	13.98254	18.44835	14.93379	19.72031	19.55887	19.31071	0	17.25288	0	18.63143	17.08733	18.85859	0	0	0	14.79059	16.22168	12.8589	0	16.62624	13.96083	0	0	16.85517	0	16.17445	15.41578	16.09598	13.46204	15.69048	0	0	0	0	0	0	0	0	0	16.08095	0	12.57458	0	0	0	15.66248	0	0	0	13.87714	0	0	0
I3JV07	I3JV07_ORENI	LOC100697248	bicellular tight junction assembly [GO:0070830]	Occludin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	bicellular tight junction [GO:0005923]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	bicellular tight junction [GO:0005923]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; bicellular tight junction assembly [GO:0070830]		DVEDWVNNVEESR	6.130000114	1590.164432	14.57567	13.6037	13.79376	0	14.70343	14.39417	15.9801	0	0	14.67186	17.35106	15.78566	14.03355	0	15.42779	0	0	0	16.48637	15.31705	0	0	17.04473	17.7945	0	0	0	0	0	15.12269	14.46344	0	13.92192	13.20637	9.400063	13.52798	0	10.58632	0	0	14.30654	15.15221	14.75775	11.7292	14.82737	13.88676	0	12.48069	15.14053	14.14357	16.13766	0	0	0
A0A669BS77	A0A669BS77_ORENI		transmembrane transport [GO:0055085]	Oculocutaneous albinism II	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transport [GO:0055085]		INPASREETAVK	10.35999966	1313.289433	14.78183	16.48292	0	12.11651	0	0	0	0	14.08558	0	17.06181	17.44797	16.53495	0	0	15.15754	0	0	14.00297	0	0	0	0	14.58571	0	0	0	0	0	14.15444	0	0	0	0	0	0	0	0	0	0	13.47897	0	14.94405	14.18577	0	0	13.61567	0	0	0	0	16.0564	0	14.20868
I3JXR1	I3JXR1_ORENI	LOC100703406		Olfactomedin-like domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				FNVGIFMK	9.020000458	972.691587	0	14.51383	15.45012	15.15451	15.4325	14.87574	14.34555	14.33862	0	0	0	0	15.55356	0	14.37282	15.50274	15.39123	16.32099	15.31417	0	14.55768	15.15109	13.74792	0	15.88351	14.48916	15.96333	15.66394	15.03122	15.00271	16.3931	15.29649	15.29444	15.50472	13.69171	14.44668	15.35234	14.14115	0	15.51685	0	15.93744	15.09831	14.28908	14.33898	15.31954	16.20356	15.87768	0	14.38319	13.44047	0	0	13.77815
I3KKT8	I3KKT8_ORENI	LOC100710542		Olfactory receptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	YLAICCPLQYHTRMSSSK	4.460000038	2229.969179	0	15.11152	13.53369	11.44994	11.61858	12.79799	11.17601	12.54124	13.21174	0	14.43859	12.67348	0	0	0	2.035744	10.93962	12.47542	17.44044	14.8136	9.918795	0	15.49396	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KKC8	I3KKC8_ORENI			Opioid growth factor receptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; opioid receptor activity [GO:0004985]	opioid receptor activity [GO:0004985]	KEADETLQESMSATNGSLMK	5.510000229	2186.605869	11.65206	12.44526	10.30352	8.42048	13.52899	13.15878	13.7337	11.91313	13.12414	0	0	9.709332	14.88182	14.61949	0	12.908	13.95041	12.32192	0	11.15311	0	15.00673	8.214458	0	14.833	13.19399	15.20904	0	12.90097	14.42098	15.89147	14.77495	0	0	11.92299	10.89046	11.88731	10.33864	14.57475	13.96056	0	14.264	0	11.02124	13.61511	14.39667	14.38365	8.319487	16.12118	16.22692	0	13.63917	14.61334	14.17075
I3K916	I3K916_ORENI		phototransduction [GO:0007602]; protein-chromophore linkage [GO:0018298]; visual perception [GO:0007601]	Opsin 4xa	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; G protein-coupled receptor activity [GO:0004930]; photoreceptor activity [GO:0009881]; phototransduction [GO:0007602]; protein-chromophore linkage [GO:0018298]; visual perception [GO:0007601]	G protein-coupled receptor activity [GO:0004930]; photoreceptor activity [GO:0009881]	KSQSQEQLR	1.730000019	1103.75371	14.19592	15.35087	11.30158	0	0	13.23893	15.03708	17.23205	0	0	0	15.55489	0	0	13.76622	0	0	15.42941	16.37613	0	0	0	0	0	16.00628	17.45092	14.3169	0	14.39921	0	14.53743	16.98935	14.6551	0	12.73908	0	13.64057	14.48194	0	15.41124	0	0	15.25255	13.45729	14.93095	13.09576	16.0886	15.04311	0	16.56817	0	0	0	0
A0A669DWT3	A0A669DWT3_ORENI			Osteoclast stimulatory transmembrane protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		ASQMLK	3.289999962	693.5942505	0	14.3671	13.50076	14.43553	15.07197	14.45167	12.18654	0	12.96993	13.4786	13.37986	0	14.69717	14.56309	15.11071	0	13.93581	13.13316	15.58885	14.9078	14.42995	0	14.45068	15.72139	14.5373	13.31153	15.36828	14.48342	14.02891	15.17513	17.58144	19.17558	17.76272	12.71683	14.73979	0	13.92352	13.93861	13.5923	0	13.43342	0	0	0	0	0	0	0	15.63913	0	0	0	14.37621	14.71825
A0A669AZN0	A0A669AZN0_ORENI			Otoferlin b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	LSRGPGLPASPPISLTYMMK	5.099999905	2132.6908	13.90314	0	9.765833	11.83444	15.15433	14.176	14.15561	15.74035	13.58602	12.72285	7.82295	14.17573	0	12.22371	14.74633	12.80523	12.94893	0	12.3063	0	10.66311	12.8202	11.72799	14.30043	14.9738	12.42202	0	11.48368	14.51966	13.18741	16.70345	0	15.39034	14.55334	8.247842	7.134336	14.34175	13.28547	14.17024	11.08786	12.3719	13.45118	13.6054	12.69307	14.07915	10.53907	14.23732	11.18544	13.97723	14.82171	14.52875	0	13.22925	0
A0A669C377	A0A669C377_ORENI	oaf		Out at first protein homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MFASCISAAPGRILTR	10.89000034	1748.612433	0	0	0	0	0	0	13.66375	0	12.51486	0	0	0	0	12.85644	0	0	0	0	0	14.38147	0	0	12.29548	0	0	0	0	0	0	0	0	0	0	21.29895	0	0	0	0	0	0	0	0	0	0	0	0	13.38594	20.958	0	0	0	0	0	0
I3JZ79	I3JZ79_ORENI			Outer dense fiber of sperm tails 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]	cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]		MLMEAEVNGAAAAK	4.110000134	1421.631652	0	13.29384	13.66319	15.2317	15.08522	16.28712	0	13.33968	16.79983	16.88784	16.65064	16.2219	15.50382	15.96062	14.45395	15.51221	16.01189	15.72614	14.9022	16.2775	0	17.25531	0	0	17.36636	0	15.53855	0	13.292	13.86811	16.33164	17.21825	16.31549	0	0	0	14.69193	14.60503	14.18794	15.72726	16.03429	15.37387	0	15.2465	15.06069	0	15.62324	14.70627	15.17077	16.84574	14.76784	16.50432	15.7393	16.37055
I3K019	I3K019_ORENI		tricarboxylic acid cycle [GO:0006099]	Oxoglutarate (alpha-ketoglutarate) dehydrogenase b (lipoamide)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		oxoglutarate dehydrogenase (succinyl-transferring) activity [GO:0004591]; thiamine pyrophosphate binding [GO:0030976]; tricarboxylic acid cycle [GO:0006099]	oxoglutarate dehydrogenase (succinyl-transferring) activity [GO:0004591]; thiamine pyrophosphate binding [GO:0030976]	ALSANP	4.519999981	573.0536114	14.99599	13.94014	13.36663	13.79534	14.02936	13.79991	14.14816	14.91602	14.10655	17.40047	14.3177	15.09303	14.63496	16.04173	15.36522	13.8094	12.78461	14.62816	15.19626	15.04008	0	14.21711	0	13.3478	15.13482	14.80286	0	14.37969	14.42268	0	0	16.76083	0	15.68487	14.13807	0	17.04405	15.03059	14.111	15.71685	13.58635	15.35212	14.83208	14.33715	0	14.57516	0	16.14353	16.48093	0	13.61041	0	0	15.47382
A0A669DJ21	A0A669DJ21_ORENI	LOC100689819	lipid transport [GO:0006869]	Oxysterol-binding protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		lipid binding [GO:0008289]; lipid transport [GO:0006869]	lipid binding [GO:0008289]	QLRPGMDLSKVVLPTFILEPR	12.77000046	2410.032347	12.92584	6.387395	0	8.924658	10.4209	12.64411	16.50226	13.77123	0	0	11.53265	10.79434	11.49309	10.5031	0	11.74849	8.134956	12.05257	0	10.11283	0	17.10077	17.9598	0	0	13.39469	15.02191	13.3101	0	0	0	0	13.51036	13.84645	11.92173	12.37613	13.43115	11.91472	13.05928	12.17998	0	11.38873	11.89063	16.59667	12.37203	0	10.93437	0	7.546378	0	0	0	0	0
I3K2B4	I3K2B4_ORENI	LOC100701459	copper ion transport [GO:0006825]	P-type Cu(+) transporter (EC 7.2.2.8)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled cation transmembrane transporter activity [GO:0019829]; copper ion binding [GO:0005507]; copper ion transport [GO:0006825]	ATPase-coupled cation transmembrane transporter activity [GO:0019829]; ATP binding [GO:0005524]; copper ion binding [GO:0005507]	VDYDASVIPTK	10	1207.796707	12.38589	13.06509	0	14.97908	0	13.14211	13.40924	12.67062	11.90879	14.73695	9.123424	0	6.00231	15.16573	12.29792	14.50205	0	8.637629	13.92992	11.79095	14.34125	13.18989	0	12.1527	0	15.45627	0	14.11114	0	0	0	15.56208	0	17.15775	13.28762	16.87434	15.79912	13.59801	0	0	12.62877	12.55197	0	12.61048	13.31588	0	0	0	0	20.47289	0	0	0	15.01209
A0A669DWE0	A0A669DWE0_ORENI	atp8b1	phospholipid transport [GO:0015914]	P-type phospholipid transporter (EC 7.6.2.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled intramembrane lipid transporter activity [GO:0140326]; magnesium ion binding [GO:0000287]; phospholipid transport [GO:0015914]	ATPase-coupled intramembrane lipid transporter activity [GO:0140326]; ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]	LSPNSKHK	1.889999986	911.2990203	0	15.04655	13.36538	0	13.09564	0	0	15.5009	13.27481	13.35508	14.44617	13.21593	12.65494	13.45368	14.37154	12.33716	14.3891	0	0	0	11.98525	17.08595	0	15.36489	13.97422	0	14.41935	0	0	14.02248	16.32113	0	0	0	0	15.6115	0	15.52351	0	0	16.91203	15.21887	13.73543	0	15.42509	12.48312	13.03739	14.6394	0	12.2077	16.15913	13.57893	16.09267	13.7526
A0A669ELP8	A0A669ELP8_ORENI	p2rx4	response to ATP [GO:0033198]	P2X purinoceptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of plasma membrane [GO:0005887]; postsynapse [GO:0098794]	integral component of plasma membrane [GO:0005887]; postsynapse [GO:0098794]; ATP binding [GO:0005524]; extracellularly ATP-gated cation channel activity [GO:0004931]; purinergic nucleotide receptor activity [GO:0001614]; response to ATP [GO:0033198]	ATP binding [GO:0005524]; extracellularly ATP-gated cation channel activity [GO:0004931]; purinergic nucleotide receptor activity [GO:0001614]	SSLFLISSLVRGVAMSK	19.87000084	1810.180782	0	0	0	16.14482	16.19578	0	15.73795	0	14.85649	0	0	16.41976	0	0	0	0	0	0	0	0	0	0	0	14.80576	13.57096	14.84878	14.57358	0	0	0	15.16541	16.17002	0	0	15.96589	0	16.52244	0	16.22073	0	0	0	0	16.54838	16.1382	15.80018	0	0	0	16.96358	16.64125	16.34732	0	0
A0A669C4C1	A0A669C4C1_ORENI		phospholipase C-activating G protein-coupled receptor signaling pathway [GO:0007200]; platelet activation [GO:0030168]; relaxation of muscle [GO:0090075]	P2Y purinoceptor 1 (Purinergic receptor)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; G protein-coupled purinergic nucleotide receptor activity [GO:0045028]; phospholipase C-activating G protein-coupled receptor signaling pathway [GO:0007200]; platelet activation [GO:0030168]; relaxation of muscle [GO:0090075]	ATP binding [GO:0005524]; G protein-coupled purinergic nucleotide receptor activity [GO:0045028]	SLVLLDRR	7.039999962	972.2095287	13.42728	13.23182	14.19052	13.9075	12.05722	14.07259	14.81536	14.99236	15.46112	13.29814	14.41412	13.55666	15.44319	0	0	13.06899	0	0	15.1252	13.2688	9.476444	9.380449	14.18761	0	0	15.14283	9.116658	13.81754	0	13.96003	14.76494	0	15.9708	9.94804	0	0	11.64746	13.93717	15.71679	13.36842	12.76563	13.2935	0	14.96446	13.29433	13.12271	12.43109	13.04389	0	0	0	13.83591	0	14.75962
I3KXQ4	I3KXQ4_ORENI	P2RY4	transepithelial chloride transport [GO:0030321]	P2Y purinoceptor 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; G protein-coupled purinergic nucleotide receptor activity [GO:0045028]; transepithelial chloride transport [GO:0030321]	G protein-coupled purinergic nucleotide receptor activity [GO:0045028]	MMNVLMR	5.920000076	909.4128423	0	15.04667	14.04549	7.607749	14.83671	12.0749	14.96089	14.32903	14.92561	11.47351	14.83282	14.23481	15.23311	0	0	15.0624	0	0	0	0	0	14.50698	0	0	13.78092	0	13.14862	12.50097	11.24335	14.92868	15.1031	0	0	16.37514	14.95006	0	12.1629	12.43625	15.78472	13.31034	11.56882	13.07596	9.762156	0	15.19929	10.11884	13.89511	0	15.18495	15.19175	0	0	15.46365	13.8567
A0A669C6V4	A0A669C6V4_ORENI	AKAP9	signal transduction [GO:0007165]	PACT_coil_coil domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]	cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]; molecular adaptor activity [GO:0060090]; signal transduction [GO:0007165]	molecular adaptor activity [GO:0060090]	SSEEGGSLLER	2.059999943	1163.686524	10.59891	13.59248	11.14591	10.65638	12.59734	11.70058	18.40361	14.13564	0	0	0	12.7251	12.8315	13.87327	0	10.53872	0	13.29314	10.58647	16.72052	19.47591	15.46988	15.37356	18.5394	18.27106	12.10911	8.894666	0	0	10.40471	0	13.81861	0	0	0	0	13.77837	11.52524	14.48457	0	7.325152	0	0	13.52103	0	0	13.37023	0	0	15.31645	12.33561	0	14.05914	0
I3K9I0	I3K9I0_ORENI	PAN3	mRNA processing [GO:0006397]; nuclear-transcribed mRNA poly(A) tail shortening [GO:0000289]; positive regulation of cytoplasmic mRNA processing body assembly [GO:0010606]	PAN2-PAN3 deadenylation complex subunit PAN3 (PAB1P-dependent poly(A)-specific ribonuclease) (Poly(A)-nuclease deadenylation complex subunit 3) (PAN deadenylation complex subunit 3)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	PAN complex [GO:0031251]; P-body [GO:0000932]	P-body [GO:0000932]; PAN complex [GO:0031251]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]; transferase activity [GO:0016740]; mRNA processing [GO:0006397]; nuclear-transcribed mRNA poly(A) tail shortening [GO:0000289]; positive regulation of cytoplasmic mRNA processing body assembly [GO:0010606]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]; transferase activity [GO:0016740]	SVNDIMPMIGAR	3.579999924	1335.357489	10.60114	12.28578	13.58191	9.676215	12.84004	14.48882	12.60606	0	13.13415	13.40515	12.64411	15.06481	14.84789	13.37186	13.69966	12.81527	12.8975	12.91415	0	15.21728	13.03829	14.91937	0	9.842192	13.45582	13.11733	12.68456	13.74051	15.26001	13.28855	19.0301	18.50282	18.38215	11.55286	14.09342	0	12.78962	14.54397	12.30213	12.34439	14.98117	12.37977	8.293065	12.69676	12.24014	13.9566	15.12694	13.92796	12.71756	12.37	16.34624	13.1846	14.80582	10.26886
I3K5F5	I3K5F5_ORENI	ino80b	chromatin remodeling [GO:0006338]	PAPA-1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Ino80 complex [GO:0031011]	Ino80 complex [GO:0031011]; chromatin remodeling [GO:0006338]		NLLLVQSAA	14.98999977	927.323661	14.80351	15.85939	0	14.91098	15.33958	15.12147	15.90621	12.55664	15.47051	0	16.59507	14.66512	13.86484	14.13003	14.12123	12.41534	13.38569	12.34957	12.56079	13.05136	0	0	14.04646	13.91766	0	7.017058	13.16298	13.48264	14.27565	11.89942	0	13.40439	0	0	0	0	0	0	12.82078	13.22489	13.06986	13.53128	0	13.47347	13.90637	0	15.38204	15.4617	0	0	0	0	0	0
I3KMU8	I3KMU8_ORENI		negative regulation of double-strand break repair via homologous recombination [GO:2000042]	PARP-1 binding protein (PARP1-binding protein) (PCNA-interacting partner)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; negative regulation of double-strand break repair via homologous recombination [GO:2000042]		IDIDIFLLLLFKGIMEGLGER	8.649999619	2405.651454	10.15444	0	11.20648	12.72112	0	0	0	13.60233	0	9.842173	11.77996	12.58492	13.17268	12.34852	12.63367	0	11.73053	12.54843	0	17.13734	13.62253	12.30596	17.13943	13.35798	11.16458	16.12549	14.91848	16.35368	0	0	0	0	0	0	13.53501	15.21633	0	7.513158	0	0	0	0	0	10.99058	0	0	0	0	0	0	0	0	0	0
A0A669EDV8	A0A669EDV8_ORENI	LOC100690808	circadian regulation of gene expression [GO:0032922]	PAS domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; circadian regulation of gene expression [GO:0032922]		MIYSCSEHAEAGK	2.75999999	1496.840891	14.64292	0	14.71308	12.56999	10.88713	12.60807	13.4906	15.13518	17.19354	16.01445	0	13.51609	0	0	11.94483	0	0	12.38927	12.27144	0	0	15.84829	0	12.74763	0	0	0	0	0	0	0	16.7158	17.64576	0	0	0	0	0	15.67796	11.3801	15.50024	0	0	12.97109	15.45692	0	13.66176	0	0	13.86629	0	13.96637	0	0
A0A669C3W5	A0A669C3W5_ORENI	PSMD11	proteasome assembly [GO:0043248]	PCI domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	proteasome complex [GO:0000502]	proteasome complex [GO:0000502]; proteasome assembly [GO:0043248]		MAAAAVAEFQR	2.900000095	1181.029057	13.74053	14.00048	15.36615	0	15.69832	0	16.98164	0	0	18.23853	0	0	0	0	0	0	16.30749	0	18.92324	17.31152	17.07788	0	0	0	0	0	0	0	0	0	0	16.26049	14.98002	0	0	16.86261	13.43229	0	0	17.05281	15.19338	0	17.7515	16.78106	16.41809	16.48619	0	0	0	0	0	0	0	0
I3JV65	I3JV65_ORENI	pcm1	cilium assembly [GO:0060271]; microtubule anchoring at centrosome [GO:0034454]; protein localization to centrosome [GO:0071539]	PCM1_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centrosome [GO:0005813]	centrosome [GO:0005813]; cilium assembly [GO:0060271]; microtubule anchoring at centrosome [GO:0034454]; protein localization to centrosome [GO:0071539]		ILQELHSLR	14.61999989	1108.226543	16.0027	13.77926	0	18.02731	0	15.40047	14.70017	18.39179	0	13.61297	13.77172	11.90028	0	14.13488	13.44777	13.41964	14.44468	11.14016	14.95156	18.20517	9.518331	14.50037	19.10346	0	12.5467	13.50063	14.73538	17.47147	18.64251	15.41293	0	14.82701	14.59403	13.20081	13.52938	0	14.65219	0	15.15862	0	0	13.50385	0	16.86191	13.45365	15.33235	13.9372	13.32405	14.31242	14.14213	16.61656	15.29063	16.15243	9.765324
I3JWU7	I3JWU7_ORENI			PDCD2_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]		HGDAVFSRFMK	3.630000114	1309.70569	7.348166	13.33681	0	14.40693	13.96985	14.00525	17.00001	12.12123	0	0	0	0	0	12.50083	0	14.18536	0	14.29144	12.81531	0	13.83786	13.72884	14.76381	11.64359	12.80512	14.33025	10.64061	13.15423	14.32467	13.28209	11.64055	0	0	11.55812	0	13.50967	0	0	0	0	0	0	0	0	0	8.941669	0	0	0	0	0	11.65422	0	13.87173
I3JVU1	I3JVU1_ORENI			PDZ and LIM domain 1 (elfin)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]; Z disc [GO:0030018]	cytoskeleton [GO:0005856]; Z disc [GO:0030018]; metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	IKGCIEEMVLSIDR	9.840000153	1679.327319	0	14.64749	0	11.63154	13.00864	13.8208	15.5812	14.53427	14.61418	14.75784	12.64435	13.14557	13.65559	14.64155	16.63002	0	15.74524	12.48069	0	0	0	0	0	0	0	0	0	0	15.35837	12.31486	18.76568	0	16.01359	0	0	0	12.17769	0	0	0	16.00096	0	0	0	13.73111	0	12.3718	0	0	0	0	0	0	0
A0A669CQ27	A0A669CQ27_ORENI			PDZ and LIM domain 5b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	MNTNYSVTLDGPAPWGFR	11.06000042	2040.996922	15.04887	11.95127	13.05067	0	0	12.49182	0	0	10.65613	14.4248	14.56157	13.58068	14.28126	0	15.16163	12.46429	16.49267	0	10.5223	0	0	14.29799	0	0	0	0	14.95588	13.14582	0	0	0	0	0	0	10.27606	14.33829	0	0	11.17985	17.61998	11.40677	14.40739	11.93475	18.95137	14.37671	12.33881	0	0	15.35123	15.92383	16.68402	18.58448	14.56075	0
A0A669DAP0	A0A669DAP0_ORENI			PDZ domain containing 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TCMEECK	5.949999809	973.7142747	12.28159	0	0	16.43246	16.43719	0	0	13.74723	14.88988	14.16338	0	0	0	17.10495	0	0	14.88568	0	0	16.65194	0	0	17.49558	0	0	0	0	0	0	0	19.53217	20.03716	0	0	0	0	0	0	0	17.68548	0	0	0	0	0	17.92264	0	0	0	0	0	0	0	0
I3KQ30	I3KQ30_ORENI		eye photoreceptor cell development [GO:0042462]; inner ear receptor cell development [GO:0060119]	PDZ domain containing 7a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		eye photoreceptor cell development [GO:0042462]; inner ear receptor cell development [GO:0060119]		TPSEASSDSALR	4.860000134	1220.540479	10.22041	11.41714	11.69661	13.35698	12.46812	14.10671	13.68405	12.9479	10.22221	14.11258	0	15.11927	14.93856	0	12.98517	0	12.89962	13.5213	15.18313	14.31502	0	0	14.61926	0	0	14.60899	0	0	0	15.50225	16.85891	17.65315	16.80736	0	0	0	0	0	15.05759	15.13591	0	0	0	15.26922	14.52197	0	0	14.95595	10.49761	15.35508	12.5023	0	0	15.40812
A0A669BWD2	A0A669BWD2_ORENI	LOC100691190		PDZ domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GESKSPK	1.470000029	730.267277	0	0	0	0	15.71007	0	0	0	14.34546	14.16276	15.63466	14.99194	12.92614	14.46782	14.87921	13.68449	12.11311	14.23076	0	0	14.38883	14.56084	15.36003	13.59801	14.93112	13.72887	12.36864	13.01578	11.22713	14.94838	15.38956	20.49063	17.50692	15.51885	0	0	11.78336	13.49141	14.69898	14.26746	14.89999	0	0	14.38228	14.63177	14.05656	11.46984	14.1663	14.70709	0	14.73073	13.44683	14.38896	13.84726
I3JXU4	I3JXU4_ORENI	LOC100704759		PH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LLGDEFQEK	12.47999954	1078.363011	0	13.00988	13.3653	13.69258	13.48986	15.39126	8.548526	18.58369	0	17.02268	13.17413	15.20611	0	12.44297	16.02243	11.19168	15.75853	15.64202	13.0867	14.97702	16.49993	0	0	0	16.75665	18.56821	18.19147	15.88326	17.63888	12.32343	14.81777	0	14.00363	0	12.5771	14.48387	12.8333	0	0	13.76583	0	15.13023	14.68866	0	15.13166	0	14.90959	14.58544	0	0	0	16.34846	17.48641	16.52942
A0A669BVX6	A0A669BVX6_ORENI	stoml2		PHB domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]		ESAINVAEGR	3.200000048	1045.48877	0	14.74367	13.53667	12.1947	13.50856	15.20591	16.08855	14.35222	0	14.9324	0	15.21916	14.94413	0	14.57147	13.65327	14.28534	0	15.21326	0	13.99168	15.9667	14.85682	10.24102	13.78792	13.15602	15.31448	0	13.51054	14.06226	0	0	16.59951	0	0	0	0	13.44204	0	0	14.79248	0	0	0	0	0	0	0	15.2719	0	0	0	0	0
A0A669DU81	A0A669DU81_ORENI	phf10	nervous system development [GO:0007399]	PHD finger protein 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	npBAF complex [GO:0071564]	npBAF complex [GO:0071564]; metal ion binding [GO:0046872]; nervous system development [GO:0007399]	metal ion binding [GO:0046872]	EYSQMQQQNPQKVEASK	6.980000019	2039.374877	14.63268	11.20517	12.48425	15.57169	0	10.95588	0	0	10.76974	14.79198	16.88967	0	13.8897	0	0	0	14.63884	15.65289	11.85299	13.12003	13.07627	10.82442	16.70312	0	0	0	0	0	14.3759	10.39648	0	11.69379	13.9849	13.6752	12.60588	12.68099	0	0	0	0	14.7059	12.84567	12.53868	13.15464	0	13.91535	9.664633	12.3028	14.38527	0	10.49529	14.46756	13.32953	0
I3IWQ1	I3IWQ1_ORENI			PHD finger protein 19	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	PAAGGPAER	1.850000024	822.6419299	14.20033	12.28969	0	0	0	10.95105	14.73728	0	14.4713	0	14.08178	14.13341	13.12241	0	14.55755	14.64817	13.82988	12.91739	0	0	0	0	0	15.51787	15.20067	14.84852	15.00063	0	0	0	0	0	0	15.25055	0	0	14.28314	0	0	0	0	0	0	0	0	0	0	0	0	16.09465	0	0	14.6893	0
A0A669C1S8	A0A669C1S8_ORENI	PHF21B		PHD finger protein 21B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GMLGTLTAVPIKVPQVSSLHR	5.21999979	2204.154674	12.31	12.45448	0	12.6165	11.93061	0	9.763659	0	16.16392	14.38725	13.46782	0	14.19877	12.75185	0	13.53452	0	14.41722	15.22368	14.0238	13.95188	14.03063	14.51184	0	0	0	0	0	0	0	0	0	0	0	14.18133	0	0	0	0	0	0	0	0	0	0	0	0	13.32553	14.21206	0	0	0	0	0
I3JTH6	I3JTH6_ORENI	LOC102077430		PHD-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	KPASEIPPLTCNVSR	2.960000038	1669.190447	12.49917	14.29431	12.4237	0	0	15.1391	0	14.75835	15.43546	15.71848	0	15.20327	15.24558	11.05664	0	16.03797	15.26071	14.60859	12.55595	10.99082	12.50934	15.49792	17.0272	7.558593	14.67226	12.70064	14.13782	10.52719	14.23635	15.07293	0	13.83115	16.15975	15.63427	15.54305	15.65306	13.30198	11.36495	13.05899	13.90161	0	0	0	16.01232	0	12.30759	6.328263	0	0	0	15.91831	0	0	0
I3JRF6	I3JRF6_ORENI	LOC100691550		PID domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				FSHVLVSVIGDAFR	5.460000038	1545.846067	0	0	15.12268	7.161147	14.47759	0	12.88115	17.1228	12.94248	13.56621	13.85782	0	13.77577	0	0	0	0	0	15.95677	15.89961	14.82157	0	0	17.75997	0	0	0	0	16.07942	0	16.6233	0	0	14.43346	0	14.46383	0	0	13.53374	0	0	0	15.46135	0	0	16.27053	14.81442	14.08288	0	15.48986	15.23483	0	0	0
I3JDV0	I3JDV0_ORENI	smg6	"nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]"	PINc domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	"cytoplasm [GO:0005737]; nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]"		LLFGGSR	13.46000004	749.5988242	15.93777	16.15165	16.47905	17.09094	16.5133	14.03606	15.59084	0	18.34498	15.42077	16.2615	17.89922	14.34145	14.53885	17.22572	0	20.12685	19.34717	19.40421	19.08273	19.31484	19.09403	19.94196	19.10742	19.44346	15.5332	19.40819	18.42389	14.96443	17.94128	17.48309	0	17.02108	18.03481	14.8193	16.85282	15.76078	15.3301	16.82305	17.05534	18.22665	14.66826	15.14505	17.34429	16.52743	15.1099	14.98379	0	15.82599	16.53513	17.64664	15.50447	14.9511	18.5747
I3KSX2	I3KSX2_ORENI	LOC100708253		PIP49_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GVIDGSACSSLCEK	5.070000172	1483.575213	13.20754	14.24547	0	13.14462	0	0	0	15.71231	14.07353	16.59866	17.44805	13.09077	0	0	15.47448	0	16.38618	0	19.07619	0	13.81914	15.48982	14.09105	16.4068	11.04755	0	0	0	15.65257	15.04039	0	0	0	9.690238	0	0	7.293247	11.31864	0	15.20999	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DWC5	A0A669DWC5_ORENI	LOC100701476		PIPK domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; phosphatidylinositol phosphate kinase activity [GO:0016307]	ATP binding [GO:0005524]; phosphatidylinositol phosphate kinase activity [GO:0016307]	PGSSGMSMKK	8.239999771	1026.051665	0	12.8453	13.77858	0	0	14.36726	15.37906	13.49598	15.06111	0	15.11681	17.28097	0	10.63953	17.55342	13.84175	0	14.28196	0	11.89361	10.1773	13.96648	0	0	0	0	0	11.32875	0	0	0	15.71051	15.84129	12.26479	10.06249	14.8408	0	14.14706	0	11.40486	0	14.33463	9.639847	9.994279	0	0	0	0	12.55345	13.06192	15.73575	12.88681	0	0
A0A669D7N4	A0A669D7N4_ORENI	LOC100700791		PKD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		TIRGPAGNLLVDFYK	3.069999933	1664.812286	14.73531	0	14.3504	0	16.5943	14.75548	0	16.50512	14.73298	0	15.21688	0	14.6144	16.15024	14.91026	13.39204	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.67323	0	0	0	0	15.08908	13.07519	0	0	0	0	0	17.16538	14.85105	15.38111	17.32262	0	0	16.00563	0	14.83693	0	17.4648	0
I3KBJ5	I3KBJ5_ORENI	LOC100697912		PKS_ER domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; oxidoreductase activity [GO:0016491]; zinc ion binding [GO:0008270]	oxidoreductase activity [GO:0016491]; zinc ion binding [GO:0008270]	TLARTGCR	3.470000029	933.4951715	13.57366	14.32731	12.50379	14.08727	0	0	13.78981	0	0	0	0	12.98068	0	0	0	14.03085	12.06689	0	0	13.30169	0	0	12.94909	0	9.609122	14.41623	12.2291	0	0	0	0	19.00547	0	0	0	0	13.4251	0	0	13.39258	13.53644	0	0	13.29517	0	0	0	0	0	0	0	0	13.18218	0
I3JGB0	I3JGB0_ORENI	LOC102081065	phospholipid catabolic process [GO:0009395]	PLA2c domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		phospholipase activity [GO:0004620]; phospholipid catabolic process [GO:0009395]	phospholipase activity [GO:0004620]	DYAAKLK	7.289999962	808.2728953	15.5753	0	14.14273	0	0	15.36512	15.30167	14.29961	13.30725	15.09323	15.37605	16.01573	0	0	0	13.58161	0	0	0	0	12.93818	0	15.35107	15.80665	0	13.43988	0	0	0	13.4171	0	16.76598	0	14.98136	0	15.66067	13.74382	0	0	0	0	0	0	16.1221	0	0	0	0	14.9483	0	0	0	15.83713	12.64221
A0A669DGE4	A0A669DGE4_ORENI	LOC100703496		PLAC domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VSHSSTQDGITSTYALCVR	8.56000042	2080.899917	0	16.35684	0	0	16.16474	0	16.37601	0	16.71239	0	16.31836	0	16.44213	0	17.15878	0	15.77978	15.27874	0	12.25745	15.636	15.2986	0	0	14.34905	16.36957	0	16.82265	0	0	0	0	0	14.25654	0	0	0	0	14.64757	14.84986	14.11237	0	0	14.94049	0	12.36491	0	14.06187	15.37349	14.5209	13.8782	16.01511	16.22116	16.29715
A0A669BHZ9	A0A669BHZ9_ORENI		lipid metabolic process [GO:0006629]	PLCXc domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		phosphoric diester hydrolase activity [GO:0008081]; lipid metabolic process [GO:0006629]	phosphoric diester hydrolase activity [GO:0008081]	DQLNVGVR	6.53000021	901.1992431	0	14.44944	0	0	14.29595	13.12237	0	14.51732	15.7131	12.77462	14.19703	16.12213	0	16.36695	0	0	18.57004	17.65028	16.05655	15.06779	13.96427	18.14423	13.78348	18.3813	0	0	0	0	0	14.205	16.91974	0	15.69646	16.28469	13.96624	17.589	15.27003	0	15.49281	15.35785	16.08894	15.15145	0	14.81548	15.96447	0	0	0	17.74327	16.37228	18.45363	0	18.19233	18.0687
A0A669BVY4	A0A669BVY4_ORENI	pou4f1	multicellular organism development [GO:0007275]	POU domain protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; multicellular organism development [GO:0007275]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]"	TSIAAPEKR	3.170000076	972.7518743	0	15.16837	17.55442	0	16.03096	15.81465	17.76599	16.27973	16.84529	17.41948	14.1263	15.83792	0	0	16.48453	16.65594	15.77815	15.96657	15.10451	16.24324	0	16.00838	0	0	15.82124	17.20938	16.06651	17.75926	17.5486	0	0	16.32983	0	0	11.54392	14.68186	16.35406	17.82035	16.21123	15.87226	17.55927	14.44175	0	18.63444	15.17582	18.42629	15.49681	15.99108	16.02026	16.6531	16.37608	17.63029	17.47518	0
A0A669DGY7	A0A669DGY7_ORENI		cell cycle [GO:0007049]; cell division [GO:0051301]; positive regulation of protein dephosphorylation [GO:0035307]	PP1-binding domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; cell cycle [GO:0007049]; cell division [GO:0051301]; positive regulation of protein dephosphorylation [GO:0035307]		ENNPPMTPTPSK	7.150000095	1313.201016	16.21813	0	0	14.35771	0	10.61603	14.73993	13.30344	15.75248	13.33204	13.88517	12.10354	14.2073	0	0	17.77876	16.20708	15.86389	16.59564	0	16.79222	16.25526	12.22716	0	14.38355	14.2689	17.11108	15.58411	0	15.38429	15.57338	14.9321	15.79403	0	0	16.80813	16.30859	15.27154	0	0	16.10061	0	16.19626	0	16.1956	15.78065	16.56828	0	12.85405	18.67222	14.1213	0	0	0
I3K0P5	I3K0P5_ORENI	LOC100700412		PPM-type phosphatase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; phosphoprotein phosphatase activity [GO:0004721]	metal ion binding [GO:0046872]; phosphoprotein phosphatase activity [GO:0004721]	SSAVLFNMLR	19.29000092	1152.796453	12.70935	0	0	0	0	0	0	0	11.47206	14.00453	0	0	0	0	14.06406	14.56502	8.720609	0	16.24194	15.74641	0	15.20645	11.38017	14.4761	0	13.32886	16.88953	14.59228	12.71072	0	16.94959	0	15.49369	12.93144	14.26015	0	0	10.79582	0	14.4363	0	13.42667	15.68927	0	11.38663	0	0	0	0	18.82166	0	0	0	0
A0A669DRS4	A0A669DRS4_ORENI			PR domain containing 11	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MSAADQK	6.349999905	766.9502239	16.09228	16.05569	14.90218	0	15.13284	17.01827	17.22135	16.38667	16.96102	0	17.23511	16.73554	0	0	17.23123	0	18.52791	16.25179	17.11436	0	0	0	0	0	16.25955	0	0	0	0	0	0	0	0	0	16.24039	16.41416	13.75416	0	16.16914	17.22643	15.53247	15.73291	16.5233	16.50764	15.91559	0	17.23922	16.79444	12.6922	15.67034	14.39069	0	21.17669	17.66539
I3J1F7	I3J1F7_ORENI			"PR domain containing 2, with ZNF domain a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ECGISVTKENDGHLHR	4.570000172	1851.247764	0	15.16566	13.83095	0	13.19981	13.48177	14.77216	16.37902	12.35165	0	14.77417	0	0	13.84086	0	0	0	0	0	0	0	0	0	0	13.88226	0	14.30902	0	0	0	0	0	0	0	16.84395	0	0	0	0	14.17969	0	0	0	0	11.80878	0	0	0	0	12.23559	0	0	0	0
I3KBM0	I3KBM0_ORENI	LOC109194164	cell fate commitment [GO:0045165]	PR domain zinc finger protein 1 (EC 2.1.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	"cytoplasm [GO:0005737]; nucleus [GO:0005634]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; histone deacetylase binding [GO:0042826]; metal ion binding [GO:0046872]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; cell fate commitment [GO:0045165]"	"DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; histone deacetylase binding [GO:0042826]; metal ion binding [GO:0046872]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	TLSYPLMR	1.24000001	997.0596405	9.665159	13.13686	14.0916	14.93371	12.81226	10.94805	0	0	11.79231	15.05319	14.34751	16.93287	13.95424	9.609385	10.24061	14.15258	14.18083	11.15756	0	13.01917	0	0	0	0	0	12.49454	0	0	0	11.76999	0	10.33519	0	15.69341	0	13.19441	14.51046	13.08008	0	0	12.93287	12.13876	0	0	13.75942	0	0	0	0	11.76971	0	0	14.85546	0
I3K5T3	I3K5T3_ORENI	rabac1		PRA1 family protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GFSASMAK	2.849999905	815.0230766	14.59951	15.16768	14.85063	18.02596	14.84189	0	0	15.67794	0	0	0	13.66996	0	0	13.00126	0	0	0	0	15.01242	0	16.42805	0	0	0	0	15.91699	13.85565	15.15091	0	21.69833	21.58125	12.00815	0	14.78098	14.74695	10.89365	0	13.18552	0	0	14.14591	0	0	15.06147	0	0	0	0	0	0	0	0	0
A0A669EWR8	A0A669EWR8_ORENI	prpf4b	"mRNA cis splicing, via spliceosome [GO:0045292]"	PRP4 pre-mRNA-processing factor 4 homolog (EC 2.7.11.1) (Serine/threonine-protein kinase PRP4 homolog)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; mRNA cis splicing, via spliceosome [GO:0045292]"	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	MPNKMIR	7.320000172	922.268831	16.58106	18.17581	15.47123	14.27387	12.35912	15.93989	13.75631	15.73047	16.44663	14.74576	16.44862	15.24794	15.48496	16.24381	17.3491	16.90165	0	17.67298	0	17.9357	16.71975	0	16.20258	0	0	15.6954	18.17395	0	16.30419	0	0	0	0	19.14365	0	0	0	15.70628	17.20218	17.30761	0	0	0	0	0	0	15.53192	0	17.00786	16.90006	16.32776	0	0	15.72381
A0A669BNF0	A0A669BNF0_ORENI	prpf6	"mRNA splicing, via spliceosome [GO:0000398]"	PRP6 homolog (Pre-mRNA-processing factor 6) (U5 snRNP-associated 102 kDa protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; mRNA splicing, via spliceosome [GO:0000398]"		ALITCWQKLQSVSVLSK	4.519999981	1959.980247	18.28564	0	0	14.30725	14.54234	12.26738	11.45125	14.94306	0	13.38688	14.95094	0	0	14.09724	0	15.73168	14.77724	12.45552	0	17.86645	16.56683	15.07769	10.62457	12.5174	0	16.29626	0	0	0	0	0	0	0	0	0	0	0	0	0	16.37099	0	0	16.08561	0	0	0	13.96816	0	0	0	0	0	0	15.61665
A0A669DJU4	A0A669DJU4_ORENI			PTPRF interacting protein alpha 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	synapse [GO:0045202]	synapse [GO:0045202]		DMERMGVMTLIAAVDEDGR	6.269999981	2157.499043	12.87328	0	14.14624	8.137086	11.40874	11.11984	13.539	0	17.66344	13.5372	0	0	17.39244	0	11.9309	0	11.63124	0	0	12.64794	0	13.05188	10.86029	0	0	17.42628	13.12114	13.363	17.67831	0	14.64496	11.0929	12.64885	0	12.5771	10.89016	7.517692	0	0	13.42545	13.45488	8.351528	0	0	11.09775	0	14.73823	0	13.67321	8.876546	13.90604	0	14.16121	0
I3JN87	I3JN87_ORENI	srrm1	mRNA processing [GO:0006397]	PWI domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		mRNA processing [GO:0006397]		KLSNSPMK	12.98999977	920.4594162	16.10864	15.89703	15.62115	14.37706	15.48426	14.52548	0	0	14.85656	0	16.05473	14.02322	0	14.2755	14.70836	16.93974	15.42868	13.92115	14.56892	14.33369	15.95829	15.5693	0	16.42955	14.40769	0	13.65884	13.70628	14.86067	16.59484	0	0	14.20313	14.37937	16.76122	15.15132	15.85244	17.18291	16.0429	15.48622	16.60813	15.37713	15.76042	16.58687	0	15.46643	0	0	14.83969	0	16.91946	0	16.00126	15.17981
A0A669DWB4	A0A669DWB4_ORENI			PWWP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VGGTSAKEGEK	5.03000021	1060.19282	0	13.38791	12.36252	0	10.85149	11.87081	14.36927	12.44151	0	14.39126	17.76999	6.100082	11.38081	0	7.815781	17.42612	14.97835	14.60043	14.96017	0	11.66049	13.97486	15.49159	0	12.46876	15.83989	0	14.85784	0	0	13.08813	13.51721	13.87226	0	12.3051	0	13.30982	13.46897	14.60773	14.78906	14.66374	9.843489	13.50874	12.89316	13.158	13.20986	0	15.05464	0	0	0	14.05302	12.08357	8.443156
A0A669D089	A0A669D089_ORENI	LOC100692540	"intracellular protein transport [GO:0006886]; retrograde transport, endosome to Golgi [GO:0042147]"	PX domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]; retromer complex [GO:0030904]	"cytosol [GO:0005829]; retromer complex [GO:0030904]; phosphatidylinositol binding [GO:0035091]; intracellular protein transport [GO:0006886]; retrograde transport, endosome to Golgi [GO:0042147]"	phosphatidylinositol binding [GO:0035091]	VSATVRK	6.670000076	759.7763268	11.47218	0	13.28127	0	11.77258	16.58097	14.18024	16.45547	16.19231	12.79445	15.64878	15.09247	13.25691	0	0	0	0	15.4476	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.6992	0	0	0	0	0	0	0	0	0	14.82218	0	0	0	0	0	15.68317	0
A0A669CUN1	A0A669CUN1_ORENI	trip13	meiotic cell cycle [GO:0051321]; oogenesis [GO:0048477]; spermatogenesis [GO:0007283]	Pachytene checkpoint protein 2 homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATPase activity [GO:0016887]; meiotic cell cycle [GO:0051321]; oogenesis [GO:0048477]; spermatogenesis [GO:0007283]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	ATIVALVTAKR	1.940000057	1144.151342	13.95822	13.8562	0	14.47325	13.83726	0	15.06725	14.59959	0	0	0	0	13.50936	13.29722	0	11.51603	13.67434	14.9631	0	0	0	0	17.79644	14.49847	0	0	0	14.52869	13.35616	13.62012	0	14.52446	15.68144	0	0	0	13.37562	13.18542	14.51409	0	0	0	0	14.89062	0	0	0	15.24663	0	0	15.29241	12.72249	13.62998	12.93646
A0A669BUL1	A0A669BUL1_ORENI			"Palladin, cytoskeletal associated protein"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SSVIMAK	1.879999995	750.9074875	15.18326	15.31305	14.73998	15.87477	15.65899	16.61893	16.34786	16.34853	0	0	15.85002	0	0	0	0	0	0	0	0	0	0	16.45095	0	0	0	0	16.93538	0	16.00701	17.28144	16.72908	0	0	16.36994	13.93284	16.26705	16.72524	16.10536	0	0	16.95641	12.68423	0	0	16.9762	16.16793	16.05101	16.7967	17.2387	0	16.14355	15.23447	0	16.9017
A0A669DYW4	A0A669DYW4_ORENI		protein palmitoylation [GO:0018345]	Palmitoyltransferase (EC 2.3.1.225)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; mitochondrion [GO:0005739]	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; mitochondrion [GO:0005739]; protein-cysteine S-palmitoyltransferase activity [GO:0019706]; protein palmitoylation [GO:0018345]	protein-cysteine S-palmitoyltransferase activity [GO:0019706]	LGGPREAMK	7.150000095	975.8731565	14.66469	14.83893	15.91972	14.95485	0	14.81173	15.88353	0	0	12.81165	15.47123	15.27098	0	15.47245	15.78321	0	0	0	0	0	15.03855	16.51043	0	15.66696	16.2647	16.04234	14.34241	15.1686	13.65652	14.99282	15.35446	14.12346	0	15.92183	14.21229	15.00648	0	15.04987	0	0	0	0	15.31065	0	0	17.32446	0	0	17.17315	15.45362	18.42764	16.94355	14.5271	17.07312
A0A669C9D4	A0A669C9D4_ORENI	pank4	coenzyme A biosynthetic process [GO:0015937]	Pantothenate kinase (EC 2.7.1.33)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; metal ion binding [GO:0046872]; pantothenate kinase activity [GO:0004594]; coenzyme A biosynthetic process [GO:0015937]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; pantothenate kinase activity [GO:0004594]	ATGGGAHKFK	5.809999943	974.6247348	14.25811	15.25374	13.43408	14.23114	0	14.26768	14.98278	16.17474	14.82722	20.5969	14.49327	14.89201	11.58517	12.82423	14.28557	15.18646	12.16728	9.733778	14.27112	13.19882	11.55863	15.36826	16.71088	14.68053	0	12.72962	14.72423	9.582525	13.77834	16.06	15.9621	18.73201	15.15252	13.435	14.6643	14.79777	12.58745	13.50002	13.69535	13.92327	0	0	10.93853	14.54046	14.01354	14.91216	14.51589	14.44381	15.14739	14.23673	15.82197	14.37121	12.01171	14.79643
I3KJA4	I3KJA4_ORENI		lipid catabolic process [GO:0016042]	Patatin-like phospholipase domain containing 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		hydrolase activity [GO:0016787]; lipid catabolic process [GO:0016042]	hydrolase activity [GO:0016787]	QTMQLLQPAALSTNMDETYK	5.199999809	2300.003895	12.65134	10.34591	11.4185	13.94691	11.22111	10.17424	9.652431	13.87689	0	13.75132	0	14.75216	0	0	13.04861	0	16.34534	12.19068	8.992752	13.10027	0	12.6047	0	0	0	9.827792	5.829041	0	0	0	11.91431	13.61532	13.23045	8.996556	14.30942	12.21076	13.65134	12.34604	11.86091	0	0	12.59838	11.71264	13.96563	0	11.74388	11.5333	0	0	0	18.0846	13.60466	13.84786	12.11124
A0A669CKN2	A0A669CKN2_ORENI	pcnx3		Pecanex-like protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		KQASLTAEADSHVGVEMTVFR	4.789999962	2276.073261	0	10.1515	0	16.52108	10.86622	13.40373	0	0	13.37032	13.54844	0	8.439953	0	13.41167	13.05247	12.02378	11.99782	15.56666	0	12.53596	0	12.97223	0	0	0	14.91323	0	0	15.96848	0	0	0	0	13.49179	0	12.7531	0	0	14.41209	0	0	9.61679	12.70876	0	0	0	0	13.48633	0	13.89562	12.72538	13.90572	0	0
I3JF60	I3JF60_ORENI	LOC100701841		Pentaxin (Pentraxin)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	MKLFPVLVMLTACAARPQDLSGK	7.820000172	2579.333057	0	9.84116	10.66816	0	0	6.919063	0	0	11.93355	16.48855	0	0	10.66791	0	0	0	12.90592	0	0	11.14574	0	11.40062	17.1074	11.94611	11.63369	0	0	12.30961	12.01339	0	0	0	0	0	0	0	0	0	0	0	12.49946	0	0	9.336699	0	11.08492	0	9.295607	0	0	0	10.28987	14.02167	0
A0A669BUS7	A0A669BUS7_ORENI	adamts1		Peptidase M12B domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular matrix [GO:0031012]; extracellular region [GO:0005576]	extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	LDVFGMQLVLR	5.360000134	1306.008543	0	0	13.51993	17.67013	0	6.19506	0	0	0	17.04557	0	13.95725	0	0	0	0	0	0	0	0	0	0	8.592268	0	11.5396	0	0	0	0	0	0	12.62907	0	10.06142	18.11345	0	13.08588	0	0	11.48003	14.81233	11.40685	0	0	0	12.29637	0	0	11.83099	0	12.29516	0	0	9.847024
A0A669BXF1	A0A669BXF1_ORENI			Peptidase M60 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TEDAMTSANR	6.21999979	1095.593118	14.08315	12.63777	13.25235	15.64898	15.09104	0	0	13.60857	0	15.00028	0	14.20765	0	0	15.39393	0	15.09527	12.24541	14.67899	15.1929	14.08755	15.37163	15.69206	0	0	14.5306	0	0	0	0	20.38863	16.58207	0	0	0	14.6625	0	0	0	0	0	15.80748	15.27094	0	0	14.89302	14.6765	0	15.37475	14.67058	0	0	0	15.90926
A0A669D3X6	A0A669D3X6_ORENI	LOC100692083	"complement activation, alternative pathway [GO:0006957]; Notch signaling pathway [GO:0007219]"	Peptidase S1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]	"extracellular space [GO:0005615]; serine-type endopeptidase activity [GO:0004252]; complement activation, alternative pathway [GO:0006957]; Notch signaling pathway [GO:0007219]"	serine-type endopeptidase activity [GO:0004252]	KFTTNMICAHK	5.619999886	1351.161062	0	0	0	0	0	0	8.662384	0	8.405636	12.78618	9.443754	8.238852	0	0	0	0	0	0	13.31969	10.91765	0	7.371896	11.47799	0	0	0	10.87878	0	0	13.99346	8.870894	0	0	0	0	12.5541	0	12.05654	13.0192	17.35774	11.97306	9.643904	0	15.35301	0	12.59346	0	8.960407	0	0	0	0	13.43802	7.374815
A0A669ELR7	A0A669ELR7_ORENI	LOC100704359		Peptidase_M13_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; metalloendopeptidase activity [GO:0004222]	metalloendopeptidase activity [GO:0004222]	LDLLFSEKIC	8.279999733	1237.03209	14.93683	12.9562	14.55388	0	10.88171	0	14.05003	13.06725	13.44291	0	14.06485	12.72354	13.90808	12.89334	14.85595	0	15.85012	0	0	0	14.75686	0	0	0	11.75137	12.42198	0	0	12.61294	0	0	15.43775	16.94187	13.39676	15.93153	13.97865	14.42359	0	14.86046	14.3455	12.55461	12.37606	13.32006	12.45889	14.03958	13.16035	14.42908	14.73521	0	16.09421	15.65131	0	16.00729	0
A0A669ESD2	A0A669ESD2_ORENI	agtpbp1		Peptidase_M14 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metallocarboxypeptidase activity [GO:0004181]; zinc ion binding [GO:0008270]	metallocarboxypeptidase activity [GO:0004181]; zinc ion binding [GO:0008270]	EIGVQRSYTMESTLCGCDQGK	3.470000029	2434.786715	12.86058	0	0	10.67628	7.865816	13.75274	9.461917	0	0	14.25617	13.52689	12.77648	17.71585	0	12.78624	0	0	17.68604	13.62758	0	0	0	0	0	13.38266	12.78832	0	0	0	11.34871	0	13.17785	0	11.85937	10.52543	12.50995	10.31358	8.825356	13.07414	0	12.89059	0	13.93955	0	14.21521	0	0	10.9833	0	6.602905	0	0	0	13.51263
A0A669AXW6	A0A669AXW6_ORENI	ERMP1		Peptidase_M28 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		YLAMSEK	14.64000034	841.5736066	14.86653	14.72556	15.06601	0	0	15.50733	0	16.50296	0	16.23644	14.95071	0	15.15383	15.85405	15.22756	14.28553	0	0	14.38086	13.83649	0	12.61253	15.7684	15.89727	0	14.41024	12.78205	14.08147	15.60818	16.60574	15.7595	0	0	14.65165	14.66544	15.34703	0	14.85687	15.95906	15.23536	0	0	14.91691	13.80231	15.17694	14.68064	15.3543	14.65127	0	15.22439	15.86769	15.47019	16.17646	0
A0A669EZ45	A0A669EZ45_ORENI	nln		Peptidase_M3 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	GPDGKR	5.809999943	628.7229228	17.97964	18.07358	16.57017	0	15.98278	0	17.40342	0	0	15.62926	0	15.30746	17.43474	0	14.78162	15.45374	0	0	16.40773	15.4699	16.26792	0	0	0	0	17.23881	16.88802	0	15.32565	0	0	0	0	0	0	0	0	16.67689	0	0	0	0	0	0	0	0	0	0	0	0	0	17.59897	0	18.42662
I3JSN7	I3JSN7_ORENI	LOC100703873	glycosaminoglycan biosynthetic process [GO:0006024]; heparan sulfate proteoglycan biosynthetic process [GO:0015012]	Peptide O-xylosyltransferase 1 (EC 2.4.2.26) (Xylosyltransferase 1) (Xylosyltransferase I)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi membrane [GO:0000139]	Golgi membrane [GO:0000139]; metal ion binding [GO:0046872]; protein xylosyltransferase activity [GO:0030158]; glycosaminoglycan biosynthetic process [GO:0006024]; heparan sulfate proteoglycan biosynthetic process [GO:0015012]	metal ion binding [GO:0046872]; protein xylosyltransferase activity [GO:0030158]	TNDQLVAFLSK	3.099999905	1234.929351	15.68654	0	12.43405	14.17133	14.54874	14.46087	14.60702	15.23638	14.37866	16.42677	14.91435	14.28024	10.71165	14.99371	0	14.17306	14.76446	13.74689	12.91505	0	0	15.70319	16.08085	13.90825	14.74174	14.18262	14.35063	15.86749	12.85891	14.12153	20.62745	20.91452	20.06055	15.64479	13.75244	12.45179	13.17853	15.35422	13.88331	0	0	13.69159	15.88776	13.65052	15.30843	15.6302	16.49475	14.61691	16.50809	14.71891	14.82558	14.48228	14.37379	16.0356
I3JX57	I3JX57_ORENI	pdf	translation [GO:0006412]	Peptide deformylase (EC 3.5.1.88)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; peptide deformylase activity [GO:0042586]; translation [GO:0006412]	metal ion binding [GO:0046872]; peptide deformylase activity [GO:0042586]	LPYISPCR	6.320000172	1001.863395	11.94178	14.61419	13.98526	12.23869	13.38367	13.22165	11.52106	0	12.21313	13.99377	13.5796	15.1435	12.77385	13.65454	10.67419	0	9.411765	14.10544	11.55324	0	0	0	0	0	0	13.20843	13.45214	13.18784	0	10.52258	12.27633	12.86171	14.90581	11.94006	13.79414	9.066962	12.29323	12.96423	0	0	0	0	12.47556	10.47461	0	14.5468	13.68009	14.43573	0	0	13.45871	0	0	14.71718
A0A669EHQ6	A0A669EHQ6_ORENI		fucose metabolic process [GO:0006004]	Peptide-O-fucosyltransferase (EC 2.4.1.221)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		peptide-O-fucosyltransferase activity [GO:0046922]; fucose metabolic process [GO:0006004]	peptide-O-fucosyltransferase activity [GO:0046922]	MAQSVLNR	3.339999914	933.6967845	16.5729	13.70631	14.67723	14.33261	0	14.86739	14.68977	14.45761	14.45037	12.52749	16.23469	15.17805	8.686227	0	12.91996	15.3907	13.37854	13.52058	16.08033	0	14.07585	0	13.81626	13.21407	0	15.32412	15.6093	12.51222	0	14.20707	16.49095	13.96751	14.50722	17.11729	15.47355	14.51307	14.94887	15.03113	0	15.47822	15.70548	13.96412	15.4454	14.73037	12.82725	15.08406	13.4851	14.6184	17.32916	0	15.92805	13.04305	14.82088	0
I3JZQ3	I3JZQ3_ORENI	ppil4		Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; peptidyl-prolyl cis-trans isomerase activity [GO:0003755]; RNA binding [GO:0003723]	peptidyl-prolyl cis-trans isomerase activity [GO:0003755]; RNA binding [GO:0003723]	GGESVYSK	2.24000001	827.0423369	0	0	0	13.47348	15.3875	14.51924	0	0	14.53943	0	0	16.47578	14.43694	0	0	16.38082	0	15.33872	15.0238	18.66118	13.90665	15.63714	15.36766	0	14.71561	0	0	14.29604	0	15.08028	18.27575	17.02071	18.35972	0	0	0	13.8949	15.35111	15.94232	0	0	13.28012	15.43299	0	13.69314	15.55998	16.19889	15.19424	16.70729	15.3889	15.31927	14.45986	15.5715	14.55516
I3KD88	I3KD88_ORENI	LOC100692597		Peptidylprolyl isomerase (EC 5.2.1.8)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	KPSDSD	11.05000019	648.4376047	14.9272	15.28801	15.76047	13.93698	13.897	0	14.46416	0	15.59419	15.94325	15.63134	13.58548	15.54592	15.10196	0	16.53063	15.56538	0	16.65166	14.58702	11.8615	15.90425	15.36019	13.46727	15.73783	0	14.63165	14.22065	15.28351	15.23932	18.82273	16.71286	20.78189	15.33623	0	0	15.00634	0	15.04115	0	0	15.54237	0	0	0	0	0	0	16.00339	16.00216	15.14536	0	0	15.86913
I3JS64	I3JS64_ORENI		cytolysis [GO:0019835]	Perforin 1.3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]; cytolysis [GO:0019835]	calcium ion binding [GO:0005509]	MVDSNCCPAAAGVAQMNVTVVR	5.21999979	2382.399934	16.06175	0	10.62159	15.36794	11.59131	0	15.5054	15.17463	18.62372	20.0062	19.73084	11.70019	0	18.59523	0	12.82725	6.338789	12.30315	0	12.46758	13.75538	13.59836	0	0	11.46694	19.19108	0	18.91785	0	0	0	0	15.18799	19.28341	0	9.941551	11.32714	12.41914	13.81172	0	13.31651	15.29549	0	18.96871	19.39423	15.2375	0	15.10162	11.65721	12.2598	0	10.01577	0	0
A0A669AVE8	A0A669AVE8_ORENI	PER2	rhythmic process [GO:0048511]	Period circadian regulator 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; rhythmic process [GO:0048511]		GLSNMK	8.890000343	663.3123636	16.26792	14.23158	14.46186	16.25384	14.78994	13.03692	16.73727	15.12538	0	15.26558	13.1846	13.84344	13.27774	15.5305	16.84548	14.62395	14.35157	17.73689	14.99288	14.69219	14.19128	16.05916	15.69462	16.56998	15.669	14.49595	15.89653	15.77893	15.37441	14.47763	17.95705	18.54029	18.16613	14.06677	15.16202	14.47154	15.07641	13.74847	12.80177	15.24853	14.70676	14.26904	0	14.82317	15.19516	14.87834	15.00548	14.7377	13.31868	15.20463	14.35203	14.4134	15.38759	13.51896
A0A669BZZ4	A0A669BZZ4_ORENI		hydrogen peroxide catabolic process [GO:0042744]; response to oxidative stress [GO:0006979]	Peroxidase (EC 1.11.1.7)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; heme binding [GO:0020037]; peroxidase activity [GO:0004601]; hydrogen peroxide catabolic process [GO:0042744]; response to oxidative stress [GO:0006979]	heme binding [GO:0020037]; peroxidase activity [GO:0004601]	AFFSPFR	6.329999924	870.8834113	0	0	13.22702	14.88343	16.23436	0	16.24438	17.7482	16.6928	17.07662	16.20867	0	15.56135	15.22539	17.30459	0	16.51904	16.87285	0	0	17.30522	16.73256	15.29691	12.65878	9.050217	15.90609	14.02818	14.02828	0	14.70762	17.66907	18.10496	16.92943	16.15439	0	12.63742	0	12.14221	0	12.48401	0	0	0	0	14.66853	0	0	0	19.39784	0	0	0	17.1403	0
A0A669DTG0	A0A669DTG0_ORENI	pex1	protein targeting to peroxisome [GO:0006625]	Peroxin-1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	peroxisomal membrane [GO:0005778]	peroxisomal membrane [GO:0005778]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; protein targeting to peroxisome [GO:0006625]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	QAMEKK	11.06000042	750.262244	16.40675	16.78045	0	17.60895	16.89549	17.1466	0	15.32918	16.24393	0	17.95888	17.72733	16.03654	16.64897	0	0	20.06269	18.50098	0	16.60896	16.46439	0	16.69776	0	17.38052	0	0	0	0	16.08002	0	17.85849	18.45931	0	0	0	0	16.12679	0	0	0	0	18.0985	0	0	0	0	17.01629	17.38905	0	0	21.11832	17.64406	18.02365
I3J222	I3J222_ORENI		"protein import into peroxisome matrix, docking [GO:0016560]"	Peroxin-14	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; peroxisomal membrane [GO:0005778]	"integral component of membrane [GO:0016021]; peroxisomal membrane [GO:0005778]; protein import into peroxisome matrix, docking [GO:0016560]"		MEVQGEEERK	20.70000076	1251.698436	0	17.35427	19.6994	0	0	0	12.5285	14.8823	0	13.84225	13.87001	0	13.65437	15.62306	0	0	0	0	0	15.97865	16.59428	17.188	0	13.39987	14.65294	0	0	0	0	0	0	0	0	0	0	0	0	17.2107	0	0	15.93229	0	18.28301	19.14001	0	0	18.88743	0	19.32169	18.83055	18.73096	0	0	0
I3KRS2	I3KRS2_ORENI	LOC100702211		Peroxiredoxin-1 (EC 1.11.1.24)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		peroxidase activity [GO:0004601]; peroxiredoxin activity [GO:0051920]	peroxidase activity [GO:0004601]; peroxiredoxin activity [GO:0051920]	MSAGNAKIGFPAPDFK	2.660000086	1667.332672	0	0	0	0	0	13.95541	0	15.78272	15.19964	13.67619	0	13.74952	13.97072	0	14.00377	0	0	16.86036	14.76483	15.79812	0	16.00293	0	0	0	0	0	15.56023	0	0	0	0	0	0	12.85958	0	14.60826	0	0	0	0	0	16.88582	0	0	0	16.87079	0	0	0	13.87333	0	0	0
A0A669D2W8	A0A669D2W8_ORENI			Peroxiredoxin-like 2 activated in M-CSF stimulated monocytes (Peroxiredoxin-like 2A) (Redox-regulatory protein FAM213A)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; antioxidant activity [GO:0016209]	antioxidant activity [GO:0016209]	RMGGLGFIR	4.940000057	1006.882214	15.11418	14.72225	12.14301	12.06482	12.71237	14.78649	11.91058	15.15585	14.50099	14.35938	16.0311	15.2426	15.6622	0	0	0	19.55867	15.57207	16.25057	15.35876	0	0	13.55908	0	16.4236	0	15.44823	15.94037	0	14.69098	16.60418	12.2142	16.99759	15.33609	14.72202	0	0	14.98581	15.45504	14.85141	0	14.99404	16.26631	14.80598	15.3215	0	14.36728	0	0	17.10321	0	16.19025	15.31124	0
I3ITS6	I3ITS6_ORENI		protein import into peroxisome membrane [GO:0045046]	Peroxisomal biogenesis factor 26	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of peroxisomal membrane [GO:0005779]	integral component of peroxisomal membrane [GO:0005779]; protein-containing complex binding [GO:0044877]; protein import into peroxisome membrane [GO:0045046]	protein-containing complex binding [GO:0044877]	QTALDIIEEK	7.420000076	1160.109063	13.64413	12.57471	12.62891	15.16651	0	12.29778	13.28365	14.48722	13.41282	14.33177	14.15769	9.184834	0	11.83042	0	0	18.02866	10.36325	13.97034	17.85713	0	13.97623	10.95164	18.1605	12.73652	14.95174	18.1135	0	0	0	10.24554	0	14.52941	15.67752	13.18906	10.71744	16.52564	0	0	11.71354	0	13.03034	12.20107	12.56187	0	0	0	0	0	14.71665	14.20962	14.38851	0	15.06724
A0A669CAE9	A0A669CAE9_ORENI			Peroxisomal biogenesis factor 5-like b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; membrane [GO:0016020]	cytoplasm [GO:0005737]; membrane [GO:0016020]		EAGDVLRR	7.730000019	916.5226838	10.6494	13.80578	0	14.49645	14.33357	13.93905	11.85736	14.873	0	0	15.37057	14.57458	0	0	13.67937	13.91476	0	0	13.4747	11.0701	16.26558	0	10.8271	15.17236	11.60286	11.24967	0	14.16861	12.68317	14.32295	15.4502	0	14.46767	12.51637	14.76191	5.823274	16.21875	11.41403	13.7978	13.44671	10.70601	13.22049	15.17475	13.68699	13.2238	14.92164	14.13305	11.92268	0	0	12.41425	0	0	0
A0A669D7I8	A0A669D7I8_ORENI	ppargc1a	mitochondrion organization [GO:0007005]	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	PML body [GO:0016605]	PML body [GO:0016605]; RNA binding [GO:0003723]; signaling receptor binding [GO:0005102]; transcription coregulator activity [GO:0003712]; transcription factor binding [GO:0008134]; mitochondrion organization [GO:0007005]	RNA binding [GO:0003723]; signaling receptor binding [GO:0005102]; transcription coregulator activity [GO:0003712]; transcription factor binding [GO:0008134]	DDGDNFGFITYR	14.96000004	1420.033248	0	17.35797	0	16.57293	19.41963	16.49876	0	0	17.72691	18.32186	17.62149	15.5658	16.02459	16.23773	15.90951	0	0	0	0	13.05711	0	0	15.67681	0	0	0	0	0	0	17.67579	16.62735	0	16.26891	0	14.79543	0	0	0	0	17.72309	0	0	14.89112	16.85552	15.66508	17.17654	15.21887	14.61583	14.14117	0	0	15.92466	16.68702	16.47969
I3KWL5	I3KWL5_ORENI	LOC100693683		Phosphatase and actin regulator	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]; protein phosphatase 1 binding [GO:0008157]; protein phosphatase inhibitor activity [GO:0004864]	actin binding [GO:0003779]; protein phosphatase 1 binding [GO:0008157]; protein phosphatase inhibitor activity [GO:0004864]	LLTRLGSLEGAPPVPVK	4.010000229	1747.306178	0	0	0	0	14.03768	0	10.71894	0	0	16.26508	0	0	0	14.52274	14.33764	15.60325	0	13.60784	0	0	12.8876	0	15.25815	14.89802	0	0	15.47789	0	16.37874	0	0	17.55231	17.8115	15.95831	0	14.79218	0	15.18672	16.27616	14.80368	13.30745	13.76671	11.46803	0	16.15017	0	13.54346	0	0	13.31186	15.75048	16.02808	0	14.89723
A0A669DJR0	A0A669DJR0_ORENI	LOC100694683	phosphate ion transport [GO:0006817]	Phosphate transporter	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; inorganic phosphate transmembrane transporter activity [GO:0005315]; symporter activity [GO:0015293]; phosphate ion transport [GO:0006817]	inorganic phosphate transmembrane transporter activity [GO:0005315]; symporter activity [GO:0015293]	SHTIHK	1.120000005	723.0896461	0	21.01882	14.10681	13.75446	0	14.88916	0	14.2739	16.27678	19.93828	16.50352	15.46525	18.83868	16.91139	19.45058	15.33302	0	15.2287	16.88823	17.83929	0	19.91052	18.24011	15.92776	18.76363	0	0	16.55199	20.80432	20.77113	15.23394	14.59852	0	0	0	20.6438	0	15.14001	0	21.15351	0	14.89803	13.86033	20.34529	15.64024	20.07724	15.59244	15.2574	0	0	0	0	15.87161	0
I3KA83	I3KA83_ORENI	tamm41	cardiolipin biosynthetic process [GO:0032049]; CDP-diacylglycerol biosynthetic process [GO:0016024]	"Phosphatidate cytidylyltransferase, mitochondrial (EC 2.7.7.41) (CDP-diacylglycerol synthase) (Mitochondrial translocator assembly and maintenance protein 41 homolog)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial inner membrane [GO:0005743]	mitochondrial inner membrane [GO:0005743]; phosphatidate cytidylyltransferase activity [GO:0004605]; cardiolipin biosynthetic process [GO:0032049]; CDP-diacylglycerol biosynthetic process [GO:0016024]	phosphatidate cytidylyltransferase activity [GO:0004605]	LRAALVANLK	3.349999905	1066.721179	11.88362	13.96542	0	0	0	12.74449	0	14.6225	0	0	11.28807	14.08783	14.82225	13.52701	0	15.2386	14.84855	0	0	0	0	0	14.03182	14.53031	13.83029	14.08453	14.75508	15.11087	0	15.13974	15.62956	14.19623	17.26155	0	0	0	0	13.48567	0	10.39399	13.38541	14.20737	0	14.86865	13.85052	14.37125	12.31588	15.11852	15.39835	0	13.95733	15.17441	14.99724	13.61401
A0A669EM00	A0A669EM00_ORENI	LOC100705181	fatty acid catabolic process [GO:0009062]; regulation of transcription by RNA polymerase II [GO:0006357]; triglyceride biosynthetic process [GO:0019432]	Phosphatidate phosphatase (EC 3.1.3.4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		phosphatidate phosphatase activity [GO:0008195]; fatty acid catabolic process [GO:0009062]; regulation of transcription by RNA polymerase II [GO:0006357]; triglyceride biosynthetic process [GO:0019432]	phosphatidate phosphatase activity [GO:0008195]	SVSAQIDMLMVNLLK	9.409999847	1678.161749	0	13.69791	0	15.43336	14.41585	0	15.20304	0	0	0	15.19127	14.73927	14.28583	0	13.87894	0	0	0	16.09178	15.38536	0	0	13.74714	16.43876	0	0	11.79456	0	0	0	15.45983	0	0	16.75246	0	0	0	0	0	0	0	0	0	0	15.21109	13.62983	15.05625	10.57433	15.60457	0	15.72262	0	0	0
I3IV48	I3IV48_ORENI	LOC100695712	inositol phosphate dephosphorylation [GO:0046855]; negative regulation of cell population proliferation [GO:0008285]; nervous system development [GO:0007399]; phosphatidylinositol dephosphorylation [GO:0046856]	"Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (EC 3.1.3.16) (EC 3.1.3.48) (EC 3.1.3.67) (Phosphatase and tensin homolog)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; PML body [GO:0016605]	"cytoplasm [GO:0005737]; PML body [GO:0016605]; inositol-1,3,4,5-tetrakisphosphate 3-phosphatase activity [GO:0051717]; phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity [GO:0016314]; phosphatidylinositol-3,4-bisphosphate 3-phosphatase activity [GO:0051800]; phosphatidylinositol-3-phosphatase activity [GO:0004438]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]; protein tyrosine phosphatase activity [GO:0004725]; protein tyrosine/serine/threonine phosphatase activity [GO:0008138]; inositol phosphate dephosphorylation [GO:0046855]; negative regulation of cell population proliferation [GO:0008285]; nervous system development [GO:0007399]; phosphatidylinositol dephosphorylation [GO:0046856]"	"inositol-1,3,4,5-tetrakisphosphate 3-phosphatase activity [GO:0051717]; phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity [GO:0016314]; phosphatidylinositol-3,4-bisphosphate 3-phosphatase activity [GO:0051800]; phosphatidylinositol-3-phosphatase activity [GO:0004438]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]; protein tyrosine/serine/threonine phosphatase activity [GO:0008138]; protein tyrosine phosphatase activity [GO:0004725]"	SSIIKEMVSR	13.56000042	1165.414096	17.74401	17.24371	17.73517	17.40907	16.16248	17.04064	17.94668	16.58329	16.87349	17.23521	17.77138	0	0	17.46941	16.04271	20.968	15.78573	16.97685	0	17.33195	0	19.03151	17.26159	0	17.04685	0	0	0	17.32351	0	17.69559	0	17.40628	21.22678	16.41898	0	0	17.30932	18.6447	0	0	0	15.97307	15.84737	0	18.37666	17.46118	19.26858	0	19.45057	0	0	17.09057	0
A0A669DME5	A0A669DME5_ORENI	LOC100710015	signal transduction [GO:0007165]	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha (Phosphatidylinositol 3-kinase regulatory subunit alpha)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signal transduction [GO:0007165]		NQLSPRNLAESFSPLLFR	5.460000038	2088.738385	0	14.4507	14.91837	13.68494	0	0	15.23621	0	0	16.19002	0	0	0	0	0	0	12.41402	0	0	0	15.06981	16.06215	15.75428	15.68221	12.85341	0	13.82827	14.82305	16.04163	0	18.4236	16.06513	0	0	16.27714	0	0	15.38321	0	16.51261	0	13.25551	15.3475	0	16.42798	15.44729	15.72036	0	14.74287	14.81399	15.68431	0	12.70169	15.778
A0A669F8I5	A0A669F8I5_ORENI	pik3c3	phosphatidylinositol-mediated signaling [GO:0048015]	Phosphatidylinositol 3-kinase catalytic subunit type 3 (EC 2.7.1.137)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		1-phosphatidylinositol-3-kinase activity [GO:0016303]; ATP binding [GO:0005524]; phosphatidylinositol-mediated signaling [GO:0048015]	1-phosphatidylinositol-3-kinase activity [GO:0016303]; ATP binding [GO:0005524]	EMVEGMGGMQSEQYQEFR	3.039999962	2151.347147	0	11.37851	13.45251	13.36108	0	9.856142	11.9643	13.74179	12.05705	12.41275	14.05977	17.52654	14.17486	9.551404	0	0	0	12.31527	14.32724	13.55412	0	0	0	0	14.88955	12.92466	0	15.39884	14.92736	8.94364	0	11.79703	0	0	0	0	13.95225	0	0	0	0	0	0	0	0	0	14.32053	0	13.44052	0	0	0	0	0
A0A481NV19	A0A481NV19_ORENI	pik3r3b LOC100690473		Phosphatidylinositol 3-kinase regulatory subunit gamma b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KAGEEGDWR	8.180000305	1047.388886	0	13.23137	0	0	0	0	14.52403	0	10.6788	0	12.85284	14.3416	9.912703	13.81058	0	0	12.79016	14.45062	13.28469	11.82691	13.06391	14.19289	0	13.41291	0	11.75533	0	0	0	12.79597	14.80196	0	15.43755	18.2239	15.02128	0	13.6543	11.92462	14.13826	15.2719	12.15665	11.04453	15.373	0	18.00438	11.63359	0	8.538056	0	0	0	0	0	0
A0A669DZL4	A0A669DZL4_ORENI		phosphatidylinositol-mediated signaling [GO:0048015]; phosphatidylinositol phosphorylation [GO:0046854]	"Phosphatidylinositol 4-kinase, catalytic, alpha a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		kinase activity [GO:0016301]; phosphatidylinositol phosphorylation [GO:0046854]; phosphatidylinositol-mediated signaling [GO:0048015]	kinase activity [GO:0016301]	LQCMCPVDFRGTFQLDER	7.260000229	2272.602019	12.13428	0	14.14546	6.659452	0	6.520014	13.15595	11.90246	0	0	12.79811	12.61585	18.61499	12.52208	0	12.30487	0	13.12896	0	0	16.78047	10.77659	10.73319	12.95049	18.19439	7.81313	12.68635	17.28094	0	0	0	17.01184	0	13.57362	13.42106	11.73582	13.27467	0	0	11.23185	0	10.8183	12.84046	13.16874	17.33612	11.28016	0	14.28748	0	13.96817	0	0	0	0
I3KDZ0	I3KDZ0_ORENI	PITPNM2		Phosphatidylinositol transfer protein membrane associated 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; phospholipid transporter activity [GO:0005548]	metal ion binding [GO:0046872]; phospholipid transporter activity [GO:0005548]	IRNVTANHR	2.720000029	1077.050112	13.46673	14.07937	13.93843	0	13.34262	13.55742	0	12.98197	14.23581	0	13.45291	14.05223	0	12.05783	0	0	10.7449	12.74431	0	14.44292	13.08937	11.93676	13.84826	15.8406	0	15.5416	13.59242	11.42631	15.20956	0	14.6419	0	17.502	0	13.3967	15.01584	13.54545	0	14.1748	0	14.39157	13.88367	0	12.53618	13.83284	15.75929	14.60089	0	14.1046	0	0	0	0	0
I3JXN5	I3JXN5_ORENI		axonogenesis [GO:0007409]; chordate embryonic development [GO:0043009]	"Phosphatidylinositol transfer protein, alpha a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]; nucleus [GO:0005634]	cytosol [GO:0005829]; nucleus [GO:0005634]; phospholipid transporter activity [GO:0005548]; axonogenesis [GO:0007409]; chordate embryonic development [GO:0043009]	phospholipid transporter activity [GO:0005548]	IAPKGSLTVHEK	4.420000076	1279.38471	0	10.25926	8.812876	0	14.0903	0	14.58135	13.04382	0	12.40824	0	0	0	12.78005	0	0	0	0	0	13.75383	0	0	0	15.21018	0	0	0	0	0	0	13.80976	0	0	0	0	0	0	9.698135	12.21888	13.5305	11.09368	14.34455	0	10.08219	12.53091	0	0	13.01837	0	15.06871	18.42174	0	0	0
I3KIZ3	I3KIZ3_ORENI	inppl1	immune system process [GO:0002376]; phosphatidylinositol dephosphorylation [GO:0046856]	"Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase (EC 3.1.3.86)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]; cytosol [GO:0005829]; filopodium [GO:0030175]; lamellipodium [GO:0030027]; membrane [GO:0016020]; nuclear speck [GO:0016607]	"cytoskeleton [GO:0005856]; cytosol [GO:0005829]; filopodium [GO:0030175]; lamellipodium [GO:0030027]; membrane [GO:0016020]; nuclear speck [GO:0016607]; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity [GO:0034485]; immune system process [GO:0002376]; phosphatidylinositol dephosphorylation [GO:0046856]"	"phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity [GO:0034485]"	GQPMGLGLDACR	6.179999828	1290.121158	0	11.403	12.16678	0	10.88501	13.87837	9.02247	0	10.36242	0	0	0	0	0	16.34896	0	20.10174	12.59595	19.83685	0	0	16.10841	14.29548	0	13.38181	12.58947	0	0	0	0	0	0	13.08328	14.46374	0	0	10.66059	0	10.63664	0	0	0	0	17.72198	12.34535	0	0	12.03918	0	15.20538	14.03281	0	13.79231	12.50982
A0A669BA94	A0A669BA94_ORENI		intracellular signal transduction [GO:0035556]	"Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]; intracellular signal transduction [GO:0035556]	guanyl-nucleotide exchange factor activity [GO:0005085]	NHGLMPRCIMQTMDIMR	5.869999886	2152.606789	14.04248	12.87264	14.54936	13.32149	11.37236	13.75962	8.116909	15.31398	0	13.95159	12.6592	9.751487	0	0	17.23339	13.08493	0	0	9.727582	11.30634	0	11.82644	13.13096	12.54929	12.13666	0	13.42726	13.41186	18.56595	0	12.95924	13.12753	14.35432	10.76636	12.33316	12.92337	12.15901	0	11.64783	0	15.44698	11.43087	10.79584	8.067668	10.84547	9.858354	11.45478	0	0	15.89999	14.42047	0	8.715438	0
A0A669EL36	A0A669EL36_ORENI		intracellular signal transduction [GO:0035556]	"Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]; intracellular signal transduction [GO:0035556]	guanyl-nucleotide exchange factor activity [GO:0005085]	LTAAVK	1.679999948	602.4993418	15.32306	8.74294	10.2016	14.52556	13.11416	14.23003	14.49888	15.60816	14.49091	14.43966	14.26671	16.25851	13.53768	15.37418	15.21627	14.38266	13.96427	14.3865	13.81114	14.74879	11.9637	11.83928	13.55331	12.4014	12.77182	14.25361	10.51214	0	16.49814	14.22251	17.08427	16.50943	16.15709	13.94508	13.48278	14.48791	14.2638	12.66045	11.94364	13.69163	16.06349	14.52547	12.08851	16.30399	12.56602	15.60949	0	15.85982	10.82646	15.3384	15.24357	15.70765	17.24692	15.1259
I3K9U1	I3K9U1_ORENI	LOC100694889		"Phosphatidylinositol-3,4-bisphosphate 4-phosphatase (EC 3.1.3.66)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity [GO:0016316]; phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity [GO:0034597]"	"phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity [GO:0016316]; phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity [GO:0034597]"	TYDVVTIGAPAAHHQGFKGCGLR	4.510000229	2456.398529	0	0	0	12.90188	12.46764	11.03282	0	11.8145	0	12.55667	15.53084	0	13.94503	0	11.40178	0	15.00367	0	0	0	7.297762	0	0	0	0	0	0	0	0	0	0	14.83128	14.29146	0	10.5485	11.33332	10.67634	13.48223	16.1235	10.10184	0	0	0	0	13.59532	12.74863	0	14.38654	0	0	14.55999	0	0	10.16791
A0A669ETS0	A0A669ETS0_ORENI	mtmr2	lipid metabolic process [GO:0006629]	"Phosphatidylinositol-3,5-bisphosphate 3-phosphatase (EC 3.1.3.64) (EC 3.1.3.95) (Phosphatidylinositol-3-phosphate phosphatase)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; membrane [GO:0016020]	"cytoplasm [GO:0005737]; membrane [GO:0016020]; phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity [GO:0052629]; phosphatidylinositol-3-phosphatase activity [GO:0004438]; protein tyrosine phosphatase activity [GO:0004725]; lipid metabolic process [GO:0006629]"	"phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity [GO:0052629]; phosphatidylinositol-3-phosphatase activity [GO:0004438]; protein tyrosine phosphatase activity [GO:0004725]"	SITPVQTFV	7.570000172	991.3720547	0	0	10.73783	12.81175	15.05796	0	11.17739	0	0	15.14551	0	0	14.70086	15.5289	15.90137	13.11865	0	17.76993	0	0	14.8129	0	15.54262	0	0	14.4584	12.51968	14.91833	0	15.51004	15.64127	0	0	0	0	16.09988	0	0	0	12.75018	14.02352	17.41879	0	0	0	0	0	0	0	16.1417	0	15.96307	15.40712	14.81055
A0A669CEU9	A0A669CEU9_ORENI	pik3cg	phosphatidylinositol-mediated signaling [GO:0048015]	"Phosphatidylinositol-4,5-bisphosphate 3-kinase (EC 2.7.1.153)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"phosphatidylinositol-3,4-bisphosphate 5-kinase activity [GO:0052812]; phosphatidylinositol-4,5-bisphosphate 3-kinase activity [GO:0046934]; phosphatidylinositol-mediated signaling [GO:0048015]"	"phosphatidylinositol-3,4-bisphosphate 5-kinase activity [GO:0052812]; phosphatidylinositol-4,5-bisphosphate 3-kinase activity [GO:0046934]"	IKDLPK	2.349999905	711.1524655	17.06554	0	15.22602	16.07251	16.32626	0	15.73137	0	15.32218	15.33132	14.9326	15.20541	17.10955	0	15.72185	16.66147	0	0	16.32072	15.93958	15.52958	15.25287	0	0	0	0	16.1035	0	0	0	16.79858	0	17.13583	15.76717	16.04438	16.9373	16.47156	0	16.11024	0	0	0	16.8093	16.68157	0	16.0977	15.43012	0	17.74025	0	16.56903	0	17.81176	0
A0A669EB56	A0A669EB56_ORENI	pgm3	carbohydrate metabolic process [GO:0005975]; UDP-N-acetylglucosamine biosynthetic process [GO:0006048]	Phosphoacetylglucosamine mutase (PAGM) (EC 5.4.2.3) (Acetylglucosamine phosphomutase) (N-acetylglucosamine-phosphate mutase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		magnesium ion binding [GO:0000287]; phosphoacetylglucosamine mutase activity [GO:0004610]; carbohydrate metabolic process [GO:0005975]; UDP-N-acetylglucosamine biosynthetic process [GO:0006048]	magnesium ion binding [GO:0000287]; phosphoacetylglucosamine mutase activity [GO:0004610]	DTRSSSASLSQAVLDGVSALGGHSK	4.300000191	2430.844659	0	0	14.69857	13.23922	14.31032	14.02662	15.04299	15.20313	14.9318	14.92292	15.02433	0	14.35045	13.72118	14.83452	14.58911	12.69748	0	13.35417	12.60661	10.38763	10.4822	0	8.662889	0	0	13.66283	14.76605	15.35303	16.58075	15.97429	14.81715	14.5355	0	12.96639	0	0	0	0	15.23269	0	13.55178	0	0	14.80509	14.82248	14.03831	0	0	0	16.0372	0	15.03602	12.67653
A0A669BJL8	A0A669BJL8_ORENI	LOC100692702	cAMP catabolic process [GO:0006198]; signal transduction [GO:0007165]	Phosphodiesterase (EC 3.1.4.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"3',5'-cyclic-AMP phosphodiesterase activity [GO:0004115]; metal ion binding [GO:0046872]; cAMP catabolic process [GO:0006198]; signal transduction [GO:0007165]"	"3',5'-cyclic-AMP phosphodiesterase activity [GO:0004115]; metal ion binding [GO:0046872]"	LPAGMSSNELSVEMDSCIR	5.050000191	2128.887774	11.66609	10.63769	11.9443	0	9.532772	13.10869	14.9252	13.39069	11.89445	13.07474	12.03368	0	14.25089	12.38396	9.520123	13.87899	15.23618	0	13.96207	12.31216	0	17.88163	13.69716	12.14654	0	12.66329	0	0	0	0	0	0	0	10.97505	12.10121	15.40858	12.83751	12.25488	14.73188	9.259259	16.00647	13.52805	13.3499	14.38929	0	11.90648	0	11.70722	0	0	0	0	14.31715	0
A0A669EG51	A0A669EG51_ORENI		fructose 6-phosphate metabolic process [GO:0006002]	"Phosphofructokinase, platelet b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; 6-phosphofructokinase activity [GO:0003872]; metal ion binding [GO:0046872]; fructose 6-phosphate metabolic process [GO:0006002]	6-phosphofructokinase activity [GO:0003872]; metal ion binding [GO:0046872]	LNIIIVAEGATDR	1.879999995	1385.778029	0	0	13.90586	15.59015	15.77115	0	15.347	0	16.56333	0	0	0	14.71911	16.72665	15.30579	0	0	0	14.67475	0	16.52823	16.2323	15.5482	15.8639	0	0	13.82689	15.81066	15.39878	14.71155	0	0	17.11244	0	14.88388	15.23735	10.99432	13.92023	0	0	16.20279	14.77646	12.88025	0	15.98468	14.81353	16.12859	0	14.075	14.93669	0	16.35514	0	16.66143
A0A669CJW7	A0A669CJW7_ORENI	inpp5b	phosphatidylinositol dephosphorylation [GO:0046856]; signal transduction [GO:0007165]	Phosphoinositide 5-phosphatase (EC 3.1.3.36)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	early endosome membrane [GO:0031901]; phagocytic vesicle membrane [GO:0030670]	"early endosome membrane [GO:0031901]; phagocytic vesicle membrane [GO:0030670]; inositol phosphate phosphatase activity [GO:0052745]; phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity [GO:0004439]; phosphatidylinositol dephosphorylation [GO:0046856]; signal transduction [GO:0007165]"	"inositol phosphate phosphatase activity [GO:0052745]; phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity [GO:0004439]"	AHILAMPQFGLR	15.05000019	1354.236308	0	17.70868	18.2716	0	16.61924	0	17.26212	18.9226	0	15.74136	0	0	15.88454	0	0	14.49882	0	16.23017	0	17.36095	0	0	0	0	0	0	0	0	0	0	0	0	16.24548	0	0	18.38285	0	0	0	0	0	0	0	0	0	0	15.6493	0	0	0	0	0	0	0
A0A669DKT1	A0A669DKT1_ORENI	LOC100703201	lipid catabolic process [GO:0016042]; phosphatidylinositol-mediated signaling [GO:0048015]	Phosphoinositide phospholipase C (EC 3.1.4.11)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]; calcium-dependent phospholipase C activity [GO:0050429]; phosphatidylinositol phospholipase C activity [GO:0004435]; lipid catabolic process [GO:0016042]; phosphatidylinositol-mediated signaling [GO:0048015]	calcium-dependent phospholipase C activity [GO:0050429]; calcium ion binding [GO:0005509]; phosphatidylinositol phospholipase C activity [GO:0004435]	CMSVMQSGTQMVK	3.900000095	1502.382073	0	14.9756	9.575555	0	13.97692	0	0	12.77999	12.42671	0	15.00512	14.62332	16.18116	12.75474	15.12851	16.70793	15.64832	12.58583	14.0706	14.82361	13.75751	15.5236	14.07622	14.03468	12.61619	14.37759	12.34206	0	13.69923	0	19.84065	19.74099	20.85363	14.05713	13.53201	13.80928	12.24673	12.80122	13.6577	13.12785	13.95485	11.46945	14.65594	14.46386	13.27659	15.1611	0	10.98885	15.32915	13.77248	0	13.58176	15.31929	12.6925
A0A669DFT8	A0A669DFT8_ORENI	LOC100698203	arachidonic acid secretion [GO:0050482]; lipid catabolic process [GO:0016042]; phospholipid metabolic process [GO:0006644]	Phospholipase A2 (EC 3.1.1.4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	"extracellular region [GO:0005576]; calcium ion binding [GO:0005509]; phospholipase A2 activity [GO:0004623]; phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine) [GO:0102567]; phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine) [GO:0102568]; arachidonic acid secretion [GO:0050482]; lipid catabolic process [GO:0016042]; phospholipid metabolic process [GO:0006644]"	"calcium ion binding [GO:0005509]; phospholipase A2 activity [GO:0004623]; phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine) [GO:0102567]; phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine) [GO:0102568]"	GLLELAGAIK	8.359999657	985.5202261	7.657271	8.535941	0	17.24623	7.170324	13.71248	11.91519	0	0	0	16.0564	14.8919	0	11.44789	14.22953	8.069672	0	13.57448	10.53745	16.17673	12.21371	0	14.87179	13.56406	14.42299	13.25155	0	12.35431	10.27895	12.16621	13.33171	0	0	14.03165	7.635931	10.87263	11.97723	12.87977	11.12294	13.97557	14.17601	13.24848	13.63125	13.2599	18.0185	15.73352	10.92109	14.39853	12.4518	12.8114	15.38396	0	13.86805	12.472
A0A669BZA0	A0A669BZA0_ORENI			Phospholipase A2-activating protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]		CSIPGHEMDVR	7.619999886	1316.249248	0	0	0	16.22443	13.99115	15.74381	14.72905	14.72955	0	0	0	0	0	14.7121	14.95129	0	0	15.00412	0	15.90641	14.36042	0	0	15.62504	14.52469	15.61038	16.56206	16.57269	12.37741	15.6826	14.36089	0	16.39265	0	15.57708	0	13.54067	15.09341	15.78996	0	15.72964	16.11432	0	16.60426	0	15.83745	0	0	15.34454	14.67377	0	16.53978	0	16.0718
A0A669D290	A0A669D290_ORENI	LOC100699552	inositol lipid-mediated signaling [GO:0048017]; lipid catabolic process [GO:0016042]; phosphatidic acid biosynthetic process [GO:0006654]	Phospholipase (EC 3.1.4.4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290]; phosphatidylinositol binding [GO:0035091]; phospholipase D activity [GO:0004630]; inositol lipid-mediated signaling [GO:0048017]; lipid catabolic process [GO:0016042]; phosphatidic acid biosynthetic process [GO:0006654]	N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290]; phosphatidylinositol binding [GO:0035091]; phospholipase D activity [GO:0004630]	TLVFKCSSYR	13.40999985	1256.718735	9.216541	9.851228	12.17121	11.10576	0	0	0	18.01073	12.30437	17.10056	0	0	0	11.50968	12.7114	12.39905	0	14.28361	13.46742	12.47734	14.14082	0	0	13.35834	0	14.84675	0	14.37316	0	0	10.66583	12.43889	0	12.48797	0	0	0.5993317	11.73978	10.63576	13.27614	8.741827	14.96564	12.48881	13.74946	0	12.16018	0	0	11.84787	11.63635	0	11.76255	0	0
I3KVK2	I3KVK2_ORENI		axonogenesis [GO:0007409]; phospholipid dephosphorylation [GO:0046839]; phospholipid metabolic process [GO:0006644]	Phospholipid phosphatase related 4a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of plasma membrane [GO:0005887]	integral component of plasma membrane [GO:0005887]; lipid phosphatase activity [GO:0042577]; axonogenesis [GO:0007409]; phospholipid dephosphorylation [GO:0046839]; phospholipid metabolic process [GO:0006644]	lipid phosphatase activity [GO:0042577]	QTGPILTR	8.979999542	885.1279344	12.62217	0	15.4163	13.88937	13.68789	11.41002	10.46634	13.20651	14.60774	0	0	12.31764	13.13642	11.49258	0	16.10141	10.71632	12.8473	17.03353	14.05851	0	13.20293	13.72017	0	15.51545	0	0	0	16.04	0	0	15.2357	16.17409	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669FBJ7	A0A669FBJ7_ORENI	ATP11B	phospholipid transport [GO:0015914]	Phospholipid-transporting ATPase (EC 7.6.2.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase-coupled intramembrane lipid transporter activity [GO:0140326]; magnesium ion binding [GO:0000287]; phospholipid transport [GO:0015914]	ATPase-coupled intramembrane lipid transporter activity [GO:0140326]; ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]	ADNEVNGAPVFVVR	2.039999962	1486.245937	17.53279	0	0	11.69628	0	0	13.83179	14.05838	12.88217	0	16.68716	18.62075	0	14.95153	10.95279	14.06865	13.90033	15.34625	0	0	14.91233	16.66065	0	14.95525	14.70209	12.43793	14.24484	0	0	0	22.2214	22.64506	22.54292	15.42852	0	0	0	13.52242	0	0	0	13.88918	13.96832	15.1307	14.78312	0	0	12.7207	16.83876	17.6513	0	0	0	16.20621
A0A669CU13	A0A669CU13_ORENI	LOC100707493	glycogen metabolic process [GO:0005977]	Phosphorylase b kinase regulatory subunit	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; calmodulin binding [GO:0005516]; glycogen metabolic process [GO:0005977]	calmodulin binding [GO:0005516]	VPVGFYQK	4.639999866	938.1765921	15.29152	13.88436	15.82867	0	0	0	0	15.91712	14.43704	16.55802	0	0	15.4176	13.92691	0	12.73888	15.56715	11.70254	16.19455	15.23097	16.22144	0	15.16366	16.53716	15.27261	15.68214	15.74181	15.85084	16.57331	15.84956	0	14.92616	16.57212	15.44161	14.59288	13.17519	15.03187	15.72849	16.30972	15.66761	15.45387	13.52899	15.19696	11.87498	14.75075	16.4979	15.29365	16.0667	13.196	15.24738	15.85982	12.52776	11.73361	0
A0A669D120	A0A669D120_ORENI	phkg1	glycogen biosynthetic process [GO:0005978]	Phosphorylase kinase (EC 2.7.11.19)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	phosphorylase kinase complex [GO:0005964]	phosphorylase kinase complex [GO:0005964]; ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; phosphorylase kinase activity [GO:0004689]; glycogen biosynthetic process [GO:0005978]	ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; phosphorylase kinase activity [GO:0004689]	QDNLHDK	5.920000076	870.2178059	14.2957	13.33563	14.67612	14.65061	15.28995	15.08121	15.38073	16.89211	15.26998	15.42425	0	0	15.41511	16.20484	10.91759	18.03605	16.49781	12.57122	15.63729	13.98574	0	15.41748	15.45735	15.97489	16.09922	15.75905	17.36187	15.78629	18.05163	14.55504	17.41908	16.18117	0	13.10339	0	13.09014	14.42048	0	0	14.33362	9.492591	0	15.3452	0	0	0	0	0	12.37298	17.24486	16.00593	0	0	0
I3KA33	I3KA33_ORENI	gck	cellular glucose homeostasis [GO:0001678]; glycolytic process [GO:0006096]; hexose metabolic process [GO:0019318]; positive regulation of insulin secretion [GO:0032024]	Phosphotransferase (EC 2.7.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; glucokinase activity [GO:0004340]; glucose binding [GO:0005536]; cellular glucose homeostasis [GO:0001678]; glycolytic process [GO:0006096]; hexose metabolic process [GO:0019318]; positive regulation of insulin secretion [GO:0032024]	ATP binding [GO:0005524]; glucokinase activity [GO:0004340]; glucose binding [GO:0005536]	ASVDQILSEFR	2.269999981	1265.862676	14.06014	14.39989	14.59117	14.11795	17.18222	15.54205	15.30814	17.175	15.47621	15.83814	14.17152	15.37853	16.76991	16.40096	14.60663	14.66967	15.59952	15.85069	0	14.95387	0	14.38922	16.35718	15.81777	16.58919	16.96575	15.86684	0	16.41608	16.41519	0	16.31437	16.885	0	10.91818	14.94307	14.99608	15.66419	14.93594	15.08444	0	17.1215	15.8039	15.89573	16.44503	15.23121	17.40116	16.2787	13.50408	0	0	17.04477	0	0
A0A669ECJ8	A0A669ECJ8_ORENI	LOC100691300		Phosvitin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		lipid transporter activity [GO:0005319]; nutrient reservoir activity [GO:0045735]	lipid transporter activity [GO:0005319]; nutrient reservoir activity [GO:0045735]	QLFGPSIPGFK	16.72999954	1190.990898	13.32972	12.82427	14.12402	15.85183	14.29104	15.44058	17.58801	15.77098	0	15.76605	14.51501	0	15.12173	0	0	15.72588	0	0	12.78897	0	15.87552	0	13.58377	0	15.94952	15.52939	14.70294	16.21071	13.12041	15.69382	0	17.432	17.7574	14.91299	0	16.86188	14.5563	0	15.94271	16.30045	16.64244	16.37534	17.95905	18.27272	17.77999	17.68188	17.80383	15.7027	15.12119	11.53754	16.36607	0	16.47945	14.41365
A0A669EKC3	A0A669EKC3_ORENI	LOC100701087	protein-chromophore linkage [GO:0018298]	Photolyase/cryptochrome alpha/beta domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein-chromophore linkage [GO:0018298]		EAVQGAATVR	4.070000172	1000.999435	13.11344	15.22426	15.42113	14.76394	13.87728	0	14.31868	0	0	15.19786	0	0	0	17.85227	0	0	17.59034	15.12501	15.06813	15.17322	15.23822	15.13405	16.3731	16.49908	15.01689	15.09563	16.76078	14.87358	11.97486	0	15.73191	16.15575	19.05956	12.49376	15.88739	15.62124	0	16.45096	0	15.79894	14.27656	15.69652	14.90102	16.57559	16.83854	16.15887	15.77112	14.05137	13.80039	15.55414	17.80753	16.13769	17.70776	16.37968
A0A669E2C8	A0A669E2C8_ORENI	PHYHIP		Phytanoyl-CoA 2-hydroxylase interacting protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GSAGRLLK	4.610000134	796.7717172	12.91733	14.74533	12.29817	0	13.863	13.23582	0	15.27977	12.14167	15.86024	14.83325	15.89621	18.84958	16.10258	16.39105	15.01348	16.53033	15.64936	0	14.30252	14.24364	13.80424	16.73157	16.88549	14.82563	15.89415	15.17457	16.79238	15.10675	0	17.0906	15.19342	15.82345	17.70601	16.1894	15.1517	14.89878	15.50399	17.83997	17.40165	15.31772	18.89268	14.33503	14.96528	17.51443	15.50906	14.8971	16.27431	17.71447	0	15.88065	0	0	0
A0A669AVJ3	A0A669AVJ3_ORENI			Piezo-type mechanosensitive ion channel component 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; mechanosensitive ion channel activity [GO:0008381]	mechanosensitive ion channel activity [GO:0008381]	LGEAGNDSVLKVLGGMVMSCYAK	3.019999981	2414.388624	0	10.62937	0	14.75682	0	13.77566	11.07148	16.60119	13.91473	11.67277	0	0	0	0	0	10.81105	11.81517	0	14.21562	13.28759	13.31081	9.017159	0	0	13.52744	0	0	7.704104	14.96955	0	12.15049	14.5915	12.55449	0	0	0	0	9.99782	10.80143	7.017888	0	12.75886	0	9.519853	11.11484	0	16.79891	12.00715	16.81334	14.20168	12.87447	11.76574	15.0026	13.79637
A0A669D8H9	A0A669D8H9_ORENI			Piezo-type mechanosensitive ion channel component	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; mechanosensitive ion channel activity [GO:0008381]	mechanosensitive ion channel activity [GO:0008381]	LGAMEAGNDSVLK	7.809999943	1321.657605	13.74499	16.12281	14.34358	15.73583	0	15.52688	0	17.28838	0	18.35078	0	16.34143	16.27473	14.62443	14.67669	16.75865	0	0	15.72333	14.37208	0	0	0	0	0	0	0	0	0	17.18051	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DJF8	A0A669DJF8_ORENI			Pirin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SGDLQWMTAGR	7.119999886	1217.243537	10.47022	13.1775	11.5245	7.975576	12.76689	13.43827	14.60866	13.17692	0	13.68383	11.96881	13.11013	0	13.75093	10.72976	12.85281	14.93708	0	0	14.60814	13.04263	11.25379	14.02186	14.76874	16.92214	11.68381	18.71577	13.5565	13.02168	14.21083	15.5582	0	0	0	0	0	14.26165	13.99856	13.06408	15.47474	14.14494	13.01998	14.45618	0	0	0	0	13.9178	0	0	0	13.3287	0	13.84049
A0A669C1Z3	A0A669C1Z3_ORENI	pitrm1	proteolysis [GO:0006508]	"Pitrilysin metalloproteinase 1 (Presequence protease, mitochondrial)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; proteolysis [GO:0006508]	metal ion binding [GO:0046872]	ALQYQPGQK	7.599999905	1033.376284	14.11029	13.78969	0	13.78091	0	14.98978	19.9554	13.82469	18.25533	15.96723	14.51596	16.00986	12.55587	12.67135	15.38789	16.41485	20.19833	10.46542	12.86147	11.76436	15.27606	16.03826	15.68911	14.78422	14.50368	14.79831	0	14.73025	0	15.5858	11.4178	19.56301	15.71875	0	10.67306	13.23834	17.47974	14.85402	13.99651	15.24365	14.76119	13.24865	17.0382	15.54848	18.52047	15.36615	13.16903	10.2134	19.34508	14.0118	0	17.22844	18.15634	18.7765
A0A669BEG6	A0A669BEG6_ORENI		cell-cell adhesion [GO:0098609]; positive regulation of cytokinesis [GO:0032467]; positive regulation of GTPase activity [GO:0043547]	Plakophilin 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell junction [GO:0030054]	cell junction [GO:0030054]; cell-cell adhesion [GO:0098609]; positive regulation of cytokinesis [GO:0032467]; positive regulation of GTPase activity [GO:0043547]		TLAGFIHVFK	4.260000229	1133.445928	12.51572	0	11.10006	9.357441	14.31522	11.82202	0	0	0	15.67733	0	0	14.5582	0	8.628131	0	14.05782	0	16.14988	0	14.12659	12.22476	10.83227	0	16.32652	9.44486	14.02245	0	0	0	17.91598	14.32445	18.49127	0	17.2212	0	15.09793	0	0	0	11.38368	0	9.001312	14.38619	8.999285	0	9.526761	10.49189	12.49787	16.42762	15.33155	0	0	0
A0A669BG25	A0A669BG25_ORENI		blood coagulation [GO:0007596]; fibrinolysis [GO:0042730]; tissue remodeling [GO:0048771]	Plasminogen (EC 3.4.21.7)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; serine-type endopeptidase activity [GO:0004252]; blood coagulation [GO:0007596]; fibrinolysis [GO:0042730]; tissue remodeling [GO:0048771]	serine-type endopeptidase activity [GO:0004252]	TNSGKICQR	5.570000172	1061.742693	14.82407	12.63116	15.05755	0	0	14.11677	15.45012	15.33386	15.82659	14.96049	11.02663	15.43259	13.91798	16.65719	14.09744	0	0	0	15.00108	16.27166	0	0	0	0	0	16.43592	14.95659	16.11653	16.09612	14.32592	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KRH0	I3KRH0_ORENI	PLEKHG3		Pleckstrin homology and RhoGEF domain containing G3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	QPAVEK	3.900000095	671.3954536	12.06692	13.96578	15.28781	15.10703	13.97465	14.7711	15.90647	15.23621	0	15.18642	16.33221	16.3329	0	15.30497	0	16.10952	15.50588	13.89651	15.01025	16.53518	18.07496	0	14.99858	15.34056	10.00852	16.03936	15.73402	15.37089	0	13.95787	16.31769	14.85403	15.28822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3JFW7	I3JFW7_ORENI			"Pleckstrin homology domain containing, family A member 7b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VGPNK	2.390000105	515.4147502	15.93202	13.16239	15.49247	14.17365	15.6044	15.29435	15.82975	14.78883	13.96323	12.71768	15.14856	16.27193	15.66729	15.83982	15.68772	13.75362	15.24918	14.04159	15.58547	14.6076	14.94271	16.47892	13.74745	16.07395	13.54034	16.29613	16.20899	16.85949	16.58181	16.77779	16.68013	16.25513	16.97763	14.89993	15.77353	16.31362	15.07486	16.11026	13.72718	15.56618	15.6048	15.53103	16.05223	14.2275	15.76	0	16.82297	17.29198	15.05675	15.69702	0	0	15.91593	15.1459
A0A669EWP2	A0A669EWP2_ORENI			"Pleckstrin homology domain containing, family H (with MyTH4 domain) member 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]	cytoskeleton [GO:0005856]		TVEEKAAK	6.599999905	874.8214281	16.5627	17.14592	15.10973	17.64231	17.03459	0	17.39573	16.98844	17.36412	17.10122	16.72463	17.07412	17.46328	17.14869	17.46627	16.52619	17.82851	16.74156	16.71959	17.65417	17.79628	17.74937	17.03635	16.69237	18.28988	16.4219	0	0	16.63373	16.4506	16.41982	16.94967	17.30897	0	15.24349	16.08387	16.8199	16.89543	17.17889	17.04408	15.61755	15.97883	17.76498	16.42558	17.90634	16.31379	16.76097	15.15026	17.88406	16.92197	17.20061	16.26769	17.48721	18.15499
A0A669D9Y1	A0A669D9Y1_ORENI		positive regulation of apoptotic process [GO:0043065]	"Pleckstrin homology-like domain, family A, member 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; phosphatidylinositol phosphate binding [GO:1901981]; positive regulation of apoptotic process [GO:0043065]	phosphatidylinositol phosphate binding [GO:1901981]	ETMSPGEK	12.53999996	877.6453864	0	0	0	16.42383	0	13.80904	12.60926	0	0	0	0	0	14.83426	0	16.30632	14.0847	0	9.850215	0	11.81574	13.02255	15.73402	0	0	13.57551	15.10213	0	14.1102	7.609175	11.81864	0	15.04547	15.92415	0	0	16.20446	14.65189	12.57731	14.55538	11.79068	13.29991	14.50713	7.507618	0	0	0	13.55662	2.71864	15.34507	0	0	14.83147	14.958	0
A0A669AUV3	A0A669AUV3_ORENI			"Pleckstrin homology-like domain, family B, member 1a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				IWMDVIVTGAEGYTQFMS	4.829999924	2065.126062	13.55091	16.79773	13.27026	13.71971	0	16.9267	0	0	0	14.82342	14.62559	0	0	0	0	13.00297	13.00265	0	0	17.57794	0	16.2123	17.75831	0	16.05392	13.05739	0	12.98365	13.82905	0	14.67565	0	7.979325	0	0	0	12.98994	13.6887	0	11.52864	15.05402	12.34659	0	0	13.78519	9.974391	0	0	0	0	16.42601	0	0	0
A0A669F3F5	A0A669F3F5_ORENI			"Pleckstrin homology-like domain, family B, member 1b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SFPKSSTAMR	7.829999924	1127.677649	15.74736	15.20214	0	15.75266	0	14.23851	15.99836	15.77388	14.86149	13.94519	15.71522	15.53877	15.04487	14.44641	17.4773	15.06089	0	14.21125	0	14.76429	13.66238	18.56176	15.64926	0	18.63933	15.22128	15.91143	15.62215	17.13781	0	14.73911	15.16007	15.05214	19.44785	14.7961	0	0	19.33232	15.86819	15.78874	16.04547	14.26843	0	16.77015	14.68725	16.21538	12.28737	15.47579	13.716	15.79401	0	0	0	0
A0A669D4M6	A0A669D4M6_ORENI			"Pleckstrin homology-like domain, family B, member 2a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EKNNLLVMLQK	4.300000191	1345.709768	0	7.621683	11.30041	10.07497	11.1184	0	0	0	0	0	0	12.67637	12.28244	0	12.34895	9.317987	0	12.06295	0	10.47197	0	0	0	10.98331	13.82714	0	17.65166	0	12.98573	0	0	0	0	11.47679	0	13.1244	0	10.45359	12.19205	0	12.2168	13.05991	0	0	9.234415	11.58543	0	0	12.91157	12.74831	0	13.5671	9.082731	12.27294
A0A669ETJ6	A0A669ETJ6_ORENI		intermediate filament cytoskeleton organization [GO:0045104]	Plectin b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; actin binding [GO:0003779]; intermediate filament cytoskeleton organization [GO:0045104]	actin binding [GO:0003779]	VAGMLMPLR	5.090000153	1003.594462	0	0	8.011523	12.88245	12.94556	7.948125	15.3417	13.90996	10.04184	15.18124	15.67624	10.79575	14.53563	12.53221	13.85065	13.89172	13.03866	11.45633	0	11.30981	14.81853	0	11.65878	13.7485	12.64387	0	13.08726	14.43615	8.274081	9.775686	0	0	7.695864	12.34156	0	16.82302	11.70443	13.60233	0	11.64565	11.84753	10.40295	12.01606	11.47534	14.03164	14.78716	0	0	13.03784	0	15.0065	8.385155	13.39219	0
A0A669D5X8	A0A669D5X8_ORENI		positive regulation of cell division [GO:0051781]	Pleiotrophin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; growth factor activity [GO:0008083]; heparin binding [GO:0008201]; positive regulation of cell division [GO:0051781]	growth factor activity [GO:0008083]; heparin binding [GO:0008201]	IKVLLLI	31.98999977	810.35545	21.00141	0	20.22136	18.65663	17.45218	17.40258	0	18.2417	16.51785	0	0	17.06964	21.02484	21.618	18.1599	17.24634	17.41185	16.87287	0	18.38565	0	19.80725	16.37172	17.89151	0	0	0	20.62248	20.89869	16.60652	17.26927	0	17.56394	19.79612	18.89425	21.2292	19.56911	17.53076	17.861	0	18.0216	17.05088	0	0	17.59933	18.63092	18.56218	21.03368	19.38851	0	0	0	17.78419	0
A0A669CTG7	A0A669CTG7_ORENI			Plexin b2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; semaphorin receptor activity [GO:0017154]	semaphorin receptor activity [GO:0017154]	NLDSYMVR	6.199999809	997.5803381	13.24569	12.83583	0	0	15.2411	14.37132	10.99942	15.66118	13.8435	15.76323	0	12.62375	13.55008	12.70372	12.92753	14.84315	0	0	15.18836	15.16039	15.77531	0	14.54214	0	0	14.14423	0	0	0	0	0	0	15.41413	0	14.13388	0	11.44623	12.90123	10.16939	13.43135	7.976301	4.280843	0	16.44868	13.67663	14.11337	13.06881	13.79932	13.05025	0	10.95879	0	0	0
A0A669CFZ1	A0A669CFZ1_ORENI	GPAT4		PlsC domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum [GO:0005783]; integral component of membrane [GO:0016021]	"endoplasmic reticulum [GO:0005783]; integral component of membrane [GO:0016021]; transferase activity, transferring acyl groups [GO:0016746]"	"transferase activity, transferring acyl groups [GO:0016746]"	YGFLLPLR	8.06000042	977.4619681	0	0	0	0	0	14.70139	16.68165	12.22744	0	0	15.08008	13.198	16.88296	14.90324	0	0	12.07662	17.26943	15.50217	14.07944	14.78931	14.51548	17.65452	17.21985	13.82579	13.0682	15.52522	15.62788	13.59199	0	0	0	0	0	0	16.63676	17.16365	0	0	0	0	17.17876	0	0	16.97164	15.90802	0	12.79989	15.86773	15.02456	16.19835	0	0	0
A0A669ELU4	A0A669ELU4_ORENI	plk4	centriole replication [GO:0007099]	Polo-like kinase 4 (EC 2.7.11.21) (Serine/threonine-protein kinase PLK4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centriole [GO:0005814]; cytoplasm [GO:0005737]	centriole [GO:0005814]; cytoplasm [GO:0005737]; ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; centriole replication [GO:0007099]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ISCDGSMVHYSINLSMWK	5.340000153	2127.138723	13.20512	12.48969	12.71235	13.16481	12.91798	0	12.11669	14.28823	13.92713	13.6608	10.67563	0	13.34434	12.88854	0	14.91067	11.89856	0	0	16.19826	0	0	11.20988	11.95533	13.05309	13.70117	15.90834	13.12629	12.67055	15.31739	0	0	15.5584	0	10.48209	14.01426	0	0	14.82003	16.46091	15.86713	13.99339	13.12435	13.44871	9.389008	0	12.16287	14.1732	14.43321	10.74791	14.57259	12.38707	13.08839	10.44002
A0A669E661	A0A669E661_ORENI	LOC100694656		Poly [ADP-ribose] polymerase (PARP) (EC 2.4.2.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		NAD+ ADP-ribosyltransferase activity [GO:0003950]	NAD+ ADP-ribosyltransferase activity [GO:0003950]	GNIQDQTTDVIVNTISEDMK	4.829999924	2237.881555	0	0	0	0	13.24211	0	13.38378	13.84786	8.924041	12.84915	12.39602	11.25771	13.64942	9.162958	13.89965	0	12.0945	9.903902	16.91937	16.01447	14.2205	0	13.48654	11.5793	0	0	0	14.48909	0	9.873775	0	0	0	0	0	13.99759	9.851858	10.94983	0	9.356767	0	10.53995	0	0	17.34742	10.59416	9.771608	0	12.86468	0	17.61878	0	0	0
A0A669EB64	A0A669EB64_ORENI			"Poly(A) binding protein, nuclear 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; RNA binding [GO:0003723]	RNA binding [GO:0003723]	VREMEEEAEK	9.090000153	1265.546625	0	0	0	17.35666	15.25608	13.2581	14.2452	0	0	0	16.54151	0	14.7779	0	15.1437	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.10515	0	0	0	0	16.55772	0	16.99363	17.01955	0	17.2436	0	0
A0A669BD45	A0A669BD45_ORENI	LOC102082008		Poly(U)-specific endoribonuclease (EC 3.1.-.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		endoribonuclease activity [GO:0004521]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]	endoribonuclease activity [GO:0004521]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]	FIGSAYPATP	5.710000038	1023.572793	13.87338	14.50714	12.88192	11.77683	14.21567	12.66136	13.60284	14.96228	12.64024	0	15.86054	13.76656	13.58333	0	12.95173	13.83519	12.60005	17.88738	12.62376	17.39055	13.48555	15.27069	14.29436	19.00182	13.60508	15.02586	14.06154	14.10725	12.91871	0	14.57736	0	0	15.10847	15.85349	14.25066	0	15.36538	0	0	14.26419	0	11.26237	0	17.60149	0	13.91078	15.11317	0	14.58522	14.3659	0	0	14.44
A0A669F903	A0A669F903_ORENI			Polyadenylate-binding protein (PABP)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; RNA binding [GO:0003723]	RNA binding [GO:0003723]	MVSTAPVKEGNESMFNFFQQK	1.429999948	2450.66462	0	11.18013	11.66748	14.61716	0	0	14.77342	0	0	0	0	0	0	18.56212	0	18.00901	17.86358	19.36761	15.34328	17.84056	12.37816	11.26907	13.42932	19.11446	9.753331	0	14.58696	16.24516	0	12.35295	0	0	0	12.51562	0	0	14.32728	12.27453	11.21039	10.8526	0	11.05521	0	9.846701	0	0	12.5392	0	0	10.83487	17.30132	0	0	0
A0A669DU66	A0A669DU66_ORENI			Polycystic kidney and hepatic disease 1 (autosomal recessive)-like 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LRGNHR	9.460000038	752.9171918	16.05285	13.78665	12.26305	18.31909	15.84297	14.56176	15.08009	0	12.08744	15.37436	17.7131	0	16.20622	0	0	0	0	0	0	0	15.5711	18.27028	0	0	16.11312	15.6522	13.05404	15.781	17.39688	0	0	17.26095	18.01645	11.03481	0	17.08074	0	0	0	15.18087	0	0	0	12.01583	16.14592	0	0	0	0	0	0	0	0	17.20773
I3KMG6	I3KMG6_ORENI		liver development [GO:0001889]; lymphangiogenesis [GO:0001946]; pronephros development [GO:0048793]; regulation of collagen biosynthetic process [GO:0032965]	Polycystic kidney disease 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cilium [GO:0005929]; integral component of membrane [GO:0016021]	cilium [GO:0005929]; integral component of membrane [GO:0016021]; liver development [GO:0001889]; lymphangiogenesis [GO:0001946]; pronephros development [GO:0048793]; regulation of collagen biosynthetic process [GO:0032965]		KTSVIFQEPK	2.930000067	1177.629994	11.02403	0	15.58154	10.08287	0	0	0	13.51706	13.36849	15.87709	14.8481	15.11831	0	12.26005	12.4229	0	11.91702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.90093	0	0	0	0	0	0	0	0	0	0	13.54448	0	0	0	0	0	0	0	0	0	0	0
A0A669BAI3	A0A669BAI3_ORENI			Polymeric immunoglobulin receptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		EHMIKIDNK	14.57999992	1143.608158	17.72519	17.706	16.33774	17.36453	16.99262	17.67341	15.92166	18.05128	17.26667	0	18.11766	17.83766	18.72461	18.33121	18.308	18.75573	15.72751	15.77784	0	14.81136	13.67372	18.73762	15.89664	14.62982	16.26158	18.62572	0	17.05091	18.6071	17.57791	18.09574	15.95915	15.91408	0	17.87687	0	17.40336	17.22707	17.96835	18.03418	17.5445	16.65336	0	17.99503	17.65955	17.07745	16.4415	17.1351	15.80879	16.5348	17.3389	17.13155	13.87242	15.64519
I3J9Z5	I3J9Z5_ORENI	GALNT15	protein glycosylation [GO:0006486]	Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; carbohydrate binding [GO:0030246]; polypeptide N-acetylgalactosaminyltransferase activity [GO:0004653]; protein glycosylation [GO:0006486]	carbohydrate binding [GO:0030246]; polypeptide N-acetylgalactosaminyltransferase activity [GO:0004653]	GPPTHGEMGK	6.760000229	1026.690045	14.12495	14.14389	12.50575	13.44778	16.36144	8.056941	17.65183	15.53515	15.37638	14.24403	0	15.03392	12.71889	0	0	13.65937	0	16.06397	13.30811	0	0	0	15.46153	14.62197	0	14.61596	0	13.90099	12.73177	16.21384	0	13.71912	0	17.21497	11.4415	14.05037	16.08863	12.87506	11.97922	13.25488	13.45834	14.20358	11.79527	10.10756	14.39454	10.66287	14.34845	11.71793	12.59805	13.78912	12.31679	17.14051	14.79796	15.03244
I3K332	I3K332_ORENI		protein glycosylation [GO:0006486]	Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.41)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; carbohydrate binding [GO:0030246]; polypeptide N-acetylgalactosaminyltransferase activity [GO:0004653]; protein glycosylation [GO:0006486]	carbohydrate binding [GO:0030246]; polypeptide N-acetylgalactosaminyltransferase activity [GO:0004653]	GLASAR	7.199999809	575.2577502	19.56311	20.14204	18.66185	20.07438	19.50763	20.1339	19.92669	19.53378	19.66644	16.74935	19.73737	19.59718	19.32025	19.13465	17.98618	19.02057	15.0986	19.4103	19.88203	19.6248	18.89741	19.05727	19.25452	18.29386	19.24545	19.45899	19.47934	20.09078	19.88545	20.04232	19.11225	17.53193	19.78318	19.82449	18.59204	18.99575	19.56984	19.81638	19.61274	19.6261	19.80957	19.98573	18.92204	19.29918	16.94893	18.58851	18.18125	18.36027	18.78864	18.45615	19.59634	19.33748	16.81626	19.45762
A0A669CF94	A0A669CF94_ORENI		mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	Polypyrimidine tract binding protein 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; RNA binding [GO:0003723]; mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	RNA binding [GO:0003723]	SHCTFTFFPPSCIPSRVLHLR	7.53000021	2559.93899	0	13.63972	13.42566	11.98611	16.06721	12.22577	0	13.92881	11.69286	0	7.409279	0	0	0	12.19522	10.66764	11.43194	11.54846	14.78955	13.70927	12.18595	0	12.95518	14.48259	12.5628	14.13822	0	0	9.720246	0	0	0	12.85974	0	13.03651	15.17093	9.819721	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.73653	13.78885	0
A0A669DPA5	A0A669DPA5_ORENI	pgap3	GPI anchor biosynthetic process [GO:0006506]	Post-GPI attachment to proteins factor 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; GPI anchor biosynthetic process [GO:0006506]		AFVNPDGPRR	5.46999979	1129.678709	12.87977	10.02686	12.61431	12.69877	0	12.22037	9.481205	13.07527	10.62341	12.20752	12.08116	18.30466	13.50769	13.16901	0	13.56722	14.86064	10.83411	17.29152	14.12594	0	0	12.37644	13.97705	15.25795	13.61901	0	0	10.50009	10.14105	14.60893	12.87007	10.12651	15.37476	0	14.57505	13.9176	13.88157	11.28699	0	8.643128	13.16765	13.42881	0	13.86892	12.54716	15.20759	14.3746	11.50749	14.74993	11.90679	0	13.88828	13.11124
A0A669BEX7	A0A669BEX7_ORENI			Post-proline cleaving enzyme (EC 3.4.21.26) (Prolyl endopeptidase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		serine-type endopeptidase activity [GO:0004252]	serine-type endopeptidase activity [GO:0004252]	GIFYNCYPR	3.410000086	1188.851725	13.59678	13.51029	11.22088	0	0	12.47396	14.59971	8.300931	15.77898	14.96966	0	9.345293	0	13.22333	0	0	0	0	0	0	0	16.35301	15.13482	0	0	0	12.16146	0	0	0	13.9847	20.57263	14.33094	13.91557	0	0	10.89698	13.40079	11.09418	13.00609	0	12.5931	15.36649	12.80178	0	13.33738	0	0	14.71218	13.09236	0	12.42522	0	0
A0A669BSB7	A0A669BSB7_ORENI		regulation of ion transmembrane transport [GO:0034765]	"Potassium channel, voltage gated eag related subfamily H, member 7"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; voltage-gated potassium channel activity [GO:0005249]; regulation of ion transmembrane transport [GO:0034765]	voltage-gated potassium channel activity [GO:0005249]	AFRGATK	11.68999958	748.4933272	0	0	14.288	12.36393	14.85802	0	14.13234	0	0	0	0	0	14.48409	16.00129	0	15.76585	0	0	0	0	0	0	0	0	0	0	0	0	14.42979	15.56316	16.62554	17.05786	17.16484	0	0	13.76112	0	0	0	0	0	0	0	13.25605	15.66748	13.52531	0	9.997241	13.2638	0	0	0	14.17494	0
I3J041	I3J041_ORENI	KCNK4		Potassium two pore domain channel subfamily K member 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; potassium channel activity [GO:0005267]	potassium channel activity [GO:0005267]	VSPTIVR	18.76000023	771.3242678	0	16.13707	16.61356	15.90062	18.35644	16.4531	0	0	14.8975	16.75722	19.35563	18.23002	15.57186	14.3459	0	0	17.63062	15.84113	12.66223	0	0	0	16.45257	15.0754	16.52435	0	0	15.17491	0	0	16.39323	18.31429	17.92582	0	0	14.7519	14.99802	16.14271	14.58807	14.95386	0	0	15.78256	15.2671	0	14.22007	13.89792	16.00678	14.37327	0	14.92312	17.0656	0	14.17937
I3IZA4	I3IZA4_ORENI	KCNV1	protein homooligomerization [GO:0051260]; regulation of ion transmembrane transport [GO:0034765]	Potassium voltage-gated channel subfamily V member 1 (Voltage-gated potassium channel subunit Kv8.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated potassium channel complex [GO:0008076]	voltage-gated potassium channel complex [GO:0008076]; voltage-gated potassium channel activity [GO:0005249]; protein homooligomerization [GO:0051260]; regulation of ion transmembrane transport [GO:0034765]	voltage-gated potassium channel activity [GO:0005249]	SVLEMMR	8.789999962	896.6542236	10.25536	13.62042	15.25718	0	0	13.02265	14.01323	10.99786	14.83249	13.16077	0	6.086857	12.45759	0	0	15.27072	12.87695	0	14.28916	0	0	0	0	0	15.2308	0	16.10344	0	0	0	13.37895	14.25676	13.7892	0	13.84837	0	0	0	13.59552	0	0	13.16528	0	0	0	0	13.37911	0	15.13316	0	14.14096	16.61143	0	14.99471
A0A669C072	A0A669C072_ORENI	slu7	"mRNA splicing, via spliceosome [GO:0000398]"	Pre-mRNA-splicing factor SLU7	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	spliceosomal complex [GO:0005681]	"spliceosomal complex [GO:0005681]; pre-mRNA 3'-splice site binding [GO:0030628]; second spliceosomal transesterification activity [GO:0000386]; mRNA splicing, via spliceosome [GO:0000398]"	pre-mRNA 3'-splice site binding [GO:0030628]; second spliceosomal transesterification activity [GO:0000386]	APTEEEMEAFR	1.620000005	1325.011052	14.38393	12.20269	10.69343	0	11.78464	10.45587	0	10.97266	0	0	0	0	13.91126	14.05886	0	0	12.30996	15.35101	0	13.33861	0	0	11.93088	0	12.57538	0	13.7229	13.06011	0	13.61822	0	0	0	0	12.09238	11.64096	13.17813	13.48518	10.00714	18.5463	9.103615	0	0	0	0	0	7.437031	13.44029	0	0	13.62092	0	13.27019	12.91095
I3KIB0	I3KIB0_ORENI	pfdn4	protein folding [GO:0006457]	Prefoldin subunit 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	prefoldin complex [GO:0016272]	prefoldin complex [GO:0016272]; unfolded protein binding [GO:0051082]; protein folding [GO:0006457]	unfolded protein binding [GO:0051082]	FGNNINLEADES	7.090000153	1323.737185	18.06633	16.65264	18.5349	0	0	0	0	0	0	16.45189	17.70951	0	0	0	0	0	0	0	16.9383	0	0	16.31597	0	0	0	14.09467	15.26957	0	12.78321	0	0	0	0	14.35689	0	0	0	0	0	0	0	0	0	14.38305	0	0	0	0	0	14.7272	0	17.22809	0	0
A0A669BLS7	A0A669BLS7_ORENI	LOC100704213	nucleoside metabolic process [GO:0009116]	Pribosyltran domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		nucleoside metabolic process [GO:0009116]		GIVGTGKTMK	12.57999992	1005.329609	0	18.15554	18.77438	17.64744	17.71722	0	17.7304	0	0	0	18.49199	0	0	0	17.99328	0	0	17.88797	18.41122	0	0	18.47692	18.25092	0	17.94465	17.45719	0	17.99489	0	17.85632	17.26695	17.88331	0	0	0	18.06606	0	17.26105	0	17.14807	0	0	17.30973	0	0	0	17.1779	0	18.08366	0	17.43911	17.64369	0	0
A0A669EU16	A0A669EU16_ORENI	LOC100700674	nucleoside metabolic process [GO:0009116]; nucleotide biosynthetic process [GO:0009165]	Pribosyltran_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		magnesium ion binding [GO:0000287]; ribose phosphate diphosphokinase activity [GO:0004749]; nucleoside metabolic process [GO:0009116]; nucleotide biosynthetic process [GO:0009165]	magnesium ion binding [GO:0000287]; ribose phosphate diphosphokinase activity [GO:0004749]	IYIMATHGLLSADAPR	8.859999657	1728.677206	14.96994	13.93803	0	13.39695	9.800949	0	0	0	12.0035	14.76502	13.52237	0	0	0	14.55448	0	0	0	0	16.41524	12.95253	0	12.58473	0	0	11.16352	0	0	0	15.61284	11.79765	17.83321	18.70346	15.39162	13.94398	0	12.98486	0	0	7.017138	13.33831	0	11.24549	15.39577	0	14.43021	0	11.75026	0	0	0	0	0	14.29165
A0A669BLE6	A0A669BLE6_ORENI	rbm46		Probable RNA-binding protein 46 (RNA-binding motif protein 46)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]	RNA binding [GO:0003723]	EMALLSLIDKTGYNMVQENGQR	4.599999905	2525.597215	0	10.83416	12.3819	0	0	0	0	0	0	11.77941	11.6036	13.44977	19.28999	0	16.11303	9.900794	12.3909	19.79962	0	0	0	17.04928	10.11306	0	0	12.34487	0	0	0	0	0	15.47514	15.38168	0	12.26156	0	11.0564	13.50443	12.42765	13.14452	12.78786	17.5156	10.95543	14.46176	0	0	10.88871	14.43232	13.32367	13.47075	0	11.72923	0	0
A0A669BF98	A0A669BF98_ORENI			Procollagen C-endopeptidase enhancer b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]	extracellular space [GO:0005615]; collagen binding [GO:0005518]; heparin binding [GO:0008201]; peptidase activator activity [GO:0016504]	collagen binding [GO:0005518]; heparin binding [GO:0008201]; peptidase activator activity [GO:0016504]	AGVKPTVKPK	8.930000305	1024.478152	0	13.28241	12.97029	11.47523	14.72256	14.99532	15.20638	0	0	0	0	12.27691	0	12.46037	0	0	0	0	0	0	14.30569	12.91768	0	0	0	0	0	13.34923	0	0	0	18.83861	0	11.66992	13.78277	11.13024	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.18117	0	14.91423
A0A669D8L1	A0A669D8L1_ORENI			"Procollagen, type IX, alpha 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GGPGAK	5.869999886	487.0601911	14.99614	14.1928	14.62015	14.63483	15.26602	16.08736	14.41488	14.5988	14.68037	0	15.07615	14.95215	15.40401	0	13.23508	15.18332	16.09442	14.35648	15.34158	14.8176	15.0211	16.00011	15.95822	14.97831	14.22024	15.52856	15.00487	16.31668	14.86675	14.72561	18.36442	18.48075	0	0	0	14.69407	14.29735	15.32169	15.07987	13.78285	14.95128	14.39898	15.17891	14.56887	15.33267	15.08832	15.03534	15.31194	14.51507	14.38911	14.73191	13.95666	15.04934	15.25792
I3KNF7	I3KNF7_ORENI	LOC100699058		Procollagen-lysine 5-dioxygenase (EC 1.14.11.4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]	endoplasmic reticulum membrane [GO:0005789]; iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; procollagen-lysine 5-dioxygenase activity [GO:0008475]	iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; procollagen-lysine 5-dioxygenase activity [GO:0008475]	GGDYMSAPGGGQKVR	5.889999866	1496.039907	0	13.89286	12.65854	0	0	0	11.98175	0	0	16.98263	12.52925	13.94401	9.164098	14.59495	13.36789	0	11.52238	0	11.8101	0	14.11895	10.66331	0	14.79642	0	14.05617	8.258114	13.77059	0	8.51883	0	15.94454	0	15.02605	0	13.7442	0	10.55872	0	0	11.75388	14.76891	0	0	0	8.850564	13.38227	12.96236	0	0	0	12.83323	0	0
A0A669EMC5	A0A669EMC5_ORENI	p3h2	collagen metabolic process [GO:0032963]	Procollagen-proline 3-dioxygenase (EC 1.14.11.7)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum [GO:0005783]	endoplasmic reticulum [GO:0005783]; iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; procollagen-proline 3-dioxygenase activity [GO:0019797]; collagen metabolic process [GO:0032963]	iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; procollagen-proline 3-dioxygenase activity [GO:0019797]	TLQHGFEGR	1.919999957	1043.977093	14.753	12.22733	16.3385	12.29563	14.09708	0	0	0	13.37383	14.63948	11.78585	0	13.68013	0	0	13.89758	13.80437	0	11.34207	0	0	11.96454	0	0	0	0	17.54271	0	0	0	0	0	13.61939	15.10649	0	14.09955	0	14.18672	0	0	14.45876	0	0	0	0	13.40588	0	12.70566	15.10542	0	14.36033	13.06582	0	11.66772
A0A669BML3	A0A669BML3_ORENI	p4ha1		Procollagen-proline 4-dioxygenase (EC 1.14.11.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum lumen [GO:0005788]	"endoplasmic reticulum lumen [GO:0005788]; iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]; procollagen-proline 4-dioxygenase activity [GO:0004656]"	"iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen [GO:0016702]; procollagen-proline 4-dioxygenase activity [GO:0004656]"	LIELGEETAEK	13.01000023	1229.728493	11.24632	0	6.875657	12.16618	0	12.74966	0	0	14.97399	0	0	0	0	0	15.78065	11.29038	13.00318	0	0	12.67292	0	17.05645	12.7803	19.17266	0	0	0	0	0	0	0	0	12.654	0	12.36847	11.76641	0	0	0	0	15.35785	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DI28	A0A669DI28_ORENI	LOC100700117	actin cytoskeleton organization [GO:0030036]; regulation of actin filament polymerization [GO:0030833]	Profilin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]	cytoskeleton [GO:0005856]; actin binding [GO:0003779]; actin cytoskeleton organization [GO:0030036]; regulation of actin filament polymerization [GO:0030833]	actin binding [GO:0003779]	TAIVIAKGTK	2.980000019	1000.916583	13.95932	0	14.33043	11.71781	12.88507	12.40616	14.11074	14.56726	0	13.68302	13.67178	14.67566	13.19862	12.1482	14.03732	0	8.80268	10.46542	14.61274	17.42653	16.90584	14.06296	0	13.21333	14.43024	8.067504	9.621976	11.58616	12.4494	12.51053	14.27244	0	0	11.95636	13.18157	13.64565	12.85164	11.86761	12.71492	13.59897	13.45078	12.54084	11.05226	11.23945	10.49023	15.69717	0	10.72554	13.77515	11.03933	0	13.19227	12.39506	14.00614
A0A669BGD8	A0A669BGD8_ORENI			Progestin and adipoQ receptor family member VI	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SPNQPHSSTCGCKEHK	1.289999962	1853.348453	0	0	0	0	0	0	0	0	0	0	0	0	0	17.46446	0	21.34135	0	0	16.62881	14.98719	0	0	15.67652	0	0	0	17.08215	14.20974	0	18.77537	15.00043	0	18.694	0	0	0	0	0	0	0	0	16.21419	0	15.66637	16.66641	16.60585	0	0	16.58246	19.47449	0	15.82218	16.02698	0
A0A669BEC3	A0A669BEC3_ORENI		mRNA processing [GO:0006397]; rRNA processing [GO:0006364]	Programmed cell death 11	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]; nucleic acid binding [GO:0003676]; mRNA processing [GO:0006397]; rRNA processing [GO:0006364]	nucleic acid binding [GO:0003676]	MVLSFK	1.870000005	724.3542185	13.32816	13.83367	0	13.80241	15.36429	14.69734	13.41873	0	0	12.88717	12.43242	14.86117	10.81111	14.11761	15.8764	12.88269	14.7605	15.19609	15.53176	13.11348	14.30223	0	16.51323	14.68487	0	17.12379	15.41968	16.35438	0	0	0	0	0	14.14482	0	13.99667	13.15471	0	0	14.36903	15.92269	15.94224	16.25406	15.44695	16.1925	16.50404	15.50733	15.74093	14.62913	14.82929	15.72362	14.59584	15.95288	0
I3JLJ6	I3JLJ6_ORENI	LOC100690566		Prohibitin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial inner membrane [GO:0005743]; plasma membrane [GO:0005886]	mitochondrial inner membrane [GO:0005743]; plasma membrane [GO:0005886]		MSSSGGR	13.97999954	696.7212841	15.99164	15.66627	15.45082	16.63998	0	0	14.682	16.05276	13.31807	15.86012	15.76661	12.45798	16.41696	16.18728	0	14.64037	16.41841	15.99728	16.18086	16.207	0	0	0	17.60316	15.0609	15.27704	14.13262	0	13.51442	17.72577	0	18.76307	16.6201	0	14.79932	16.07263	0	16.49603	16.36455	15.33051	15.74968	15.86042	15.85725	16.39612	16.5758	15.92976	0	15.98453	15.95766	15.1647	0	14.51645	14.73079	14.17908
I3JLI0	I3JLI0_ORENI	PRLR prlr		Prolactin receptor (PRL-R)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; metal ion binding [GO:0046872]; prolactin receptor activity [GO:0004925]	metal ion binding [GO:0046872]; prolactin receptor activity [GO:0004925]	QLLKSGK	7.619999886	774.0067689	17.56244	0	0	17.21589	0	16.471	0	0	16.65014	14.3464	0	15.40294	15.20725	15.90952	0	0	0	16.42997	0	0	0	0	0	0	0	0	0	0	0	0	0	16.24098	0	0	15.24907	0	16.19405	0	13.18751	0	0	0	13.82798	0	0	0	15.53667	0	14.62718	0	16.94013	0	0	0
A0A669EG94	A0A669EG94_ORENI	pcna	DNA replication [GO:0006260]; regulation of DNA replication [GO:0006275]	Proliferating cell nuclear antigen	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA polymerase processivity factor activity [GO:0030337]; DNA replication [GO:0006260]; regulation of DNA replication [GO:0006275]	DNA binding [GO:0003677]; DNA polymerase processivity factor activity [GO:0030337]	IADMGHIK	12.05000019	884.3837003	16.54333	0	15.97491	0	0	0	0	15.52732	0	0	0	0	17.12565	17.87558	0	16.23569	0	15.78834	0	15.85048	0	16.75721	17.3981	15.7581	13.19137	16.11852	16.27366	17.91023	15.42803	17.05906	17.2498	0	17.76219	0	0	0	14.35517	16.36934	0	0	15.63332	16.0044	17.30231	16.96002	14.89818	16.89238	19.18698	19.63379	15.51624	0	16.79227	16.19408	0	17.23207
I3JWX2	I3JWX2_ORENI	LOC100697817	proline catabolic process [GO:0006562]	Proline dehydrogenase (EC 1.5.5.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		proline dehydrogenase activity [GO:0004657]; proline catabolic process [GO:0006562]	proline dehydrogenase activity [GO:0004657]	CIKASGGSSMDGFSAIK	7.03000021	1730.697668	0	12.36945	0	14.32865	0	13.16906	14.55519	13.31981	0	12.86036	0	14.09919	0	0	13.63096	13.06417	0	12.87172	0	13.11499	11.75581	14.3807	14.14872	0	0	0	0	0	0	0	16.66946	17.93178	0	0	0	0	0	0	0	0	14.61553	0	0	0	0	0	0	0	13.67839	0	14.53708	0	0	0
A0A669D166	A0A669D166_ORENI			Proline rich 12a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TATTTTTTTTK	4.909999847	1127.289471	12.10438	12.79127	11.82986	12.00173	14.32245	15.37357	14.06455	14.26792	13.54092	14.0527	19.05504	12.42701	13.86558	12.86901	14.02365	18.75842	0	12.95447	0	0	0	0	0	0	0	0	15.515	0	18.09097	15.48759	0	15.00062	13.98978	18.03747	13.92835	0	11.53387	0	14.61536	13.54918	0	0	0	12.63891	0	0	14.13332	9.100695	20.03518	0	19.3976	0	0	0
I3KCJ9	I3KCJ9_ORENI	PRRC2B		Proline rich coiled-coil 2B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GPEDGMKVSHPL	2.74000001	1282.27023	11.98574	9.775635	12.49063	11.71078	13.26693	11.06698	7.928531	13.84301	12.61159	7.416631	10.46212	14.63093	10.29154	0	0	7.434908	10.69305	9.785359	13.96714	13.10393	12.61476	14.17677	0	12.81121	0	14.22452	17.99395	0	0	0	0	0	0	0	0	15.07978	0	13.49241	0	0	12.86762	0	16.87805	0	0	0	0	0	0	0	0	0	0	13.8528
A0A669D4K4	A0A669D4K4_ORENI	PRRT1		Proline rich transmembrane protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		AVQVRTAIAR	2.140000105	1083.635141	0	11.68959	11.94757	12.85534	10.09272	13.961	0	13.65247	13.79604	0	14.95134	13.11345	11.1193	0	15.72331	0	10.58313	12.36001	0	14.16829	0	12.06752	15.72779	10.45396	12.62028	14.79558	12.49196	0	0	14.59715	18.40703	17.13937	18.73331	0	13.72907	0	0	13.5034	14.0173	0	15.19076	0	11.07472	11.40976	14.44046	0	13.01476	12.11015	12.15209	11.99105	0	0	15.24601	14.14306
I3JEA2	I3JEA2_ORENI			Prolylcarboxypeptidase (angiotensinase C)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		serine-type peptidase activity [GO:0008236]	serine-type peptidase activity [GO:0008236]	MLGGLPYSTEPPVSYK	3.430000067	1755.889661	0	0	12.29372	13.73488	14.31038	0	0	13.50711	0	15.38886	9.062839	11.84231	14.19598	0	15.29683	13.70543	12.66673	16.09286	14.31107	0	0	0	0	0	0	13.41958	0	16.05917	0	0	0	0	15.78481	16.10422	15.11069	0	0	0	0	0	15.12631	17.03887	16.33988	18.37844	0	15.04867	10.2883	12.03246	0	14.25516	12.69709	0	0	0
A0A669ERT5	A0A669ERT5_ORENI			Propionyl-CoA carboxylase subunit beta	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ligase activity [GO:0016874]	ligase activity [GO:0016874]	GAVQIIFR	19.11000061	902.7108311	16.66082	16.7609	17.11375	13.3866	16.36781	15.40503	0	16.67818	16.59086	16.10618	14.31016	0	13.55728	15.81855	16.43235	0	15.43763	13.98687	15.01738	15.87423	0	14.72417	16.14851	0	0	16.1185	16.62184	15.26011	0	0	0	0	15.79072	13.40266	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.01404	17.42687	0	0	0
I3J3V1	I3J3V1_ORENI	pcsk9	apoptotic process [GO:0006915]; central nervous system development [GO:0007417]; cholesterol metabolic process [GO:0008203]; neurogenesis [GO:0022008]	Proprotein convertase 9 (Proprotein convertase subtilisin/kexin type 9) (Subtilisin/kexin-like protease PC9)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell surface [GO:0009986]; endoplasmic reticulum [GO:0005783]; endosome [GO:0005768]; Golgi apparatus [GO:0005794]; lysosome [GO:0005764]	cell surface [GO:0009986]; endoplasmic reticulum [GO:0005783]; endosome [GO:0005768]; Golgi apparatus [GO:0005794]; lysosome [GO:0005764]; serine-type endopeptidase activity [GO:0004252]; apoptotic process [GO:0006915]; central nervous system development [GO:0007417]; cholesterol metabolic process [GO:0008203]; neurogenesis [GO:0022008]	serine-type endopeptidase activity [GO:0004252]	MECVAHNGPAGK	1.730000019	1285.664104	0	14.64351	0	13.92746	12.86576	15.95395	14.30976	14.63408	15.00049	16.46503	13.79817	14.48748	13.10967	17.12571	16.4372	13.80719	13.44664	14.15945	16.63018	0	0	0	0	15.39571	0	0	13.13707	15.44006	0	0	0	0	0	16.17307	0	14.25137	14.7815	13.46492	13.79485	0	16.36075	15.37675	16.89794	13.33467	15.97048	13.82636	0	16.65809	14.81639	15.16622	15.47758	0	12.44067	12.60985
I3K7A5	I3K7A5_ORENI	prox1	"regulation of transcription, DNA-templated [GO:0006355]"	Prospero domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	QLAETLKQELNSAMTQVVDTVVK	2.589999914	2545.864662	0	15.2866	15.54977	14.09564	13.93685	14.80236	17.4038	15.88402	17.08029	16.19314	13.35941	15.07742	14.72913	0	0	15.22133	0	14.12696	15.69919	15.78475	14.57396	0	14.15791	0	0	15.85281	0	0	0	0	15.26569	0	16.39447	0	13.82608	15.20139	0	16.3828	0	0	14.20769	0	0	15.33187	15.54219	0	0	16.41549	19.97646	19.98998	14.08219	18.05884	0	0
I3K3K5	I3K3K5_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	Prospero homeobox 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	FARQAINEGVTAAEELTVGR	10.51000023	2132.824055	0	0	13.5031	0	13.58807	12.64678	0	17.01426	12.25504	10.03735	11.35298	14.60546	14.29721	12.58576	14.93146	0	0	0	10.24329	13.43217	15.76029	10.44136	19.02787	13.75493	15.42787	6.717783	0	10.14143	0	13.31786	0	13.51179	14.9482	12.5735	0	0	13.83015	13.54842	0	15.05548	11.63973	0	11.87466	0	14.69318	6.861911	13.35313	8.256888	0	11.16527	12.30574	11.03897	9.661294	13.11093
I3J8N0	I3J8N0_ORENI	LOC100703351	prostaglandin biosynthetic process [GO:0001516]	Prostacyclin synthase (EC 4.2.1.152) (EC 5.3.99.4) (Prostaglandin I2 synthase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]	"endoplasmic reticulum membrane [GO:0005789]; heme binding [GO:0020037]; hydroperoxy icosatetraenoate dehydratase activity [GO:0106256]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]; prostaglandin-I synthase activity [GO:0008116]; prostaglandin biosynthetic process [GO:0001516]"	"heme binding [GO:0020037]; hydroperoxy icosatetraenoate dehydratase activity [GO:0106256]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]; prostaglandin-I synthase activity [GO:0008116]"	EVVQDKILDMANGQR	1.00999999	1715.112594	0	0	0	0	16.22471	16.75723	16.63135	0	15.47121	16.91387	0	16.5266	17.27488	0	15.52796	17.52856	13.26593	0	15.50197	15.30115	0	0	0	0	0	13.48559	0	0	0	0	0	16.39832	16.55449	16.0004	16.37163	14.90067	14.02988	0	0	15.86665	16.09622	0	0	10.59487	15.44803	0	0	16.76123	0	16.355	16.05456	0	17.22851	0
A0A669DF82	A0A669DF82_ORENI	LOC100705061		Prostaglandin E2 receptor EP4 subtype (Prostanoid EP4 receptor)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; prostaglandin E receptor activity [GO:0004957]	prostaglandin E receptor activity [GO:0004957]	LSASQPSSAR	9.229999542	1003.932076	15.41378	0	0	15.37226	15.66499	0	0	15.16803	0	0	0	0	15.61236	14.82063	13.15309	0	15.11302	15.75745	14.65	0	13.75035	8.483879	15.41537	14.45818	0	0	14.60396	15.06254	0	0	0	0	16.22544	16.38081	0	0	0	0	15.30845	0	0	0	0	15.6936	15.77547	16.87222	0	14.42487	16.64396	12.83263	10.58353	0	15.65152	0
A0A669DBD9	A0A669DBD9_ORENI		ubiquitin-dependent ERAD pathway [GO:0030433]	"Proteasome 26S subunit, ATPase 6"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"cytoplasm [GO:0005737]; nucleus [GO:0005634]; proteasome regulatory particle, base subcomplex [GO:0008540]"	"cytoplasm [GO:0005737]; nucleus [GO:0005634]; proteasome regulatory particle, base subcomplex [GO:0008540]; ATP binding [GO:0005524]; proteasome-activating ATPase activity [GO:0036402]; ubiquitin-dependent ERAD pathway [GO:0030433]"	ATP binding [GO:0005524]; proteasome-activating ATPase activity [GO:0036402]	ALQDYR	4.599999905	765.0035238	13.28761	14.40327	0	0	0	0	0	17.29259	13.5385	0	0	0	14.16871	0	0	0	0	0	0	0	0	0	0	0	14.99613	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18.8353	0	0	0	0
A0A669BNK5	A0A669BNK5_ORENI		proteolysis [GO:0006508]	"Proteasome 26S subunit, non-ATPase 8"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	proteasome regulatory particle [GO:0005838]	proteasome regulatory particle [GO:0005838]; proteolysis [GO:0006508]		YMAQLKCYYFDYK	7.78000021	1792.445571	14.00202	0	11.35126	14.19329	0	0	0	0	0	13.77482	13.87306	9.341539	0	0	14.6692	0	14.55344	13.68238	0	0	11.16599	16.05807	0	0	0	0	12.27885	0	0	15.47225	0	15.25725	0	0	12.98985	0	0	0	0	0	0	0	0	7.227635	14.95486	0	0	0	14.5815	0	0	0	13.47618	14.83474
A0A669DIC0	A0A669DIC0_ORENI	psmb7	proteolysis involved in cellular protein catabolic process [GO:0051603]	Proteasome subunit beta	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]; proteasome core complex [GO:0005839]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; proteasome core complex [GO:0005839]; threonine-type endopeptidase activity [GO:0004298]; proteolysis involved in cellular protein catabolic process [GO:0051603]	threonine-type endopeptidase activity [GO:0004298]	ATEGMIVADKNCSK	4.260000229	1539.231971	13.20185	10.86197	13.72894	14.08876	15.78928	15.24246	16.95735	16.49656	0	0	14.00188	13.82309	12.24495	14.5977	0	16.41126	15.17614	14.1672	0	0	16.6718	0	0	0	0	0	15.77023	0	0	0	0	0	0	16.38647	0	0	0	0	16.38239	0	13.6988	0	0	0	16.18436	15.88325	0	0	16.08542	15.02561	0	0	0	0
A0A669B3K4	A0A669B3K4_ORENI	wdr83os		Protein Asterix	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MLSNNMADPR	9.229999542	1179.524988	10.41939	11.61571	11.91863	12.45102	6.997115	11.22266	16.87328	13.85766	11.78944	11.73771	17.36161	10.81803	13.91455	9.52702	15.08513	0	7.503412	13.96591	13.41439	13.79968	12.29122	14.58981	14.63702	13.66498	14.67649	15.28844	9.75943	10.62082	13.51607	13.20418	12.54398	14.67702	0	0	0	13.92831	13.79161	9.69173	12.56754	10.87478	0	14.42909	11.46337	0	13.45311	13.16794	0	0	0	0	0	10.26092	0	0
A0A669CG63	A0A669CG63_ORENI	mis12	cell division [GO:0051301]; mitotic cell cycle [GO:0000278]	Protein MIS12 homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	condensed chromosome kinetochore [GO:0000777]; nucleus [GO:0005634]	condensed chromosome kinetochore [GO:0000777]; nucleus [GO:0005634]; cell division [GO:0051301]; mitotic cell cycle [GO:0000278]		ETREAEAMDIHGER	11.27999973	1660.204302	9.987056	0	0	13.38175	12.43238	13.32831	15.40273	15.60638	0	0	16.64812	14.99699	14.58179	16.45366	10.04007	15.68398	14.27195	0	14.13529	11.74981	9.367746	13.62726	0	13.57666	0	19.44457	11.08688	12.60747	0	15.72068	16.26156	17.10538	14.8535	15.24	16.01744	14.65087	15.78404	0	0	0	13.36209	9.811751	15.90368	15.0336	13.7715	15.45311	14.14714	14.53741	14.41072	16.12595	14.90286	14.8679	0	11.63463
A0A669EUK3	A0A669EUK3_ORENI		protein transport [GO:0015031]	Protein MON2 homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein transport [GO:0015031]		QHSTKVFR	5.539999962	1001.643438	15.86462	0	10.91904	0	14.426	0	0	15.65126	15.53004	0	15.33091	14.9468	0	15.43266	14.04749	17.15599	0	14.12784	0	0	14.57019	13.99595	15.88756	14.95563	0	0	0	0	0	18.54345	15.05176	17.30247	16.39875	15.16949	16.19347	13.481	10.88881	0	0	12.91338	16.62914	14.47361	0	0	0	15.99221	18.02271	13.10731	14.56698	15.67213	15.77398	15.8332	16.07735	13.33056
I3K009	I3K009_ORENI		tRNA wobble uridine modification [GO:0002098]	"Protein MTO1 homolog, mitochondrial"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		flavin adenine dinucleotide binding [GO:0050660]; tRNA wobble uridine modification [GO:0002098]	flavin adenine dinucleotide binding [GO:0050660]	EIPPMRR	1.039999962	896.6589089	0	15.04863	0	9.218864	11.35448	15.94808	10.55631	0	14.46691	15.1358	0	15.56832	12.93369	16.80197	14.15405	16.60707	12.38485	16.06393	13.58518	0	0	14.52299	13.83925	17.85996	17.11077	0	0	0	0	0	14.67558	16.66023	18.72467	0	14.47457	16.91886	0	0	0	13.95689	0	14.33534	15.05247	0	0	0	12.31659	14.61983	0	16.63331	0	0	0	0
A0A669D152	A0A669D152_ORENI	LOC102076914		Protein NDNF	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LNGTSMAYK	11.46000004	985.0389504	14.44291	0	10.19912	13.39122	15.96509	0	11.41602	0	12.19058	0	14.94629	13.13925	12.19295	13.39839	18.9278	13.64575	13.84943	0	15.1322	0	0	0	12.69768	13.74595	0	12.40113	18.2222	7.975154	12.94713	13.51718	14.92344	17.00388	0	15.14271	13.63582	9.156308	12.69806	11.81417	12.44641	13.67859	12.94908	12.47868	8.435874	0	14.00994	13.30433	11.95516	7.78585	18.22165	19.32543	18.00659	0	18.96093	0
I3JM10	I3JM10_ORENI	pomgnt1	protein glycosylation [GO:0006486]	"Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; acetylglucosaminyltransferase activity [GO:0008375]; metal ion binding [GO:0046872]; protein glycosylation [GO:0006486]	acetylglucosaminyltransferase activity [GO:0008375]; metal ion binding [GO:0046872]	ASLTATFNLHPTIVR	1.870000005	1640.572042	11.67165	0	15.16338	7.50624	0	0	0	13.33978	0	0	15.86138	13.93427	0	16.42769	0	0	12.92457	0	13.31023	0	0	0	14.41191	12.39319	0	15.28172	10.36068	0	12.69246	12.92362	13.29508	13.4222	16.02339	13.4197	12.53967	14.7788	0	14.3509	15.02529	0	14.16887	0	0	13.84149	14.96367	15.38217	14.5737	14.12338	15.94037	0	15.99066	0	14.67247	16.29978
I3KL83	I3KL83_ORENI		"nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]"	Protein SMG8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]"		RPSLVDR	3.480000019	841.3283941	0	13.2838	0	13.61437	16.23886	14.33175	0	16.17975	16.1007	0	16.00071	16.22353	15.90964	0	0	0	0	0	17.84185	0	0	17.19152	0	0	0	16.35973	0	0	0	15.82192	0	0	16.79079	0	0	0	0	0	17.25695	15.5706	15.9831	0	0	0	0	17.64535	0	0	0	0	0	0	0	0
I3JWP1	I3JWP1_ORENI		"nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]"	Protein SMG9	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]"		NGMGYSPPS	4.679999828	907.3398026	0	0	15.50004	16.03092	14.03872	12.7432	0	0	17.40712	13.41058	17.27801	15.63856	15.45527	12.79329	0	14.63746	15.65793	0	0	15.65108	0	0	15.9613	0	0	0	0	0	16.74049	0	15.92184	16.75834	17.53871	14.91727	14.3632	0	0	0	15.28184	15.65861	0	0	0	0	0	0	0	0	16.22742	0	14.08531	0	0	0
I3JQH0	I3JQH0_ORENI	wnt7b	multicellular organism development [GO:0007275]; Wnt signaling pathway [GO:0016055]	Protein Wnt	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; signaling receptor binding [GO:0005102]; multicellular organism development [GO:0007275]; Wnt signaling pathway [GO:0016055]	signaling receptor binding [GO:0005102]	FMDAREIK	3.059999943	1025.912196	0	17.35993	0	12.67172	12.98925	0	13.86235	17.76216	13.97835	0	0	15.70629	0	12.27812	14.27604	5.917349	14.8922	0	0	0	13.83382	0	0	17.64304	0	16.03007	0	16.46547	16.67492	0	0	0	0	0	0	0	0	0	0	13.77311	8.468632	0	13.77105	0	0	0	0	0	0	0	0	0	0	0
I3KQG2	I3KQG2_ORENI	yipf1	vesicle-mediated transport [GO:0016192]	Protein YIPF	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome membrane [GO:0031902]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; late endosome membrane [GO:0031902]; small GTPase binding [GO:0031267]; vesicle-mediated transport [GO:0016192]	small GTPase binding [GO:0031267]	IIGSMMPWPR	1.50999999	1202.925147	14.56737	12.1902	0	12.1119	0	0	14.46005	0	12.81019	12.03184	0	0	0	0	0	0	17.5848	0	0	0	0	0	0	13.90743	14.07574	10.9862	14.45408	0	14.4388	0	0	15.36868	14.29881	0	14.6441	0	12.40583	13.70773	11.25269	0	11.46423	11.91812	0	0	10.04415	13.4759	13.17122	12.58527	0	17.26412	0	0	13.23336	14.81058
I3JJE1	I3JJE1_ORENI		cell differentiation [GO:0030154]	Protein YIPF3 (YIP1 family member 3)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; cell differentiation [GO:0030154]		VARDVPEVTLNATAR	5.71999979	1611.981942	12.88204	13.08177	13.01029	12.49054	14.823	13.47586	6.944337	13.60397	12.82398	15.03044	0	13.09504	0	0	10.44096	11.29991	0	13.18607	12.65798	0	13.57244	12.01073	10.62886	14.65868	0	13.76366	13.79679	9.308499	0	14.33449	18.60467	0	14.47559	0	0	9.397089	11.63768	13.14862	13.84745	9.281602	11.01488	13.80585	13.87455	11.30364	13.03232	13.86062	0	13.83085	8.249801	13.40788	0	0	0	0
A0A669F5K4	A0A669F5K4_ORENI	prmt5	rhythmic process [GO:0048511]	Protein arginine N-methyltransferase 5 (EC 2.1.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]; nucleus [GO:0005634]	cytosol [GO:0005829]; nucleus [GO:0005634]; histone-arginine N-methyltransferase activity [GO:0008469]; protein-arginine omega-N symmetric methyltransferase activity [GO:0035243]; rhythmic process [GO:0048511]	histone-arginine N-methyltransferase activity [GO:0008469]; protein-arginine omega-N symmetric methyltransferase activity [GO:0035243]	SYTIGL	10.89000034	652.3344912	19.34467	18.2708	19.29601	19.38425	20.22554	19.50362	19.58101	19.9117	19.40884	20.18602	19.41542	19.3722	19.45121	19.56528	20.15224	20.34986	18.91561	20.10662	19.41281	20.1286	16.66825	19.12306	19.25904	20.55755	18.99314	19.64293	20.64392	20.14557	19.33943	19.68177	19.98133	20.36551	20.20886	19.15022	20.07377	19.68024	19.16473	19.33743	19.62288	19.66423	18.69841	19.06808	20.19543	19.67213	18.77394	19.72663	20.39999	19.85085	18.87246	17.816	17.9619	17.38565	19.27208	16.85378
I3J8L1	I3J8L1_ORENI			Protein arginine methyltransferase 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		identical protein binding [GO:0042802]; protein-arginine N-methyltransferase activity [GO:0016274]	identical protein binding [GO:0042802]; protein-arginine N-methyltransferase activity [GO:0016274]	TGGGGISNNR	5.460000038	931.5448526	13.72803	12.24799	15.57835	15.12592	16.39727	12.52921	13.8512	18.21413	12.60055	16.47753	10.4096	14.78618	16.43168	14.22832	15.3782	17.46483	15.41555	16.17779	18.09028	15.42391	15.34306	15.6332	15.41902	14.96018	0	0	0	0	16.00358	15.67686	18.75059	0	0	15.66496	0	0	14.56733	0	16.54587	14.94987	16.13443	0	15.45267	13.06519	0	0	16.00279	15.17443	17.02141	18.5062	17.0235	14.93889	17.51153	15.23306
I3JUP9	I3JUP9_ORENI			Protein arginine methyltransferase 9	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein-arginine N-methyltransferase activity [GO:0016274]	protein-arginine N-methyltransferase activity [GO:0016274]	MPNTSTR	7.769999981	822.48588	8.656338	13.48658	14.57744	14.63798	14.71123	14.26765	13.91109	0	0	14.21852	14.80485	15.45135	0	0	13.14946	0	0	15.32039	14.37869	15.93443	14.74304	0	0	13.4627	0	12.56049	0	0	0	14.54436	16.12428	0	15.24259	15.02668	14.41383	13.31062	15.46204	15.25814	0	12.60262	0	15.29675	14.22541	14.65396	0	13.67227	13.81421	0	14.99109	11.2329	14.63922	0	0	15.55963
I3KAI2	I3KAI2_ORENI			Protein disulfide-isomerase A4 (EC 5.3.4.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum lumen [GO:0005788]	endoplasmic reticulum lumen [GO:0005788]; protein disulfide isomerase activity [GO:0003756]	protein disulfide isomerase activity [GO:0003756]	GAVLSVDTMKK	8.279999733	1164.676325	12.78483	10.29374	11.4049	13.59123	12.65779	11.86919	12.98459	17.66838	12.88959	14.8966	12.40487	13.14186	0	12.54058	11.5243	0	13.8246	10.69073	13.05507	15.1318	0	0	0	0	0	15.00405	15.56602	14.98618	15.23413	14.17981	0	0	0	0	12.32201	18.04665	15.62306	12.22514	0	0	13.07585	0	0	0	0	0	0	14.56432	0	15.42556	12.62112	0	0	14.25462
I3KBH4	I3KBH4_ORENI	pdia6		Protein disulfide-isomerase A6 (EC 5.3.4.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum lumen [GO:0005788]	endoplasmic reticulum lumen [GO:0005788]; protein disulfide isomerase activity [GO:0003756]	protein disulfide isomerase activity [GO:0003756]	IFGANK	4.789999962	650.3773806	0	15.42186	15.61072	14.75241	14.62223	16.13114	16.93935	16.83143	0	15.42118	15.05712	13.65396	0	15.42019	17.96928	0	16.92514	15.96145	16.23843	15.9292	13.00696	16.31746	13.36937	16.89521	15.86167	17.11163	16.37674	17.53124	14.07571	15.73011	0	12.68307	15.60453	0	0	0	0	0	0	0	0	0	16.06342	0	17.0533	0	0	0	0	0	0	0	0	19.2842
A0A669F3S3	A0A669F3S3_ORENI	LOC100709246	protein farnesylation [GO:0018343]	Protein farnesyltransferase subunit beta (FTase-beta) (EC 2.5.1.58)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	protein farnesyltransferase complex [GO:0005965]	protein farnesyltransferase complex [GO:0005965]; protein farnesyltransferase activity [GO:0004660]; zinc ion binding [GO:0008270]; protein farnesylation [GO:0018343]	protein farnesyltransferase activity [GO:0004660]; zinc ion binding [GO:0008270]	VAQALQHFLRMPVPEFCK	10.78999996	2188.194553	12.86538	0	14.70316	14.49652	0	0	14.23548	0	19.72075	0	17.86444	12.63108	0	0	18.22348	13.18127	0	4.049466	18.0594	11.3989	16.95131	12.56739	0	11.7297	14.67798	15.49698	12.67926	18.3547	0	19.00533	14.09204	19.48301	17.39447	19.95586	0	18.84543	0	12.49702	14.1117	18.67596	0	12.85474	0	0	16.0912	0	12.55224	0	0	14.74262	11.42024	19.77188	11.21273	0
A0A669E920	A0A669E920_ORENI			"Protein inhibitor of activated STAT, 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		SUMO transferase activity [GO:0019789]; zinc ion binding [GO:0008270]	SUMO transferase activity [GO:0019789]; zinc ion binding [GO:0008270]	IYSMSVYLVR	3.950000048	1247.529254	0	9.111223	9.633455	0	0	0	13.87281	0	0	14.15919	0	0	0	12.76832	0	11.89676	0	15.24241	13.5883	12.09214	0	0	18.43644	0	13.8609	0	0	0	0	0	18.25352	0	17.18383	0	14.16778	13.22487	11.59549	0	0	12.28018	14.96446	0	0	6.761343	0	0	0	8.423194	14.48207	13.97107	0	0	0	0
I3KHT4	I3KHT4_ORENI		otic vesicle development [GO:0071599]; otolith formation [GO:0032475]	Protein kibra	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		otic vesicle development [GO:0071599]; otolith formation [GO:0032475]		LATMLHTQLK	2.450000048	1169.823086	11.99181	13.07482	12.42965	11.70794	0	18.04757	17.48544	0	13.78196	14.01576	13.90236	15.09753	0	13.0664	0	0	16.5161	18.58404	0	14.85899	13.32302	13.32682	13.05064	10.49882	13.07593	11.26593	13.25133	0	14.26186	13.69337	12.31866	14.20209	14.65024	11.56969	13.20091	0	14.86451	13.705	12.27876	13.96723	0	15.40169	14.2523	13.00117	13.9699	14.83364	13.32613	12.9195	17.03911	13.60809	12.65866	0	14.91601	15.44244
I3JV51	I3JV51_ORENI	PRKAB2	fatty acid biosynthetic process [GO:0006633]; regulation of catalytic activity [GO:0050790]	Protein kinase AMP-activated non-catalytic subunit beta 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		fatty acid biosynthetic process [GO:0006633]; regulation of catalytic activity [GO:0050790]		MGNTSDR	1.450000048	779.6634493	14.05108	17.71513	12.90527	0	0	16.48321	16.12268	14.40141	15.34914	16.33783	16.0886	16.07043	15.56094	14.78602	14.96837	15.87576	15.44747	15.66739	17.10157	12.91284	0	17.44797	16.59137	15.1957	17.09131	0	14.00183	0	0	0	13.83075	15.45666	0	0	0	0	0	0	15.35027	16.29785	0	0	0	16.57374	0	0	14.09985	0	0	16.85189	0	0	14.70288	0
A0A669DPF4	A0A669DPF4_ORENI	LOC100692040	intracellular signal transduction [GO:0035556]	Protein kinase C (EC 2.7.11.13)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; calcium-dependent protein kinase C activity [GO:0004698]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; intracellular signal transduction [GO:0035556]	ATP binding [GO:0005524]; calcium-dependent protein kinase C activity [GO:0004698]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	GHSAPEAKR	18.09000015	951.2442984	0	16.19382	17.53927	14.29474	13.06023	15.77532	14.56177	15.26653	16.0256	15.40113	15.61965	0	15.66115	15.0371	16.31088	15.90754	16.37391	17.88145	18.13795	17.94139	16.89267	18.44804	15.94713	15.88968	0	14.65356	16.15123	15.51514	15.95332	16.97486	16.21861	17.89717	15.64386	0	16.94363	0	15.45049	16.10088	14.76719	0	0	16.27682	0	17.19487	14.83337	0	0	16.21496	16.97169	20.17269	13.94751	16.33521	15.24659	15.7444
A0A669ENP9	A0A669ENP9_ORENI	LOC100691726		Protein kinase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	MSFSLIGK	5.139999866	898.2742618	14.73077	14.09043	11.14674	12.0042	15.39595	14.90427	12.59018	0	14.65848	0	14.61137	16.02563	14.44019	9.220046	0	0	13.77813	0	15.49417	14.48964	14.96297	0	13.94513	12.79173	16.18913	0	13.71844	0	0	0	0	0	0	0	0	15.87683	14.0604	13.83597	12.58451	14.64637	13.46884	13.17899	0	13.94442	14.67097	11.46852	8.454576	0	13.52594	14.72338	15.10009	0	15.31651	13.35556
A0A669DXS2	A0A669DXS2_ORENI		regulation of protein serine/threonine kinase activity [GO:0071900]	"Protein kinase, AMP-activated, gamma 1 non-catalytic subunit"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		adenyl ribonucleotide binding [GO:0032559]; regulation of protein serine/threonine kinase activity [GO:0071900]	adenyl ribonucleotide binding [GO:0032559]	KQCFVGMLTITDFINILHR	4.099999905	2321.390389	12.04117	12.18579	9.666538	0	0	12.32054	0	0	11.43159	15.08493	0	0	0	16.0143	0	0	20.29145	0	19.98532	0	0	10.54056	18.62748	13.93557	0	0	0	0	0	3.719763	0	14.63957	0	10.8505	11.26888	0	0	0	0	14.74277	12.98981	12.99866	14.39339	12.61306	18.09349	11.25021	0	11.10308	14.51898	0	0	0	15.30016	15.78714
A0A669CV89	A0A669CV89_ORENI		regulation of protein serine/threonine kinase activity [GO:0071900]	"Protein kinase, AMP-activated, gamma 2 non-catalytic subunit b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		adenyl ribonucleotide binding [GO:0032559]; regulation of protein serine/threonine kinase activity [GO:0071900]	adenyl ribonucleotide binding [GO:0032559]	DSSTMCK	10.38000011	829.1341127	15.84752	0	16.39256	17.25727	15.27162	14.60815	15.9045	18.55732	17.90627	16.15968	16.85215	17.58368	16.75484	0	15.95665	13.1478	16.51204	16.40693	16.55476	16.60947	16.31221	13.94187	17.23359	15.55233	16.67652	0	17.70191	16.28922	18.07706	13.48351	17.01595	17.53454	17.66698	17.05678	0	17.49783	16.11222	14.8488	16.69804	16.15798	15.62339	16.487	16.64756	0	17.44901	15.53962	0	17.85086	0	17.46535	0	17.2043	16.05385	15.34431
A0A669D3R3	A0A669D3R3_ORENI			"Protein kinase, cAMP-dependent, regulatory, type II, alpha A"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cAMP-dependent protein kinase complex [GO:0005952]; plasma membrane [GO:0005886]	cAMP-dependent protein kinase complex [GO:0005952]; plasma membrane [GO:0005886]; cAMP binding [GO:0030552]; cAMP-dependent protein kinase regulator activity [GO:0008603]	cAMP binding [GO:0030552]; cAMP-dependent protein kinase regulator activity [GO:0008603]	SIEIPVGLTELLQGYTVEVLR	6.159999847	2324.393253	0	0	0	14.89644	0	12.30598	0	10.48402	0	0	11.55976	16.95189	17.3667	10.88012	0	0	0	0	0	12.62102	13.80989	5.634896	11.84763	0	0	0	0	0	0	12.33311	16.24249	9.095947	13.31531	0	0	14.83324	18.19872	0	0	6.764078	13.75016	7.4132	0	0	12.95578	11.16582	0	0	10.82265	14.33308	11.24907	14.14304	0	0
I3K832	I3K832_ORENI	msto1		Protein misato homolog 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial outer membrane [GO:0005741]	mitochondrial outer membrane [GO:0005741]		DDSRGVMR	5.079999924	951.6277533	19.82428	15.8341	16.69788	17.13233	15.56882	15.49149	0	16.39907	17.16741	16.70083	16.11839	0	18.20975	18.0987	0	14.71871	0	18.97821	15.87017	13.7043	0	0	0	16.9986	16.97183	20.16726	19.10585	17.32853	16.18948	18.22959	20.23052	16.37139	16.71128	17.40484	16.04854	19.89437	0	15.56016	15.10171	0	13.58244	18.55592	21.6978	16.00725	0	15.49659	16.60723	0	0	15.80208	18.21242	20.52937	17.37287	17.53797
A0A669DLE5	A0A669DLE5_ORENI	numb	positive regulation of neurogenesis [GO:0050769]	Protein numb homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; positive regulation of neurogenesis [GO:0050769]		MNDLPSTMQR	3.619999886	1209.42431	11.45878	12.7206	0	0	13.15769	0	12.24937	14.34596	0	0	0	15.00419	13.67349	0	14.20308	13.97132	13.73204	12.22457	9.134453	0	11.36746	12.61441	13.25742	14.1752	13.6246	11.76336	0	0	13.70117	12.33666	16.37209	16.67939	15.56654	0	15.28306	12.13901	12.96249	0	0	14.47676	0	9.994716	0	14.6162	14.08138	0	0	0	13.09604	0	12.55069	12.0776	0	15.80389
A0A669BJ88	A0A669BJ88_ORENI	pelo	"nuclear-transcribed mRNA catabolic process, no-go decay [GO:0070966]; nuclear-transcribed mRNA catabolic process, non-stop decay [GO:0070481]; RNA surveillance [GO:0071025]"	Protein pelota homolog (EC 3.1.-.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	"cytoplasm [GO:0005737]; nucleus [GO:0005634]; endonuclease activity [GO:0004519]; metal ion binding [GO:0046872]; nuclear-transcribed mRNA catabolic process, no-go decay [GO:0070966]; nuclear-transcribed mRNA catabolic process, non-stop decay [GO:0070481]; RNA surveillance [GO:0071025]"	endonuclease activity [GO:0004519]; metal ion binding [GO:0046872]	KLLLPSCS	8.130000114	916.5509585	0	16.09908	0	0	0	17.15854	0	0	17.7198	0	0	0	18.41007	0	0	18.81257	0	0	0	0	0	16.61286	0	0	0	0	0	0	0	17.84482	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.66875	0	17.63122	0	0	17.56077	0	0
I3JVZ1	I3JVZ1_ORENI		nervous system development [GO:0007399]	Protein phosphatase 1 regulatory subunit 9A-like B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; nervous system development [GO:0007399]		MMEVGGGGGQVSKPVIAR	7	1804.527047	0	13.60787	0	13.16393	17.00042	14.67913	18.46433	0	0	0	0	13.71926	16.60772	15.23957	15.1674	15.50932	11.51341	0	0	16.79736	15.36157	0	15.49759	16.61598	13.57322	14.58242	0	0	17.31916	15.56433	15.07738	16.46309	15.16385	0	0	15.56993	15.17132	14.52173	0	0	0	13.51521	16.1284	15.91732	16.3727	16.85197	15.54109	15.79023	16.32493	14.61028	15.4773	0	16.95828	0
I3KEP2	I3KEP2_ORENI	LOC100691168	signal transduction [GO:0007165]	Protein phosphatase 1 regulatory subunit	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; phosphatase regulator activity [GO:0019208]; protein kinase binding [GO:0019901]; signal transduction [GO:0007165]	phosphatase regulator activity [GO:0019208]; protein kinase binding [GO:0019901]	EIINNLNNKR	7.599999905	1227.82674	13.65775	13.31177	0	12.3565	15.72234	14.44604	13.94216	0	13.2916	0	15.44021	14.92243	0	0	0	0	14.8673	11.186	0	0	0	15.59416	17.53579	0	5.099793	0	0	0	16.17413	0	18.20445	10.16399	12.89581	12.50587	0	0	9.85607	12.77222	0	0	11.58797	11.49562	10.3092	12.67564	13.40795	13.89872	0	18.05984	0	0	0	0	0	0
I3KGZ6	I3KGZ6_ORENI			"Protein phosphatase 1, regulatory subunit 8b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NMVQTAVIPIK	7.070000172	1229.55961	16.89805	11.83048	12.06119	0	0	13.76075	17.30809	12.37131	13.99066	15.40528	16.09115	14.35832	0	0	0	0	0	15.54729	15.96972	0	14.5436	0	14.99486	14.73372	17.9981	14.30015	15.59663	12.54528	14.83252	15.05299	14.4772	0	17.38405	0	0	15.88398	16.40839	0	16.24088	0	16.89854	0	16.78074	17.54996	17.40419	14.80074	0	17.02014	18.98972	15.44229	18.13928	0	0	16.88174
A0A669BZT4	A0A669BZT4_ORENI			"Protein phosphatase 2, regulatory subunit A, beta a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		YLLMFR	10.39999962	838.2265299	0	0	15.24707	16.07223	0	15.65153	16.94488	14.99852	15.8799	15.69432	0	0	0	0	0	16.52225	14.1467	13.95432	0	0	14.51269	0	9.9946	0	0	0	0	0	0	0	0	13.92433	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.64693	0	0	0	0	0
I3J9K8	I3J9K8_ORENI		protein demethylation [GO:0006482]	Protein phosphatase methylesterase 1 (PME-1) (EC 3.1.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; protein methylesterase activity [GO:0051723]; protein demethylation [GO:0006482]	protein methylesterase activity [GO:0051723]	NPEDLSADTMAK	31.56999969	1291.437141	17.68552	15.76479	15.73589	16.71581	18.36761	15.91961	16.21161	18.3482	18.6255	17.69753	0	17.81299	16.08344	16.4689	0	17.50648	18.25878	0	0	16.15824	15.97127	0	17.3233	17.08984	18.34663	17.48698	0	15.1534	15.885	0	16.61545	15.26163	0	18.64303	15.07259	17.59601	0	0	15.2626	0	16.02052	0	0	0	0	16.6931	16.63545	0	0	17.84197	0	16.07869	18.10139	17.20677
A0A669DY62	A0A669DY62_ORENI	spry1	multicellular organism development [GO:0007275]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; negative regulation of Ras protein signal transduction [GO:0046580]; organ induction [GO:0001759]	Protein sprouty homolog 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; membrane [GO:0016020]	cytoplasm [GO:0005737]; membrane [GO:0016020]; multicellular organism development [GO:0007275]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; negative regulation of Ras protein signal transduction [GO:0046580]; organ induction [GO:0001759]		RPPAPRMVSRPHEK	1.470000029	1673.18233	16.8957	0	0	12.44981	0	0	0	13.74594	11.93453	0	0	14.28502	16.31762	0	0	14.68583	15.68939	11.82587	16.11666	17.69555	16.15408	0	15.46864	18.03775	0	0	15.12224	15.06778	13.93174	0	0	0	0	17.00595	14.14954	0	0	0	13.3443	14.77265	15.08508	0	0	14.56156	15.53845	10.0577	14.9007	0	0	0	0	18.7296	0	0
A0A669EZK8	A0A669EZK8_ORENI		COPII-coated vesicle budding [GO:0090114]; intracellular protein transport [GO:0006886]	Protein transport protein SEC23	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	COPII vesicle coat [GO:0030127]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]	COPII vesicle coat [GO:0030127]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; zinc ion binding [GO:0008270]; COPII-coated vesicle budding [GO:0090114]; intracellular protein transport [GO:0006886]	zinc ion binding [GO:0008270]	IDMNLTDLLGSCSATPGGGALGR	4.840000153	2291.78389	0	9.774015	9.251277	13.43671	14.96176	12.89638	13.42627	12.41304	10.68201	11.14729	12.13015	11.88439	0	0	14.25181	12.90152	14.14449	12.04443	0	10.99246	17.12844	14.03297	13.92264	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DGN6	A0A669DGN6_ORENI			Protein tyrosine phosphatase receptor type Ga	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DMPAVVSAAVK	8.140000343	1102.861689	0	11.19068	13.98266	10.84511	12.96636	0	14.17289	10.98051	13.52525	14.52682	17.33765	14.62343	14.52497	13.00303	16.11272	15.06664	14.3819	17.6281	11.32477	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.19582	0	0	0	0	0	0	0	0	0	0
A0A669F4H5	A0A669F4H5_ORENI	LOC100702271	nervous system development [GO:0007399]	Protein unc-119 homolog A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		lipid binding [GO:0008289]; nervous system development [GO:0007399]	lipid binding [GO:0008289]	MSYSCTSR	6.010000229	1007.743693	0	0	15.41986	14.67959	0	15.24962	15.61743	14.40908	15.81106	15.93695	14.3434	15.19758	15.5449	15.66179	14.62527	0	15.62465	14.93827	0	15.98073	12.83674	14.50316	0	16.51689	14.74217	0	12.04624	0	0	13.79162	19.51306	16.30942	14.01454	0	0	13.88757	14.25759	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669BQP2	A0A669BQP2_ORENI	LOC100702922		Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein-L-isoaspartate (D-aspartate) O-methyltransferase activity [GO:0004719]	protein-L-isoaspartate (D-aspartate) O-methyltransferase activity [GO:0004719]	TMAWMSSGK	1.360000014	1013.352024	12.00411	14.69402	0	14.14994	14.84569	12.57785	12.88254	15.06117	17.14009	14.19417	13.86348	15.79994	14.55196	15.02771	12.71287	17.52922	18.03435	14.9645	15.16814	13.22352	14.85635	14.2536	14.02522	14.5844	13.57155	13.09455	14.82683	14.48633	15.60808	0	15.09142	11.4778	14.20935	15.01945	13.81304	12.66604	13.25461	15.03117	0	13.46803	13.69943	14.43047	12.45409	14.16076	9.892012	0	14.05104	13.37173	13.80927	14.94223	0	0	0	12.10675
I3JYH4	I3JYH4_ORENI	setd3	actin modification [GO:0030047]; peptidyl-histidine methylation [GO:0018021]	Protein-histidine N-methyltransferase (EC 2.1.1.85)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; actin binding [GO:0003779]; protein-histidine N-methyltransferase activity [GO:0018064]; actin modification [GO:0030047]; peptidyl-histidine methylation [GO:0018021]	actin binding [GO:0003779]; protein-histidine N-methyltransferase activity [GO:0018064]	GGKGFS	7.690000057	553.314069	0	0	0	13.37282	13.94253	15.31174	15.08518	0	0	0	11.1355	17.11619	13.8756	0	15.56973	0	0	13.66634	12.01384	16.00916	0	16.17779	15.01785	0	0	13.49037	12.07217	0	13.84332	0	0	0	0	10.80917	0	13.60886	14.00425	0	12.30471	13.20788	0	0	0	17.09208	0	0	0	0	0	0	0	0	0	0
A0A669BZJ1	A0A669BZJ1_ORENI	LOC100701650		Protein-serine/threonine kinase (EC 2.7.11.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial matrix [GO:0005759]	mitochondrial matrix [GO:0005759]; ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	NLPPIK	3.619999886	680.2448966	0	15.13667	0	16.0096	0	15.70104	0	15.31624	0	0	16.02788	0	14.1001	16.97086	0	0	0	0	16.4705	16.45506	15.37239	0	0	0	0	0	17.45389	15.87284	16.24577	16.59905	0	15.67577	16.72074	16.53375	0	16.56359	14.36112	17.15758	0	16.53653	0	15.59956	17.44444	17.14833	0	15.46892	0	0	0	0	16.37876	17.03853	0	0
A0A669B2Z8	A0A669B2Z8_ORENI	LOC100690310		Protein-serine/threonine phosphatase (EC 3.1.3.16)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]; membrane [GO:0016020]	cytosol [GO:0005829]; membrane [GO:0016020]; magnesium ion binding [GO:0000287]; manganese ion binding [GO:0030145]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]	magnesium ion binding [GO:0000287]; manganese ion binding [GO:0030145]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]	VEEIIQVMR	15.28999996	1134.029329	16.1981	15.84982	15.55848	0	0	0	14.8237	0	14.91067	16.58309	16.30223	0	15.27584	16.1404	0	14.47511	15.88112	16.21766	16.24692	15.42113	0	15.83585	0	0	0	0	16.40759	15.7925	0	15.30731	18.09774	19.0654	19.54018	16.53179	14.55982	16.63015	16.06054	15.88727	15.88525	0	13.87056	0	15.59394	16.2148	15.5185	16.02057	16.47712	16.50714	0	15.82747	15.96575	15.33667	0	18.33862
A0A669BNB4	A0A669BNB4_ORENI	eif2s3		Protein-synthesizing GTPase (EC 3.6.5.3)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]; GTPase activity [GO:0003924]; translation initiation factor activity [GO:0003743]; tRNA binding [GO:0000049]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]; translation initiation factor activity [GO:0003743]; tRNA binding [GO:0000049]	GVLKVGQEIEVRPGIVSK	5.570000172	1906.513506	14.62282	13.85638	12.62619	16.34037	12.77214	12.32959	12.76411	12.74758	12.66358	11.97348	13.33422	14.33088	13.5255	15.63319	0	0	13.38484	0	12.51633	0	0	0	0	0	14.33212	14.34075	0	14.56735	0	0	0	16.04059	0	15.35484	0	0	0	0	13.31854	14.32436	0	0	0	0	0	0	0	0	0	0	0	13.99576	0	0
I3K2Y9	I3K2Y9_ORENI	CDC25B	cell cycle [GO:0007049]; cell division [GO:0051301]; positive regulation of cell cycle G2/M phase transition [GO:1902751]	Protein-tyrosine-phosphatase (EC 3.1.3.48)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein tyrosine phosphatase activity [GO:0004725]; cell cycle [GO:0007049]; cell division [GO:0051301]; positive regulation of cell cycle G2/M phase transition [GO:1902751]	protein tyrosine phosphatase activity [GO:0004725]	KPTKPASRCR	1.99000001	1199.604297	0	12.82774	0	0	0	15.86677	15.59358	0	0	0	0	14.74039	0	9.559874	0	13.04594	0	13.50984	14.50544	13.04991	0	0	0	0	0	0	0	14.57801	8.032168	15.3125	0	0	14.63402	0	0	0	12.91358	0	12.70467	12.23706	0	14.5119	11.51485	13.67126	0	0	0	0	0	0	13.82973	0	0	0
A0A669DL20	A0A669DL20_ORENI	ski	"transcription, DNA-templated [GO:0006351]"	Proto-oncogene c-Ski (Ski oncogene)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"SMAD binding [GO:0046332]; transcription, DNA-templated [GO:0006351]"	SMAD binding [GO:0046332]	HEDLSSQTPLADR	6.53000021	1467.58686	0	0	0	0	0	0	0	10.63722	0	0	0	0	12.02645	11.30239	0	12.04907	0	0	0	12.37379	11.77768	0	13.81846	0	0	0	2.948071	7.831528	15.06589	0	12.88652	18.28241	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13.59449
A0A669BMU8	A0A669BMU8_ORENI	ret	homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	Proto-oncogene tyrosine-protein kinase receptor Ret (EC 2.7.10.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane raft [GO:0045121]; plasma membrane [GO:0005886]	membrane raft [GO:0045121]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	IDGTGKTK	14.01000023	818.9304189	0	0	13.28146	0	15.74859	15.42407	0	16.07528	15.68668	0	17.71172	17.32149	0	15.44351	0	16.13228	0	15.08337	0	0	13.6041	0	12.77419	0	0	0	14.59161	13.22869	0	11.15705	0	17.25708	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.0157	0	0	0	0
A0A669CFL1	A0A669CFL1_ORENI		homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	Protocadherin-related 15a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	calcium ion binding [GO:0005509]	RQALMDPAK	7.940000057	1046.503952	14.00996	14.98112	16.20731	13.56258	15.78122	15.56176	0	15.54304	14.98085	15.69282	17.29983	15.66226	0	14.66113	16.40176	0	16.29179	16.02585	17.19884	16.94622	16.61066	0	0	17.67446	15.09609	18.57728	19.33732	0	0	15.43729	16.83157	0	15.01356	14.79221	10.67957	15.9761	14.77582	0	13.63543	16.28379	0	16.57449	0	16.5167	0	0	14.41175	15.79592	16.31202	0	15.33505	0	16.70706	15.33793
A0A669DWN5	A0A669DWN5_ORENI		homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; inner ear development [GO:0048839]; sensory perception of sound [GO:0007605]	Protocadherin-related 15b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; stereocilium [GO:0032420]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; stereocilium [GO:0032420]; calcium ion binding [GO:0005509]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; inner ear development [GO:0048839]; sensory perception of sound [GO:0007605]	calcium ion binding [GO:0005509]	APSKSK	4.75	618.4344225	15.89318	13.41918	14.15963	0	0	14.63451	0	15.09017	0	0	13.6842	0	0	0	15.74364	0	13.68524	0	16.004	14.47601	15.24236	13.896	14.58025	15.24667	13.87736	13.45754	13.72812	14.79256	0	15.15064	0	17.86296	0	12.8022	0	12.34444	0	14.47996	14.88777	14.70814	0	14.7884	14.31016	15.56509	0	0	15.27632	0	14.65071	13.46795	13.14551	0	15.61117	13.02949
A0A669CUL5	A0A669CUL5_ORENI	LOC100695060	heme O biosynthetic process [GO:0048034]	"Protoheme IX farnesyltransferase, mitochondrial (EC 2.5.1.-) (Heme O synthase)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; mitochondrial membrane [GO:0031966]	integral component of membrane [GO:0016021]; mitochondrial membrane [GO:0031966]; protoheme IX farnesyltransferase activity [GO:0008495]; heme O biosynthetic process [GO:0048034]	protoheme IX farnesyltransferase activity [GO:0008495]	LSGFVGVSVKQK	32.25999832	1249.598859	0	18.89288	0	0	0	20.13349	0	19.12953	0	0	0	0	17.10134	0	0	15.25366	0	16.59498	15.07194	0	11.14975	0	0	0	0	16.26844	0	0	0	0	0	0	16.66643	19.59693	0	15.98545	0	0	12.41724	16.74073	14.86731	13.77566	16.0504	0	0	14.6694	16.11763	15.52634	16.05133	13.99534	15.0336	12.94857	0	0
A0A669EAW5	A0A669EAW5_ORENI	LOC100706113	proton transmembrane transport [GO:1902600]	Proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; NAD(P)+ transhydrogenase activity [GO:0008746]; proton transmembrane transport [GO:1902600]	NAD(P)+ transhydrogenase activity [GO:0008746]	DVLASDVVVK	5.519999981	1044.759611	15.15364	15.46998	14.59953	14.29828	0	14.51778	14.55312	16.19251	13.14143	0	0	0	14.9867	0	0	18.5312	0	0	0	15.63826	0	0	0	0	0	0	0	0	0	18.79843	0	16.31254	0	14.35179	10.43146	0	14.37754	0	0	16.67215	0	0	0	15.29946	15.2174	14.89136	0	0	19.66961	0	13.3526	0	0	0
I3KRM6	I3KRM6_ORENI	LOC100709233	pseudouridine synthesis [GO:0001522]	PseudoU_synth_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]; pseudouridine synthesis [GO:0001522]	pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]	LRAIDLAR	19.61000061	927.4193618	0	21.27236	21.05717	19.1915	19.79494	20.97044	21.041	20.69726	20.07345	0	20.37826	19.254	20.75719	21.09185	18.94985	20.41135	20.60942	0	19.30713	21.03633	20.79306	19.53964	20.12849	19.76483	17.59226	19.65801	16.65995	20.10592	19.41326	19.71232	19.80163	0	19.12664	18.75167	21.17219	0	21.19833	20.11345	20.45412	19.94747	19.45677	20.72165	20.38781	17.12369	21.65342	0	21.05971	20.55399	0	19.68737	0	20.30759	20.82482	0
I3K264	I3K264_ORENI			Purple acid phosphatase (EC 3.1.3.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		acid phosphatase activity [GO:0003993]; metal ion binding [GO:0046872]	acid phosphatase activity [GO:0003993]; metal ion binding [GO:0046872]	KMFIHR	5.150000095	832.662981	14.88154	15.09199	0	15.09144	17.87869	16.17802	15.47368	14.41997	16.13812	13.59185	0	16.94684	14.52653	15.41327	0	16.18614	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17.22476	0	0	0	0	0	16.52835	0	0	0	0	0	0	0	0	0	0	0	16.67111	0	0
I7I7L9	I7I7L9_ORENI	apo14kda		Putative apolipoprotein 14kDa	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EFAENLQSKPEFQTFMK	4.260000229	2074.558238	0	13.54205	12.72348	14.31115	13.67239	13.06479	13.69594	16.84262	0	14.79096	14.4038	0	0	11.63519	15.72865	0	13.3099	11.94305	17.97804	17.5963	13.5595	12.66452	9.825404	11.58739	15.09156	0	0	0	0	0	13.68141	10.02441	13.91844	14.60375	15.25978	12.64918	0	11.13942	13.0529	11.6475	12.87844	12.01447	0	13.82767	0	0	13.99911	0	10.52611	0	0	15.00195	0	0
I7J7R5	I7J7R5_ORENI	apoa1	lipid transport [GO:0006869]; lipoprotein metabolic process [GO:0042157]	Putative apolipoprotein A1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; lipid binding [GO:0008289]; lipid transport [GO:0006869]; lipoprotein metabolic process [GO:0042157]	lipid binding [GO:0008289]	AALTPIVESIR	43	1169.507977	15.26798	14.8218	12.63783	0	0	13.82498	0	17.50225	0	17.41611	15.21192	0	14.0614	14.86024	15.36865	15.56126	15.07287	15.8193	16.79147	14.73647	0	16.53027	15.56409	15.27365	13.56676	8.096123	13.86098	14.71609	14.15005	15.57007	0	0	15.921	0	14.33372	14.45678	16.08918	0	0	14.80518	14.89499	15.4558	15.19845	14.40404	14.7013	14.72608	15.70187	15.97362	15.05541	14.5113	14.47609	17.87403	0	15.89865
I3K841	I3K841_ORENI	apoa4a	lipid transport [GO:0006869]; lipoprotein metabolic process [GO:0042157]	Putative apolipoprotein A4a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; lipid binding [GO:0008289]; lipid transport [GO:0006869]; lipoprotein metabolic process [GO:0042157]	lipid binding [GO:0008289]	SGAEAYAQAMDPEPMKAVLQQK	3.880000114	2378.595839	13.95262	12.33447	12.82654	8.02916	11.74632	5.543689	10.58025	0	8.288185	0	11.5296	0	0	12.82323	0	0	11.70517	13.66281	12.23235	0	13.43791	0	12.7615	0	0	0	0	13.03167	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669E3J6	A0A669E3J6_ORENI	sqor		Pyr_redox_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		oxidoreductase activity [GO:0016491]	oxidoreductase activity [GO:0016491]	QHYKMLVLGGGSGGITMSSR	13.13000011	2111.56903	12.91207	12.87326	13.84058	11.89577	11.44467	12.72505	0	13.25546	13.12358	0	12.12988	11.94283	12.58357	12.31046	0	13.65851	0	10.96124	10.65094	11.34536	0	12.62236	13.18551	0	0	0	0	0	15.442	0	0	0	0	0	0	0	0	0	13.42346	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DDU3	A0A669DDU3_ORENI			Pyrin domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LQEKPNMTSLQSENTNIH	5.269999981	2098.859902	11.87849	15.89149	15.66816	0	17.35124	12.10412	12.17354	0	0	10.0125	12.157	0	0	0	0	14.82666	13.75245	0	0	14.36089	14.63702	14.48068	17.09186	10.53848	14.07517	0	0	0	0	14.63887	0	16.92432	0	0	13.05672	0	0	14.65432	0	0	0	14.15164	14.41659	0	0	0	0	0	0	0	0	0	0	0
A0A669DM37	A0A669DM37_ORENI	PC	gluconeogenesis [GO:0006094]; pyruvate metabolic process [GO:0006090]	Pyruvate carboxylase (EC 6.4.1.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; biotin binding [GO:0009374]; metal ion binding [GO:0046872]; pyruvate carboxylase activity [GO:0004736]; gluconeogenesis [GO:0006094]; pyruvate metabolic process [GO:0006090]	ATP binding [GO:0005524]; biotin binding [GO:0009374]; metal ion binding [GO:0046872]; pyruvate carboxylase activity [GO:0004736]	MITLNAVSAER	6.099999905	1221.72175	14.25433	0	0	11.02048	12.1994	11.73951	11.74329	0	0	13.95538	11.80896	14.7083	13.66202	0	14.13043	0	13.86629	15.36561	13.87486	13.77053	12.57485	13.50696	14.00629	13.28112	15.45086	13.5731	13.33675	12.3971	0	13.04596	18.77302	17.73752	18.15455	0	15.06353	0	0	0	15.42538	0	0	0	0	0	0	13.38548	15.37742	0	12.85053	14.98901	15.05149	0	13.54075	10.26231
A0A669BMH5	A0A669BMH5_ORENI			Pyruvate kinase (EC 2.7.1.40)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; kinase activity [GO:0016301]; magnesium ion binding [GO:0000287]; potassium ion binding [GO:0030955]; pyruvate kinase activity [GO:0004743]	ATP binding [GO:0005524]; kinase activity [GO:0016301]; magnesium ion binding [GO:0000287]; potassium ion binding [GO:0030955]; pyruvate kinase activity [GO:0004743]	ALGAHGRDIK	12.14999962	1036.449806	0	0	0	0	0	0	21.5743	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18.32028	0	0	0	0	0	0	16.68425	0	0	0	16.92368	0	20.78808	14.14997	0	15.9471	0	16.88129	0	0	15.68173	0	0	0	0	0	0
I3KCQ0	I3KCQ0_ORENI	C9orf64		Queuosine salvage protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VLLEHGGSFR	6.329999924	1113.694119	12.21776	0	14.81447	13.22989	14.26011	15.5502	16.85655	15.82652	16.25583	15.13907	14.61128	13.60588	15.46047	12.40853	14.61368	16.33486	12.50985	13.10081	14.91047	0	14.80305	11.55095	14.04091	18.44674	14.19214	12.50423	15.13585	13.07109	13.7478	11.7499	16.64925	16.37637	16.41395	10.61725	0	10.08662	14.90206	0	14.50104	0	13.2872	15.51288	7.572889	0	14.14971	14.25306	11.62506	14.26407	0	18.98952	16.43749	0	0	14.11866
F8TLW1	F8TLW1_ORENI		positive regulation of Wnt signaling pathway [GO:0030177]; Wnt signaling pathway [GO:0016055]	R-spondin-1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		G protein-coupled receptor binding [GO:0001664]; heparin binding [GO:0008201]; positive regulation of Wnt signaling pathway [GO:0030177]; Wnt signaling pathway [GO:0016055]	G protein-coupled receptor binding [GO:0001664]; heparin binding [GO:0008201]	AQGGGGGGGGGGGGGGK	9.600000381	1145.564816	14.38968	14.32451	15.05053	0	0	15.52287	0	11.39878	7.886997	0	0	15.36313	0	0	12.95765	15.5912	15.11771	16.45748	15.00364	0	13.94194	15.07128	0	0	9.360885	0	16.21635	0	0	0	0	0	0	15.78622	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669BY44	A0A669BY44_ORENI			RAB guanine nucleotide exchange factor (GEF) 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		DNA binding [GO:0003677]; zinc ion binding [GO:0008270]	DNA binding [GO:0003677]; zinc ion binding [GO:0008270]	DFVEFLKNLQKPGR	5.300000191	1690.141688	0	16.88491	0	0	16.68582	0	0	0	0	0	0	14.32724	15.71873	0	0	0	0	0	0	0	0	0	15.58967	0	14.92718	0	0	0	0	0	15.69792	0	0	0	0	0	0	0	0	0	0	0	0	0	15.85231	0	0	0	17.29649	15.25906	0	0	0	0
A0A669BXS2	A0A669BXS2_ORENI			RAB3 GTPase activating protein subunit 2 (non-catalytic)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; GTPase activator activity [GO:0005096]	GTPase activator activity [GO:0005096]	EQKAAFLSAK	6.590000153	1092.403665	0	0	0	0	15.69997	12.1061	13.92583	12.37576	11.34145	13.34415	16.94214	12.66311	0	14.1648	0	12.38364	13.7155	0	14.15579	0	14.89925	14.57096	14.30473	0	13.63092	13.44271	11.68105	13.89666	14.80686	13.08834	10.63055	13.90826	14.42686	12.66001	13.42534	14.57742	12.41549	0	13.86382	0	0	0	12.93949	0	0	13.01903	0	14.6068	0	14.06723	13.36568	13.93205	0	14.43767
A0A669F2G7	A0A669F2G7_ORENI		DNA repair [GO:0006281]; telomere maintenance [GO:0000723]	"RAD50 homolog, double strand break repair protein"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Mre11 complex [GO:0030870]	Mre11 complex [GO:0030870]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; metal ion binding [GO:0046872]; DNA repair [GO:0006281]; telomere maintenance [GO:0000723]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	INEMSILGVRR	1.570000052	1288.755572	12.40617	0	13.18302	0	0	0	11.76199	0	11.48712	10.54137	0	9.743126	17.19259	0	6.872936	12.59547	13.78425	0	12.4379	0	0	0	0	0	0	0	0	0	0	0	0	0	14.98753	0	12.18074	0	11.51252	0	11.52925	12.85547	12.66323	0	0	0	0	11.2337	0	0	11.26663	12.62549	13.43508	13.21961	11.10215	0
A0A669DIP5	A0A669DIP5_ORENI		DNA repair [GO:0006281]	RAD51 associated protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; double-stranded DNA binding [GO:0003690]; RNA binding [GO:0003723]; single-stranded DNA binding [GO:0003697]; DNA repair [GO:0006281]	double-stranded DNA binding [GO:0003690]; RNA binding [GO:0003723]; single-stranded DNA binding [GO:0003697]	SQAAGTPMR	1.610000014	935.2180302	0	13.56166	13.65802	0	0	13.71402	0	0	0	13.47414	14.10287	14.31888	0	15.70954	15.36008	0	16.04296	14.16625	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.33191	0	0	15.80337	0	0	15.05355	13.76002	0	0	0	0	13.75455	0	0	12.0358	0	0	0	0	0	0
I3JP51	I3JP51_ORENI		signal transduction [GO:0007165]	RAN GTPase activating protein 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]; signal transduction [GO:0007165]	GTPase activator activity [GO:0005096]	GAIAMAQALK	3.450000048	988.9208026	14.17388	0	12.97979	12.44021	11.01856	13.01765	9.746797	15.24839	12.25088	13.3693	13.66787	0	13.52921	0	11.635	14.7151	9.790462	0	12.31903	0	0	10.66238	14.50262	11.02961	0	14.02495	11.46479	10.65718	0	0	12.25456	13.92297	0	14.83462	13.00662	9.913523	13.71901	12.18256	13.49696	13.18812	12.80935	11.30775	13.53702	12.3465	14.06601	13.68092	13.45359	15.012	11.10196	18.87292	10.82081	13.38051	0	13.86527
A0A669F532	A0A669F532_ORENI		regulation of mitochondrial mRNA stability [GO:0044528]	RAP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		regulation of mitochondrial mRNA stability [GO:0044528]		DIGVAQLCR	3.869999886	1029.626974	12.5166	0	12.56921	14.66864	15.27082	14.1819	14.90438	14.00723	15.63743	14.15697	14.16399	12.24567	11.5106	0	14.85836	15.03775	19.63087	0	14.96586	13.7887	0	13.9393	0	0	0	14.32186	0	0	0	0	0	0	0	15.19614	0	13.66573	0	0	14.59828	18.36715	14.19943	0	0	0	0	0	14.04283	0	0	0	0	14.30563	13.53621	16.87835
A0A669D0L9	A0A669D0L9_ORENI		protein ubiquitination [GO:0016567]	RCR-type E3 ubiquitin transferase (EC 2.3.2.33)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	axon [GO:0030424]	axon [GO:0030424]; metal ion binding [GO:0046872]; protein ubiquitination [GO:0016567]	metal ion binding [GO:0046872]	LLQTISDLMMSLPSGSSLQQMALR	1.539999962	2668.641499	11.42382	16.46962	15.19568	0	14.6669	12.54215	14.8368	0	0	16.16455	0	0	0	0	14.52418	0	15.49232	15.70786	0	14.39922	15.07872	0	13.73559	0	0	0	0	0	0	0	16.3808	0	14.14447	0	13.93858	0	0	14.26667	0	16.7682	15.06205	16.73768	14.82857	0	15.7953	17.29602	15.60464	15.51507	15.8197	16.53045	14.78532	0	0	0
I3K6F4	I3K6F4_ORENI	rad51d	DNA repair [GO:0006281]	RECA_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA-dependent ATPase activity [GO:0008094]; DNA repair [GO:0006281]	ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA-dependent ATPase activity [GO:0008094]	KLDETDS	10.42000008	806.4101465	14.03414	16.56142	15.04121	14.7444	15.9063	15.86848	15.61457	15.05819	15.73887	16.57187	15.96017	17.4022	16.43739	15.72269	17.81408	0	16.58407	16.59753	16.50987	16.19304	17.13877	18.22152	16.18926	16.54521	14.67567	16.75789	6.587338	0	0	0	15.71606	15.7115	16.79282	16.85551	13.50242	14.68747	17.29695	15.37126	16.5904	18.29369	17.39046	16.14673	15.10645	15.14796	16.63325	15.90307	0	16.05454	20.16158	0	18.7824	16.85723	0	0
I3JNN6	I3JNN6_ORENI	LOC100694937		RFX-type winged-helix domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	MEADGDESVR	10.72999954	1125.506095	0	0	13.63045	13.46826	14.29534	14.29623	0	13.51773	12.97907	13.44708	11.01071	0	14.11066	15.46266	14.81941	13.63387	15.44431	13.07135	14.23844	15.36196	14.37911	15.24268	15.86142	0	15.80244	14.29342	14.95745	0	14.87509	0	0	0	15.35716	9.741561	13.18654	14.63893	0	0	0	0	12.62095	0	15.38547	0	0	13.96668	0	0	13.80065	15.26532	0	0	15.46503	15.28399
I3JB83	I3JB83_ORENI			"RGM domain family, member D"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	anchored component of membrane [GO:0031225]; plasma membrane [GO:0005886]	anchored component of membrane [GO:0031225]; plasma membrane [GO:0005886]		GGSGVGR	9.739999771	588.8379607	15.01041	14.70746	14.90291	15.91434	14.49141	15.97865	16.05584	13.97537	15.31026	0	15.90269	14.95778	15.52719	14.59153	14.26726	15.74295	0	15.07182	13.14433	0	14.05733	14.77674	15.25696	13.75609	15.58686	15.31508	14.58154	15.15536	15.08818	15.39195	0	17.74355	18.0704	16.17694	0	0	15.06998	0	0	0	0	13.81806	14.42396	15.23997	13.31201	14.97837	14.72373	16.1809	15.8579	0	15.88389	0	15.66407	14.55615
A0A669DYW9	A0A669DYW9_ORENI	LOC100701211	G protein-coupled receptor signaling pathway [GO:0007186]	RGS domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; GTPase activator activity [GO:0005096]; G protein-coupled receptor signaling pathway [GO:0007186]	GTPase activator activity [GO:0005096]	MKATSESK	3.400000095	881.8855786	12.71268	0	14.52529	15.73836	11.51867	13.09393	12.70686	10.50402	12.81403	15.05593	14.05682	14.61966	14.56657	13.3981	0	7.562419	11.97195	12.48442	0	11.98567	9.294128	13.71404	12.70918	13.29996	11.05071	11.38056	8.379361	12.2727	9.464169	14.47793	11.1523	15.36323	14.20302	12.91958	13.5614	0	0	13.70989	14.81175	0	0	0	0	0	0	0	11.35962	13.37863	13.43949	0	12.95843	11.97444	14.7991	13.89664
I3J6Y3	I3J6Y3_ORENI	relb	regulation of transcription by RNA polymerase II [GO:0006357]	RHD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; regulation of transcription by RNA polymerase II [GO:0006357]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DDIEIIFR	13.13000011	1020.153541	0	0	13.71342	11.714	17.07826	14.64776	12.47382	14.41373	0	0	12.04002	0	14.50007	0	9.625117	0	0	0	14.49892	0	17.95095	13.07833	0	0	0	0	14.70422	0	0	10.87076	15.69958	0	0	0	0	0	14.63531	0	0	12.63246	13.92929	13.04377	14.46405	0	0	0	12.04812	16.89583	14.48482	0	14.18766	13.87007	13.15758	13.18898
I3J8F8	I3J8F8_ORENI			RHO family interacting cell polarization regulator 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		HVETSQDSISR	11.82999992	1259.921942	13.87647	10.71905	11.88501	14.15675	11.30147	13.70146	0	15.5663	12.7289	0	14.17086	12.38988	14.20454	13.58278	9.255797	11.29086	14.44583	0	15.73172	10.85916	14.47495	0	14.71987	14.84895	11.06557	15.2292	12.00313	0	0	12.51618	19.24801	17.64011	17.30241	14.45818	0	13.566	14.27007	0	10.56564	11.50527	0	11.34709	17.05439	14.03881	14.87004	13.90372	13.84537	13.31341	14.44303	12.84822	15.95567	14.46347	15.38192	14.07146
A0A669BMC9	A0A669BMC9_ORENI	LOC100695073		RIC3 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum [GO:0005783]; integral component of membrane [GO:0016021]	endoplasmic reticulum [GO:0005783]; integral component of membrane [GO:0016021]		MAMSTFQK	4.090000153	942.5112785	0	10.8684	16.72577	15.28062	13.08253	11.54178	14.10299	12.93786	13.90927	13.58616	13.17727	16.28046	15.00296	15.62696	11.39023	13.96784	0	16.16026	0	0	15.97857	0	0	0	0	16.4141	0	13.86222	0	0	0	0	15.42572	0	0	0	0	0	0	17.15544	0	0	0	13.37477	15.58971	0	0	0	16.15531	16.25845	0	0	0	0
A0A669EZ61	A0A669EZ61_ORENI			RIMS binding protein 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SINSHNTLK	7.269999981	1012.511703	13.87265	0	14.38405	11.34469	15.05085	13.29741	0	13.42707	0	13.03616	13.18873	11.92965	12.36329	0	0	14.34933	10.13815	13.67738	8.223082	16.17999	12.47628	11.7258	14.43187	14.65792	12.51825	8.41428	0	8.20216	0	0	0	10.31788	0	12.68093	14.7444	0	13.62657	13.42323	11.73353	13.33237	13.30764	14.5117	11.08255	13.02741	13.70053	0	9.931723	13.31199	13.83375	8.854696	12.3982	14.17393	12.24682	0
I3IVY7	I3IVY7_ORENI	RNF207		RING finger protein 207	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		Hsp70 protein binding [GO:0030544]; zinc ion binding [GO:0008270]	Hsp70 protein binding [GO:0030544]; zinc ion binding [GO:0008270]	LEPRFQGPK	5.78000021	1071.992441	0	14.71729	0	14.28388	0	0	0	0	13.83019	0	14.19232	13.76322	0	14.19286	0	0	11.68988	14.11609	0	13.29794	17.769	12.18686	0	13.87992	17.17028	0	14.32317	15.93698	14.5566	16.60275	0	11.77222	0	16.42129	0	0	0	14.0307	13.84575	0	0	0	15.35017	12.36989	0	0	0	15.49642	0	15.09534	0	13.91815	15.32951	0
A0A669D0D6	A0A669D0D6_ORENI	marchf5		RING-CH-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	THHSAPVLVK	8.31000042	1089.283847	7.95265	14.20436	16.55683	13.69371	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22.66564	23.22711	21.73258	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3J7Y3	I3J7Y3_ORENI	LOC100709775	posttranscriptional regulation of gene expression [GO:0010608]	RING-type E3 ubiquitin transferase (EC 2.3.2.27)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	P-body [GO:0000932]	P-body [GO:0000932]; metal ion binding [GO:0046872]; mRNA binding [GO:0003729]; ubiquitin-protein transferase activity [GO:0004842]; posttranscriptional regulation of gene expression [GO:0010608]	metal ion binding [GO:0046872]; mRNA binding [GO:0003729]; ubiquitin-protein transferase activity [GO:0004842]	AVRAGR	11.72000027	629.8950115	0	14.30555	0	13.22145	10.8282	14.63957	12.8333	0	14.02611	15.39361	15.36748	14.83008	15.33915	14.00919	13.78697	14.50877	14.07061	11.6806	13.4892	13.86699	14.5816	14.06415	13.59745	0	13.98859	14.46296	14.52764	14.18824	0	14.17586	20.32628	17.84447	20.34415	14.79242	15.74213	0	13.76714	13.49176	14.1515	13.35357	0	10.04357	13.68236	14.80983	11.414	13.09761	14.2828	0	10.84974	16.20259	16.56894	14.93561	0	12.34325
A0A669ELQ9	A0A669ELQ9_ORENI	oxtr	postreplication repair [GO:0006301]; protein monoubiquitination [GO:0006513]	RING-type E3 ubiquitin transferase RAD18 (EC 2.3.2.27)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; metal ion binding [GO:0046872]; single-stranded DNA binding [GO:0003697]; ubiquitin protein ligase activity [GO:0061630]; postreplication repair [GO:0006301]; protein monoubiquitination [GO:0006513]	metal ion binding [GO:0046872]; single-stranded DNA binding [GO:0003697]; ubiquitin protein ligase activity [GO:0061630]	KFLSYK	4.860000134	784.5449012	13.29633	15.08588	13.7349	12.03981	14.33288	13.18541	12.79659	16.12215	15.1774	15.29071	12.43607	15.02966	15.58465	15.12524	14.55876	15.21854	13.9689	14.51535	14.75124	0	15.16081	13.41173	13.34029	16.22345	14.34844	14.02097	12.99502	14.74181	11.88495	15.3032	18.56742	17.9601	16.93638	14.11364	14.48468	13.77506	13.81814	14.87009	14.69532	12.57387	14.96503	9.269123	15.06966	14.94418	16.0686	13.92505	13.76379	14.53318	13.95117	15.53365	14.44154	15.30954	0	14.38813
I3K7Z5	I3K7Z5_ORENI	LOC100699507		RING-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	STSEAAREK	5.239999771	978.7020513	0	0	0	14.7624	13.15582	15.68272	0	0	0	0	12.73742	16.0423	15.25604	15.78013	14.97562	14.4465	0	12.72236	0	15.4642	15.90511	13.62668	14.59772	15.10783	15.57778	0	14.96912	15.27202	15.41551	15.54334	15.50046	16.12663	16.51674	15.9349	14.01114	16.43711	14.98747	13.43601	12.56419	15.11181	0	14.57118	15.61813	0	0	16.40387	16.67509	14.22777	14.64977	13.2543	16.90198	16.69661	15.9791	15.93034
I3J768	I3J768_ORENI	mtpap		RL domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ASLAKCLQK	9.510000229	1016.189195	11.95256	12.9279	13.05763	12.68455	15.74494	13.45801	14.20989	14.96345	15.59726	15.55438	14.84374	14.83881	8.702471	18.48571	0	12.93514	17.72229	17.08809	0	16.74996	0	14.39962	13.18939	0	0	0	0	0	0	0	19.00736	13.97889	13.91912	14.84787	5.953264	13.41059	13.27469	9.731092	13.80841	14.16167	14.72778	13.26208	15.35334	14.49857	0	11.68244	13.47227	10.40242	14.4079	17.93509	15.5681	15.02364	13.15187	13.39282
I3KRM7	I3KRM7_ORENI	DDX17		RNA helicase (EC 3.6.4.13)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]	ATP binding [GO:0005524]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]	LAFYSFA	4.050000191	818.0447202	13.44397	13.13122	15.36215	16.13787	14.37353	12.70294	0	14.1827	15.72897	11.36488	15.18474	13.47271	14.89762	12.6623	15.65426	14.49092	14.62741	15.44386	16.16657	14.70176	16.49933	15.26426	14.21395	15.94524	14.51041	15.78242	14.20219	14.5899	15.76526	0	16.77207	0	15.37178	0	0	0	15.32686	0	0	0	0	0	14.50514	15.638	0	0	0	14.27922	15.05339	14.4576	16.35714	0	16.25704	0
I3JIH4	I3JIH4_ORENI	bcdin3d		RNA methyltransferase (EC 2.1.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		O-methyltransferase activity [GO:0008171]; RNA methyltransferase activity [GO:0008173]	O-methyltransferase activity [GO:0008171]; RNA methyltransferase activity [GO:0008173]	LGRSDFDHFK	12.01000023	1222.43319	13.17759	13.87059	11.91503	13.45606	14.54281	13.29539	13.85214	12.86156	0	0	15.17586	12.43649	13.38776	13.42662	12.61589	10.33326	13.16618	13.27211	12.7142	0	13.78112	13.65424	13.92381	14.85509	0	10.24167	0	15.26286	14.47527	0	17.31419	18.36617	0	13.79235	12.86978	13.58314	13.92357	13.12729	0	12.40237	13.50802	10.88885	12.23964	0	0	12.97424	0	0	14.33161	13.45926	12.75849	13.52734	0	12.34208
A0A669EI03	A0A669EI03_ORENI		transcription by RNA polymerase II [GO:0006366]	RNA polymerase II associated protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		transcription by RNA polymerase II [GO:0006366]		TLSLSTLANILSK	4.010000229	1360.609333	8.455713	0	0	0	16.62252	0	0	0	0	13.09042	0	13.8105	6.922631	0	17.05466	12.84982	0	17.53215	0	0	5.985937	0	0	0	14.19474	6.756061	0	0	12.38815	0	0	0	0	0	13.98743	9.11787	14.52409	9.169835	0	0	0	9.501282	0	0	10.42712	0	0	0	0	0	0	0	0	0
I3KRS9	I3KRS9_ORENI		mRNA processing [GO:0006397]	RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (EC 3.1.3.16)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]; mRNA processing [GO:0006397]	protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]	FDLVITCEER	5.050000191	1282.439934	12.99534	13.17689	13.11489	12.42674	13.08998	0	14.52244	13.6451	0	15.6603	14.2621	14.3211	6.021381	14.40395	12.66157	14.78176	9.431698	15.65046	0	14.49403	16.61792	14.85025	0	15.98683	11.62388	14.66802	0	14.84881	15.10138	14.82712	17.18519	17.98885	17.72517	0	13.05315	0	0	15.25501	14.30328	14.62532	0	11.68832	15.74964	0	14.35147	15.51354	13.23822	12.81956	14.44743	9.052111	13.209	15.02262	12.62752	13.44633
I3JWQ4	I3JWQ4_ORENI	rpap2	dephosphorylation of RNA polymerase II C-terminal domain [GO:0070940]	RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog (EC 3.1.3.16)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; metal ion binding [GO:0046872]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]; RNA polymerase core enzyme binding [GO:0043175]; RNA polymerase II CTD heptapeptide repeat phosphatase activity [GO:0008420]; dephosphorylation of RNA polymerase II C-terminal domain [GO:0070940]	metal ion binding [GO:0046872]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]; RNA polymerase core enzyme binding [GO:0043175]; RNA polymerase II CTD heptapeptide repeat phosphatase activity [GO:0008420]	EELDEDDLEDEVTADNTEDKK	1.919999957	2452.27833	14.19792	0	0	13.94929	10.62745	13.40652	0	0	13.67378	0	0	0	0	12.37355	14.39894	0	0	0	0	0	14.64425	0	0	0	0	14.93034	0	0	0	0	0	0	8.346867	14.52102	0	0	12.1328	0	14.51416	0	0	0	15.09044	14.3097	0	0	0	0	0	16.91311	0	0	0	19.09709
I3IUD9	I3IUD9_ORENI		histone modification [GO:0016570]; transcription elongation from RNA polymerase II promoter [GO:0006368]	RNA polymerase-associated protein LEO1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Cdc73/Paf1 complex [GO:0016593]	Cdc73/Paf1 complex [GO:0016593]; histone modification [GO:0016570]; transcription elongation from RNA polymerase II promoter [GO:0006368]		CSKTQK	11.67000008	751.6265898	13.16252	14.0323	14.07766	13.98758	12.75419	15.24705	15.1187	14.3688	0	15.16141	0	0	0	0	13.33188	0	17.06981	14.96447	14.53121	0	0	0	0	0	0	14.75458	14.38016	0	0	15.27507	15.4659	0	0	0	0	13.86446	0	0	0	0	0	13.99944	0	0	0	0	0	12.62127	14.16631	0	0	0	0	0
I3JML8	I3JML8_ORENI			RNA-binding motif protein 42 (RNA-binding protein 42)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]	RNA binding [GO:0003723]	MEELAARVAEQQAAVMAAGLLSK	10.28999996	2386.216571	0	7.796659	11.36726	9.955098	0	13.29709	0	16.90639	0	9.822495	0	0	10.53633	0	9.445313	11.29639	12.69882	12.17787	0	14.38192	0	0	13.59059	0	0	13.84834	0	0	0	0	13.46441	13.24638	13.41944	12.79825	0	0	0	0	0	12.87945	0	12.71885	0	0	10.01903	10.22468	0	0	0	12.42244	0	0	18.42879	0
A0A669EME3	A0A669EME3_ORENI		cytidine to uridine editing [GO:0016554]	RNA-binding motif protein 47 (RNA-binding protein 47)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; RNA binding [GO:0003723]; cytidine to uridine editing [GO:0016554]	RNA binding [GO:0003723]	LMMDFDGKNR	4.389999866	1257.45578	13.29756	14.06405	9.437691	14.91917	15.20422	15.13241	14.96286	14.62766	11.1968	13.20458	13.63192	9.144829	12.36948	15.78271	0	11.83958	16.28237	15.94629	15.97467	14.95272	14.47821	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.43104	0	0	17.55311	17.57815	0	18.04792	0	15.44169	0	0	0
I3J0N5	I3J0N5_ORENI			RNAse_Pc domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		endonuclease activity [GO:0004519]; nucleic acid binding [GO:0003676]	endonuclease activity [GO:0004519]; nucleic acid binding [GO:0003676]	QHVDGKMTEK	7.840000153	1170.070855	10.92815	11.22549	13.27819	16.36903	0	14.46352	0	0	16.55743	7.732944	0	17.44606	0	0	0	0	0	11.77248	14.26468	12.44527	16.24689	13.70404	14.40319	15.13445	12.78422	15.10466	13.33234	0	14.02898	14.83553	17.44722	0	0	11.30566	0	17.8439	0	10.99245	0	0	0	0	8.854389	0	0	0	0	9.742088	0	0	0	0	5.834338	0
A0A669CFR8	A0A669CFR8_ORENI	C18orf25		RNF111_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ARCAHPCGGVIK	10.25	1326.798599	14.15339	14.2015	0	0	14.48243	0	15.9715	0	0	13.31613	11.06965	14.81224	11.85112	0	14.47177	0	14.59699	14.44327	0	0	15.12414	14.0922	0	15.02969	0	15.44751	14.64601	0	14.89292	13.44122	15.81965	0	14.42549	0	0	0	14.61839	16.40357	0	0	0	15.05871	0	0	0	15.5415	0	15.24118	0	15.11938	0	0	15.89333	0
I3JKA0	I3JKA0_ORENI	n4bp1		RNase NYN domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]	RNA binding [GO:0003723]	MITVAHLDAQSGSR	6.150000095	1485.972864	0	13.59971	0	15.43782	13.31429	0	13.66499	13.71573	13.17674	14.95582	10.20356	14.09317	0	12.68583	15.79024	0	13.04043	0	0	0	14.57176	0	15.75252	16.08908	10.41805	14.30095	14.98238	0	12.77902	14.26235	0	23.0563	0	16.73405	13.82112	0	15.914	0	15.51524	0	0	12.97457	0	13.15691	0	15.02132	0	0	14.05085	15.4039	14.21996	11.91268	13.97599	12.69316
A0A669D7X7	A0A669D7X7_ORENI			RNase_PH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GPRADGR	1.820000052	728.1762248	13.74702	16.16276	13.83165	12.01551	10.94755	10.36169	0	15.15501	11.9063	15.36547	15.33743	15.2594	15.92031	12.18029	12.5611	15.80909	16.72367	13.90415	10.17513	13.97411	14.28666	15.47013	15.98924	14.66307	11.9984	10.92565	0	14.45347	0	13.093	16.00401	15.73559	16.50073	14.53255	14.27916	13.40926	14.3868	15.13569	11.89356	14.33279	11.57512	13.71185	13.15234	13.4133	0	13.27669	15.79133	11.29299	0	0	12.82019	12.8381	15.92292	15.25166
A0A669BFB7	A0A669BFB7_ORENI		TOR signaling [GO:0031929]	"RPTOR independent companion of MTOR, complex 2 a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	TORC2 complex [GO:0031932]	TORC2 complex [GO:0031932]; TOR signaling [GO:0031929]		LAGDASTQFK	1.169999957	1036.964909	14.21164	12.7888	14.13294	14.74111	13.64441	13.99241	15.05261	12.81942	9.195038	13.41255	14.61478	14.94557	14.76544	9.603477	12.77075	10.09488	18.36031	13.2797	16.91702	14.97617	6.126458	15.09153	13.93612	13.70947	12.31888	15.73744	0	16.62331	15.19457	10.94344	13.38278	18.04502	0	0	0	13.25943	0	14.47277	0	15.07596	16.65115	15.80516	11.84719	0	15.13789	14.59035	0	13.00013	15.09136	19.02192	11.38749	0	0	0
A0A669B2Y4	A0A669B2Y4_ORENI	LOC100698415		RRM domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nuclear speck [GO:0016607]	nuclear speck [GO:0016607]; RNA binding [GO:0003723]	RNA binding [GO:0003723]	RSASTGSSSSR	7.800000191	1081.830491	14.37916	12.93182	11.60742	13.18567	12.91811	12.8396	12.45392	14.40189	12.5275	0	12.54282	13.17769	14.08	12.6364	14.29282	12.74823	13.25454	13.73925	0	13.40853	14.38153	0	14.29685	12.15812	0	12.87504	0	14.9159	13.31423	16.77691	15.41383	17.33086	11.74373	16.10495	14.44837	9.715046	13.46706	12.57496	0	0	13.1899	10.52739	9.191542	14.07448	5.859529	12.23073	0	13.93886	0	0	12.94569	12.06781	9.920986	0
A0A669EU52	A0A669EU52_ORENI		rRNA processing [GO:0006364]	RRP15-like protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		2-oxoglutarate-dependent dioxygenase activity [GO:0016706]; methyltransferase activity [GO:0008168]; rRNA processing [GO:0006364]	2-oxoglutarate-dependent dioxygenase activity [GO:0016706]; methyltransferase activity [GO:0008168]	ILGSVSK	9.590000153	703.0406581	0	0	15.43266	12.86588	14.53112	0	14.44656	0	0	0	14.90829	0	0	0	0	0	0	0	12.60435	15.13462	0	13.11621	14.49523	0	14.20134	0	10.55475	0	0	13.10917	0	22.62524	18.31154	0	13.48722	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DCK1	A0A669DCK1_ORENI			RT_RNaseH_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AVMSTMPVK	13.75	995.3171177	0	13.36141	14.81507	0	15.98065	0	0	15.93517	16.19715	0	14.74731	12.76774	14.52303	15.6239	0	15.02582	0	0	15.203	16.00713	12.41716	15.88577	0	15.92338	0	0	0	0	0	15.83141	14.75311	15.46622	16.38705	0	0	0	15.32853	15.89708	0	0	14.65749	15.1822	14.62877	0	13.00688	15.03507	0	16.49798	16.2019	0	0	0	0	0
A0A669CCY0	A0A669CCY0_ORENI	sgsm3		RUN and TBC1 domain-containing protein 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DSSQQLELQYDEFGFR	10.81999969	1962.833923	12.57994	9.037919	9.842139	0	0	13.38291	0	0	15.61974	13.16607	14.52021	0	14.45842	0	16.4629	0	11.13663	10.3566	0	12.26046	7.906805	15.81088	14.16068	0	15.52874	14.14782	0	16.1059	0	10.6489	13.79704	14.86554	15.98845	0	0	0	14.12487	10.31145	13.02656	0	13.76138	14.91376	14.30597	12.97678	0	0	12.95125	14.0143	14.58382	8.46572	13.63187	13.63064	0	12.5226
A0A669EIG1	A0A669EIG1_ORENI	rubcn	autophagy [GO:0006914]	RUN domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endosome [GO:0005768]; lysosome [GO:0005764]	endosome [GO:0005768]; lysosome [GO:0005764]; autophagy [GO:0006914]		NGGGHR	1.25	596.7266322	0	0	15.29971	0	0	14.51377	14.39209	14.57799	13.57457	0	13.72229	14.67919	15.96256	0	0	0	13.38946	15.26799	0	15.94081	0	13.90075	15.24987	0	13.74409	0	14.56094	15.48446	0	0	15.41075	0	16.30896	0	13.84194	0	15.03237	0	0	0	15.07191	0	0	16.54364	0	16.9721	0	14.62287	17.4005	18.61782	17.73569	0	0	0
A0A669EVR0	A0A669EVR0_ORENI	LOC100708443	protein transport [GO:0015031]; small GTPase mediated signal transduction [GO:0007264]	Rab GDP dissociation inhibitor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; GTPase activator activity [GO:0005096]; Rab GDP-dissociation inhibitor activity [GO:0005093]; protein transport [GO:0015031]; small GTPase mediated signal transduction [GO:0007264]	GTPase activator activity [GO:0005096]; Rab GDP-dissociation inhibitor activity [GO:0005093]	FLMANGQLVRMLLITQVTR	7.980000019	2221.297847	11.12153	12.30023	11.89652	11.29417	10.53182	12.64233	14.69662	13.55558	12.08829	13.13663	8.212981	12.09543	0	17.09937	0	0	0	0	0	0	17.96044	11.97084	0	10.47091	14.59663	0	13.36475	9.396344	0	11.93603	0	19.35014	11.6027	0	0	9.732824	0	0	10.69982	10.80406	0	10.78316	0	0	0	0	0	0	0	0	0	12.35163	12.57539	0
A0A669CC55	A0A669CC55_ORENI	evi5		Rab-GAP TBC domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]	GTPase activator activity [GO:0005096]	IKLHPK	14.35999966	732.1148063	16.52783	15.62447	14.97184	16.14038	16.89849	16.66135	17.1918	16.00416	17.15449	16.89597	17.08886	15.04964	16.26463	18.19504	14.75477	15.85338	17.75044	13.85277	16.11656	16.17623	16.27016	18.36112	16.64188	17.26524	18.98644	16.40787	0	15.80779	0	16.35599	15.97262	17.10295	17.37631	16.28785	17.08911	0	15.49355	16.08863	18.3487	16.14902	0	0	0	0	17.14687	15.90401	0	16.83184	0	16.17009	0	0	0	0
A0A669D1U8	A0A669D1U8_ORENI	LOC100702862	intracellular protein transport [GO:0006886]	RabBD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		small GTPase binding [GO:0031267]; intracellular protein transport [GO:0006886]	small GTPase binding [GO:0031267]	LNGEGGR	3.75999999	702.4472656	0	0	0	15.20327	0	0	15.54008	0	0	15.09782	14.83906	0	14.7075	15.48983	15.52013	0	16.92508	15.50206	14.00145	0	0	0	0	0	0	0	0	0	0	0	0	18.05459	16.81963	16.98542	0	0	0	0	0	0	0	0	0	0	16.54631	0	0	0	16.68612	16.31169	0	0	0	0
A0A669ECM3	A0A669ECM3_ORENI		intracellular signal transduction [GO:0035556]	Rac GTPase activating protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		intracellular signal transduction [GO:0035556]		TPSSSSLSQR	5.079999924	1048.967308	0	16.03461	16.12867	0	0	15.31655	0	0	16.52823	15.95181	17.59041	16.35545	16.43147	0	17.22907	16.43342	17.13953	16.62036	14.15725	11.25418	0	13.7012	16.67037	17.03104	0	17.41564	0	17.07275	12.48047	16.68784	0	21.2352	18.92619	0	13.94517	0	0	11.50313	12.743	0	12.69223	11.89818	12.9606	17.75349	13.75566	19.88937	19.43693	0	15.83601	16.54794	15.51803	0	0	0
A0A669EUU9	A0A669EUU9_ORENI		sister chromatid cohesion [GO:0007062]	Rad21_Rec8 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cohesin complex [GO:0008278]	cohesin complex [GO:0008278]; sister chromatid cohesion [GO:0007062]		KTVSNVFQR	10.44999981	1075.39598	0	15.88995	0	0	0	13.92445	15.96394	18.38739	16.64786	15.65444	15.73071	0	15.01406	16.39074	14.26569	15.11897	17.03587	15.92879	16.52729	15.96392	16.82572	16.44334	17.56183	18.03254	18.64924	18.15816	17.13697	18.29895	15.78849	13.01015	16.38349	14.80458	16.4821	0	14.73872	14.30836	16.20393	15.13845	15.20176	18.5652	16.87799	16.96503	0	0	15.50915	14.6977	18.20394	14.63608	0	15.40239	0	0	16.9367	13.49585
I3JN12	I3JN12_ORENI		regulation of small GTPase mediated signal transduction [GO:0051056]	"Ral GTPase activating protein, alpha subunit 2 (catalytic)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; nucleus [GO:0005634]	integral component of membrane [GO:0016021]; nucleus [GO:0005634]; GTPase activator activity [GO:0005096]; regulation of small GTPase mediated signal transduction [GO:0051056]	GTPase activator activity [GO:0005096]	KDSFAESLASLLFR	6.409999847	1584.27355	15.3496	14.09051	15.83779	12.62703	0	13.45478	15.13861	14.96031	14.37021	15.8867	14.22169	0	15.52642	11.91203	15.82775	15.19422	14.39441	15.05827	15.43464	12.81379	0	15.07995	15.379	0	0	15.40357	12.03288	0	0	0	0	15.71105	15.92344	14.2896	14.53563	12.90309	0	0	14.38713	15.04375	0	0	0	15.89053	0	0	16.14255	15.5862	14.81343	0	0	0	0	0
I3JS81	I3JS81_ORENI		regulation of small GTPase mediated signal transduction [GO:0051056]	"Ral GTPase activating protein, beta subunit (non-catalytic)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]; regulation of small GTPase mediated signal transduction [GO:0051056]	GTPase activator activity [GO:0005096]	ETWEVLLLFLLR	18.63999939	1532.175068	12.90501	13.24733	12.41955	12.64388	15.32869	0	0	12.8259	13.24481	14.0266	15.05822	14.74796	14.5427	11.59204	0	13.19426	13.23708	0	0	12.31354	0	0	0	0	13.68629	0	13.66311	12.78268	13.01054	0	16.25973	0	0	0	10.97613	0	13.29433	0	13.32286	0	0	0	0	15.14088	11.1391	0	14.87951	0	16.20408	0	0	0	0	14.70769
I3JI92	I3JI92_ORENI	rbck1	embryonic cranial skeleton morphogenesis [GO:0048701]	RanBP-type and C3HC4-type zinc finger-containing protein 1 (EC 2.3.2.31)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; transferase activity [GO:0016740]; embryonic cranial skeleton morphogenesis [GO:0048701]	metal ion binding [GO:0046872]; transferase activity [GO:0016740]	SLTEALSSGDSEEAAKLCQR	8.68999958	2150.701028	0	0	11.05238	15.06619	11.03825	17.08094	0	0	0	13.82758	15.24744	0	0	12.60545	0	17.95149	0	14.33013	12.08209	0	12.19771	14.01668	0	13.8384	9.573308	15.10115	14.2292	11.44159	0	13.64995	0	12.22679	14.17107	11.29309	11.11317	0	13.2132	0	0	15.41012	0	0	13.65408	0	0	10.80357	8.306363	0	12.25804	12.493	0	13.21994	15.01168	0
I3JPW4	I3JPW4_ORENI		small GTPase mediated signal transduction [GO:0007264]	Rap guanine nucleotide exchange factor (GEF) 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]; small GTPase mediated signal transduction [GO:0007264]	guanyl-nucleotide exchange factor activity [GO:0005085]	HFSMGEEK	3.609999895	978.6929409	0	0	0	0	0	0	0	0	13.09603	13.8631	0	0	0	0	0	0	0	14.05627	16.13359	16.01482	0	19.45045	19.06245	0	14.43437	16.56167	0	0	11.79114	0	0	0	15.64542	0	0	15.46086	0	0	11.43299	0	0	0	0	0	0	14.09721	10.90703	15.82584	0	0	0	0	0	0
A0A669EWV9	A0A669EWV9_ORENI		small GTPase mediated signal transduction [GO:0007264]	Rap guanine nucleotide exchange factor (GEF) 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]; guanyl-nucleotide exchange factor activity [GO:0005085]; small GTPase mediated signal transduction [GO:0007264]	GTPase activator activity [GO:0005096]; guanyl-nucleotide exchange factor activity [GO:0005085]	EIRHVVR	1	908.0455826	14.46223	15.28115	15.2908	11.37445	13.71512	0	15.43578	15.49358	15.51656	14.93258	14.92307	0	0	0	12.01495	17.00329	15.97593	14.57435	13.09952	0	15.39985	15.28319	14.77761	14.97012	17.02831	17.06365	0	16.89324	15.03448	0	0	16.25031	0	16.54942	15.34815	0	15.63812	14.28537	14.39066	0	0	0	16.32391	15.61892	0	15.46712	0	17.15605	17.23439	15.13653	16.09577	0	12.03119	0
A0A669DB57	A0A669DB57_ORENI	LOC100702207	regulation of small GTPase mediated signal transduction [GO:0051056]	Rap-GAP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]; regulation of small GTPase mediated signal transduction [GO:0051056]	GTPase activator activity [GO:0005096]	RSGLFPR	3.029999971	832.7567579	0	18.65164	0	15.40056	17.59658	13.23916	0	15.27754	15.88309	10.94852	0	0	15.82245	0	0	0	0	0	0	16.83672	0	16.80804	0	0	0	0	16.17052	0	15.69289	0	0	0	0	15.4682	0	0	0	0	15.32356	0	0	0	15.26954	0	16.03001	0	15.87126	0	19.25808	0	18.41641	0	0	0
I3K2P7	I3K2P7_ORENI		signal transduction [GO:0007165]	Ras association (RalGDS/AF-6) and pleckstrin homology domains 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signal transduction [GO:0007165]		QLYLNYQEAMKR	3.450000048	1573.489043	15.28234	17.98754	19.28499	15.50186	14.95023	14.6842	14.05772	0	15.06155	0	14.82168	0	0	0	15.36544	0	0	0	17.87538	0	0	0	0	0	0	0	0	0	0	0	0	17.2418	0	0	0	0	0	17.65791	0	0	0	16.94049	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DZ55	A0A669DZ55_ORENI		small GTPase mediated signal transduction [GO:0007264]	Ras protein-specific guanine nucleotide-releasing factor 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]; small GTPase mediated signal transduction [GO:0007264]	guanyl-nucleotide exchange factor activity [GO:0005085]	IDAFCGK	13.67000008	807.8890361	0	18.0333	18.33256	0	17.37068	19.82015	0	19.05125	17.64362	0	0	19.878	0	0	0	0	0	17.02581	17.08322	13.54979	0	0	0	0	0	0	18.79116	19.19573	17.69484	15.78907	0	17.42242	16.16167	15.64835	17.63984	16.70127	0	0	0	18.79325	17.82754	16.83403	0	0	0	0	19.42171	0	0	0	17.90561	0	0	0
A0A669C1K1	A0A669C1K1_ORENI		cellular response to amino acid stimulus [GO:0071230]; positive regulation of TOR signaling [GO:0032008]	Ras-related GTP-binding protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	lysosome [GO:0005764]	lysosome [GO:0005764]; GTP binding [GO:0005525]; cellular response to amino acid stimulus [GO:0071230]; positive regulation of TOR signaling [GO:0032008]	GTP binding [GO:0005525]	SIIFANYIAR	19.29999924	1166.914923	17.3349	0	17.79139	17.21075	21.01323	18.51697	19.41567	15.80702	19.96225	21.11982	21.24946	0	0	0	17.22271	19.26484	20.13779	17.33069	15.44454	0	0	0	21.341	0	0	16.93512	0	0	0	17.40374	20.40672	0	17.64102	17.52458	0	0	17.0296	18.59417	17.0437	16.45615	0	15.88871	0	20.91182	17.58083	0	0	0	19.59686	0	0	0	21.76019	0
A0A669DGZ3	A0A669DGZ3_ORENI			Rearranged L-myc fusion	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LLLGS	5.070000172	503.1190802	15.43576	15.38808	15.45726	15.66381	16.41576	15.72482	15.0229	15.21586	14.78417	14.81914	15.00781	15.07617	15.37989	15.88741	15.9874	15.74142	15.58298	14.96982	15.25155	16.35387	14.44586	0	16.54466	16.33469	16.29467	15.53235	16.04774	15.14908	16.4283	15.34543	18.11824	17.97933	19.4241	16.29728	16.69257	0	15.02385	15.09363	15.92789	15.77024	16.41737	15.53644	15.48158	16.3059	15.73232	0	15.78528	15.97932	16.17864	16.35771	16.4014	15.03976	16.56058	15.71002
I3IYQ2	I3IYQ2_ORENI			RecQ mediated genome instability 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DTVLLMDETGTFVVQGVNNIPKGKPCLSQGK	9.699999809	3361.612657	9.387149	11.97101	0	13.88179	12.84877	12.1373	11.58549	0	0	0	11.04178	0	12.69318	12.92878	17.77665	10.70347	0	0	14.0812	14.30296	0	11.93524	0	0	12.45016	12.54074	11.65804	10.37528	7.133897	0	0	0	0	0	0	13.03213	12.80651	10.32485	12.39048	0	10.55936	0	16.34703	13.20521	0	11.92291	12.27475	0	0	0	0	0	14.98715	0
W8G106	W8G106_ORENI		inflammatory response [GO:0006954]; innate immune response [GO:0045087]; toll-like receptor signaling pathway [GO:0002224]	Receptor protein TLR22 (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; transmembrane signaling receptor activity [GO:0004888]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; toll-like receptor signaling pathway [GO:0002224]	transmembrane signaling receptor activity [GO:0004888]	EIQTASFR	10.64000034	951.3028219	0	15.52105	14.9051	14.28355	15.07927	14.56234	15.96956	14.35519	13.95574	0	15.19295	0	0	0	0	0	0	0	15.36943	0	0	0	0	0	0	0	0	0	20.04595	20.03053	18.51879	0	0	0	0	15.10678	0	12.69689	0	0	0	0	0	0	0	0	0	0	16.58601	0	0	0	0	0
A0A669EHB5	A0A669EHB5_ORENI	ACVR1B		Receptor protein serine/threonine kinase (EC 2.7.11.30)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; transmembrane receptor protein serine/threonine kinase activity [GO:0004675]	ATP binding [GO:0005524]; transmembrane receptor protein serine/threonine kinase activity [GO:0004675]	MDHHSFIIDSGR	5.610000134	1415.805479	13.7562	14.80683	0	0	15.41931	0	0	11.35683	0	17.76829	15.54916	15.72444	15.82099	14.51411	15.34069	13.10342	14.11779	0	14.90944	0	0	0	15.51624	15.15529	0	15.49885	14.90471	0	0	13.19697	15.50556	14.73017	21.69605	16.09817	15.88529	13.70028	15.16797	0	13.43916	0	13.76996	13.47692	12.9691	0	13.135	12.75726	16.15913	12.7493	16.23718	16.336	0	0	0	0
A0A669D8A1	A0A669D8A1_ORENI	EPHB3		Receptor protein-tyrosine kinase (EC 2.7.10.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of plasma membrane [GO:0005887]	integral component of plasma membrane [GO:0005887]; ATP binding [GO:0005524]; ephrin receptor activity [GO:0005003]	ATP binding [GO:0005524]; ephrin receptor activity [GO:0005003]	ELNQNNWLRSDFIPR	9.130000114	1902.149188	0	0	17.12423	17.53848	18.47055	19.4232	19.30971	0	20.27984	0	0	16.40569	19.52027	18.43721	0	0	16.83475	15.08534	0	14.77883	0	0	0	19.27912	0	0	0	0	0	0	0	0	0	0	19.31485	20.8527	16.37331	0	0	0	0	0	0	0	0	0	19.53227	0	0	0	0	0	0	0
A0A669EA04	A0A669EA04_ORENI	RELN	cell adhesion [GO:0007155]; central nervous system development [GO:0007417]; neuron migration [GO:0001764]	Reelin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; hydrolase activity [GO:0016787]; lipoprotein particle receptor binding [GO:0070325]; metal ion binding [GO:0046872]; cell adhesion [GO:0007155]; central nervous system development [GO:0007417]; neuron migration [GO:0001764]	hydrolase activity [GO:0016787]; lipoprotein particle receptor binding [GO:0070325]; metal ion binding [GO:0046872]	NVAASK	4.309999943	588.5502342	0	13.52899	14.3927	15.38698	13.69121	15.49694	0	0	0	14.81202	15.03902	14.89932	14.91292	14.47866	0	0	15.72197	0	0	14.79825	15.03006	14.20426	0	15.08405	12.77908	14.69281	14.47758	15.41752	14.64533	14.08367	0	16.33008	0	0	0	14.55895	14.23003	13.9313	13.87128	0	14.03692	14.31165	14.18425	15.08612	13.7908	14.7525	0	0	14.88716	13.53875	13.54611	14.45235	15.64303	15.23074
I3J1B1	I3J1B1_ORENI	LOC102079386		Reelin domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GFMLEAR	4.960000038	840.1942618	10.7711	15.86986	0	13.387	0	0	0	0	16.31103	14.72221	13.53433	16.81625	15.84694	15.59185	14.35704	10.16904	14.62265	14.73429	13.12829	13.91087	14.18664	15.96169	15.31439	12.6053	14.35064	15.86881	13.28148	12.99624	14.94859	15.19133	17.74032	16.92374	17.96074	12.72759	14.64619	15.72042	0	0	12.95028	13.86941	15.64415	13.62874	0	15.29236	11.73812	14.13977	15.21321	14.48626	16.85043	14.56814	16.01028	15.67107	15.57452	14.57411
A0A669EHF3	A0A669EHF3_ORENI		exocytosis [GO:0006887]	Regulating synaptic membrane exocytosis 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]; synapse [GO:0045202]	membrane [GO:0016020]; synapse [GO:0045202]; metal ion binding [GO:0046872]; small GTPase binding [GO:0031267]; exocytosis [GO:0006887]	metal ion binding [GO:0046872]; small GTPase binding [GO:0031267]	CSNSLPR	9.149999619	833.1509864	12.95523	13.66863	14.68246	13.2008	14.66771	14.11538	13.31859	15.02944	11.16495	11.31358	9.99344	16.58793	14.61454	14.61759	14.76641	15.52013	15.89804	14.95649	0	13.81197	0	0	0	14.5794	13.45812	15.48016	13.02643	14.93143	14.78937	0	0	0	0	15.53191	0	14.84614	0	14.83393	15.59246	14.37632	13.81043	0	15.35785	13.90603	0	15.34247	0	12.01159	0	0	0	14.98606	14.68059	0
A0A669D5V4	A0A669D5V4_ORENI		exocytosis [GO:0006887]; intracellular protein transport [GO:0006886]	Regulating synaptic membrane exocytosis 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]; synapse [GO:0045202]	membrane [GO:0016020]; synapse [GO:0045202]; metal ion binding [GO:0046872]; small GTPase binding [GO:0031267]; exocytosis [GO:0006887]; intracellular protein transport [GO:0006886]	metal ion binding [GO:0046872]; small GTPase binding [GO:0031267]	ISCRVQHDMHK	14.52999973	1425.72925	8.70646	4.726757	6.713434	0	9.763294	16.77517	0	0	13.58428	11.63167	0	0	0	0	0	0	14.55029	0	0	9.141256	0	0	12.40829	0	11.61098	13.62387	13.14196	12.46763	0	0	0	0	0	11.8178	10.4699	12.72299	0	0	11.10655	0	12.71445	0	0	12.31287	0	14.24067	12.42597	9.27562	11.71812	0	0	0	0	0
A0A669F7S7	A0A669F7S7_ORENI	RIMS2	calcium ion-regulated exocytosis of neurotransmitter [GO:0048791]; intracellular protein transport [GO:0006886]; regulation of exocytosis [GO:0017157]	Regulating synaptic membrane exocytosis 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]; presynaptic active zone [GO:0048786]	membrane [GO:0016020]; presynaptic active zone [GO:0048786]; metal ion binding [GO:0046872]; small GTPase binding [GO:0031267]; calcium ion-regulated exocytosis of neurotransmitter [GO:0048791]; intracellular protein transport [GO:0006886]; regulation of exocytosis [GO:0017157]	metal ion binding [GO:0046872]; small GTPase binding [GO:0031267]	KAGGK	6.230000019	459.8976503	14.77675	0	15.0324	16.0644	14.73756	15.18668	15.50997	15.41464	13.40403	0	0	15.71465	14.97643	15.76197	16.20553	15.72125	15.13124	16.12174	15.48007	0	14.74083	0	0	15.71767	14.61248	0	0	16.18757	0	15.75988	16.78279	15.90598	17.35247	16.02725	0	0	15.85028	15.57436	15.4983	15.34958	15.86758	16.14764	16.02313	15.46049	15.17332	0	15.63113	16.05304	15.73593	0	0	0	0	0
I3J059	I3J059_ORENI		signal transduction [GO:0007165]	Regulator of G protein signaling 12a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; dendrite [GO:0030425]	cytoplasm [GO:0005737]; dendrite [GO:0030425]; GTPase activator activity [GO:0005096]; signal transduction [GO:0007165]	GTPase activator activity [GO:0005096]	SNSTMSVSKS	11.21000004	1028.033091	14.50235	14.07278	13.46113	15.00467	14.48569	11.64881	15.60042	15.37444	0	18.47409	13.31223	17.49276	17.80612	17.22479	10.80537	0	11.55356	9.518511	14.13149	15.15335	12.25252	15.05705	14.28524	11.4876	15.39496	12.16675	14.04316	11.97053	0	0	17.05505	15.52351	14.71049	0	16.11818	14.04582	14.02347	14.58161	0	9.638556	0	15.54078	12.87094	15.88383	15.07525	0	13.98259	0	14.54707	0	11.76102	0	15.65282	19.6275
I3KNH6	I3KNH6_ORENI	RTEL1 LOC100709275	DNA recombination [GO:0006310]; DNA repair [GO:0006281]; DNA replication [GO:0006260]; regulation of double-strand break repair via homologous recombination [GO:0010569]; telomere maintenance [GO:0000723]	Regulator of telomere elongation helicase 1 (EC 3.6.4.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; 4 iron, 4 sulfur cluster binding [GO:0051539]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; metal ion binding [GO:0046872]; DNA recombination [GO:0006310]; DNA repair [GO:0006281]; DNA replication [GO:0006260]; regulation of double-strand break repair via homologous recombination [GO:0010569]; telomere maintenance [GO:0000723]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; metal ion binding [GO:0046872]"	APGLKYLSGQDWYK	2.839999914	1626.14093	13.40502	14.54909	13.05469	0	18.51672	14.12953	9.952669	13.52053	0	0	14.36733	0	15.21782	0	16.58173	15.68687	13.79187	15.40348	0	18.09442	0	0	0	0	0	0	0	0	0	0	16.89543	0	14.51966	15.69026	16.19168	0	13.80715	0	0	0	16.15566	17.11696	15.20397	15.72373	13.9837	0	14.50143	17.20599	16.15067	18.10291	15.16083	16.27985	15.78229	0
A0A669AYY1	A0A669AYY1_ORENI	rfc1	DNA repair [GO:0006281]; DNA replication [GO:0006260]	Replication factor C subunit 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	DNA replication factor C complex [GO:0005663]; nucleus [GO:0005634]	DNA replication factor C complex [GO:0005663]; nucleus [GO:0005634]; ATP binding [GO:0005524]; DNA clamp loader activity [GO:0003689]; DNA repair [GO:0006281]; DNA replication [GO:0006260]	ATP binding [GO:0005524]; DNA clamp loader activity [GO:0003689]	KVFASGEETAR	6.579999924	1193.706306	0	13.54305	15.63203	14.87058	14.19915	0	16.50834	14.0401	0	0	15.31761	0	15.55756	0	0	0	8.669463	0	0	0	15.16221	17.6397	0	15.95846	0	13.43555	0	0	0	0	22.69753	22.12059	22.49068	0	0	0	0	12.4887	0	0	0	13.92237	14.72758	12.02729	0	19.77581	12.44452	19.57152	17.24955	15.58429	16.75064	18.9422	18.04539	0
A0A669EUH9	A0A669EUH9_ORENI	RPA1	DNA recombination [GO:0006310]; DNA repair [GO:0006281]; DNA replication [GO:0006260]	Replication protein A subunit	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; DNA recombination [GO:0006310]; DNA repair [GO:0006281]; DNA replication [GO:0006260]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	VSPMKASPMK	12.56999969	1107.198479	0	12.25783	14.18107	0	0	14.4188	0	14.36499	18.12473	17.06985	12.10886	14.45105	14.82617	12.13708	13.83362	14.18283	14.27775	14.05333	15.30469	14.86628	15.97543	13.91678	0	17.51773	15.49659	17.05732	14.89954	10.28673	15.70216	10.97567	0	15.48494	0	0	0	13.82615	0	0	17.7406	14.61097	11.18991	0	0	0	0	0	13.86174	13.67367	14.33898	0	14.56919	13.62868	15.10742	0
A0A669ESZ4	A0A669ESZ4_ORENI			Retinol dehydrogenase 14b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SAPLLIAAVVGGGVLLLMR	16.60000038	1866.710939	0	14.24285	15.91566	15.33453	15.61274	0	13.81812	18.42396	14.58764	15.22458	17.11976	15.70298	17.30616	15.80685	0	0	15.81071	0	15.05619	0	0	16.01739	16.13578	0	0	0	17.031	0	0	15.43184	17.62228	15.8638	18.1733	16.38624	16.24619	0	16.2571	17.27896	15.68453	17.16965	0	0	0	0	0	15.59278	15.67459	0	0	16.69763	15.54888	16.49936	16.23759	17.20466
I3KSW6	I3KSW6_ORENI	LOC100693336	estrogen biosynthetic process [GO:0006703]; response to stimulus [GO:0050896]	Retinol dehydrogenase (EC 1.1.1.300)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; membrane [GO:0016020]	cytoplasm [GO:0005737]; membrane [GO:0016020]; estradiol 17-beta-dehydrogenase activity [GO:0004303]; NADP-retinol dehydrogenase activity [GO:0052650]; estrogen biosynthetic process [GO:0006703]; response to stimulus [GO:0050896]	estradiol 17-beta-dehydrogenase activity [GO:0004303]; NADP-retinol dehydrogenase activity [GO:0052650]	GHIVVISSVMGIQGILFNDIYAASK	5.610000134	2649.17313	0	13.90105	10.75336	0	0	0	0	13.92197	0	0	14.44012	0	0	0	12.94017	13.04503	0	12.73248	11.02896	13.06859	10.86866	0	18.12644	14.03265	11.75923	0	12.81844	0	0	0	11.95194	0	0	12.95362	0	13.6093	12.93848	13.56332	12.00937	0	9.243672	0	0	0	0	10.07544	0	11.86079	14.06925	0	11.48721	0	0	0
A0A669BAN1	A0A669BAN1_ORENI	LOC109203576	DNA integration [GO:0015074]	Reverse transcriptase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		aspartic-type endopeptidase activity [GO:0004190]; nuclease activity [GO:0004518]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]; DNA integration [GO:0015074]	aspartic-type endopeptidase activity [GO:0004190]; nuclease activity [GO:0004518]; nucleic acid binding [GO:0003676]; RNA-directed DNA polymerase activity [GO:0003964]; zinc ion binding [GO:0008270]	LNAVGFR	16.59000015	777.797418	17.06909	16.12538	15.00491	16.136	0	16.01091	0	16.36334	16.52983	0	16.05491	0	15.98589	16.03944	0	0	17.35793	16.62954	17.30958	0	18.26217	0	17.95277	0	17.69592	0	16.47266	0	0	0	0	0	0	0	15.70428	15.24754	16.22276	16.89394	15.70136	0	0	0	16.32945	0	16.73619	17.70754	16.17337	0	21.28319	15.78697	18.64051	0	17.05023	0
A0A669D1X8	A0A669D1X8_ORENI			Reverse transcriptase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		aspartic-type endopeptidase activity [GO:0004190]	aspartic-type endopeptidase activity [GO:0004190]	ACRLDPAK	11.93000031	927.876977	14.83784	15.26398	14.08373	14.68523	15.44421	15.49405	16.38875	15.55616	15.02562	16.01202	15.03903	16.72987	16.51915	16.37539	15.83842	15.52034	15.78587	17.16155	15.79532	16.61037	14.82698	18.80408	17.26168	15.72783	16.39849	16.38422	16.90105	14.38869	16.52856	15.05223	0	15.38325	17.15962	18.2227	16.19779	16.47978	16.25801	14.76613	17.38761	0	0	16.01442	16.48752	14.6554	15.02041	16.98275	16.57325	14.81351	15.15774	18.49187	18.17892	16.02755	0	16.18072
I3KF24	I3KF24_ORENI			Rho GDP dissociation inhibitor (GDI) gamma	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; GTPase activator activity [GO:0005096]; Rho GDP-dissociation inhibitor activity [GO:0005094]	GTPase activator activity [GO:0005096]; Rho GDP-dissociation inhibitor activity [GO:0005094]	QTLLGPEAMMADASGPNVK	7.199999809	1945.043325	13.85655	0	13.4898	15.97935	0	14.38719	0	14.58259	14.59017	15.37384	0	13.98319	13.56792	11.87091	0	14.11516	13.51817	13.83805	0	13.99437	0	0	15.58451	0	0	13.71646	12.646	15.36555	0	0	13.39916	15.94734	0	14.07572	13.06141	12.36625	16.78146	13.19671	14.04934	14.11098	13.02592	11.87348	13.98578	13.30505	0	10.10666	10.50764	11.41369	10.50491	15.94379	14.27289	0	13.3471	0
A0A669DXW9	A0A669DXW9_ORENI		signal transduction [GO:0007165]	Rho GTPase activating protein 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]; signal transduction [GO:0007165]	GTPase activator activity [GO:0005096]	LLNMSSK	27.5	789.6051112	15.63283	11.43715	13.13764	12.34186	13.29447	13.45866	15.92349	16.40981	16.27743	13.50792	12.63768	13.60437	11.04213	13.17333	13.20325	13.15854	10.94642	15.34258	13.70236	15.18701	14.43984	14.33115	12.6771	12.52029	13.90542	14.80414	13.61014	12.66219	10.90931	14.25849	15.67643	14.80452	13.73959	14.26179	13.04753	14.17453	12.67639	15.25708	13.71846	13.97901	16.05732	14.31322	18.10043	14.75479	14.25508	0	13.7921	13.46467	0	0	0	13.7904	14.5673	14.64119
I3KD33	I3KD33_ORENI	ARHGAP28	signal transduction [GO:0007165]	Rho GTPase activating protein 28	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signal transduction [GO:0007165]		VPASAAK	5.210000038	643.512933	16.17717	16.28215	15.8627	15.8131	14.63458	17.53967	16.38989	16.75169	16.59136	16.45249	16.00709	16.88435	17.21926	16.41689	16.57666	16.65189	16.94072	15.61211	17.61867	16.08534	16.53383	16.64338	16.62058	0	16.78432	16.23461	16.9256	0	17.59554	17.4938	17.86857	14.7662	16.54652	16.03263	15.71353	16.93524	16.55845	16.55849	15.39611	15.64289	16.53871	16.67244	17.29137	17.02859	15.51046	16.10621	15.02157	16.32651	15.81051	15.9745	16.39794	17.35665	10.51025	17.4489
I3JYP9	I3JYP9_ORENI		signal transduction [GO:0007165]	Rho GTPase activating protein 32a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		phosphatidylinositol binding [GO:0035091]; signal transduction [GO:0007165]	phosphatidylinositol binding [GO:0035091]	STSEAMSAVSK	1.299999952	1111.508276	13.55318	0	0	13.01166	0	0	0	0	8.965496	17.81221	15.72708	17.69871	0	13.47982	14.55366	9.627154	0	0	0	0	11.22727	0	0	0	17.63608	0	0	0	15.04108	0	14.51827	15.33936	12.94003	14.03235	0	0	13.44416	15.91229	17.52476	17.94586	12.22435	0	14.44851	0	12.67184	0	0	12.32291	13.10013	0	13.17157	0	0	14.49797
I3K1D4	I3K1D4_ORENI		signal transduction [GO:0007165]	Rho GTPase activating protein 36	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signal transduction [GO:0007165]		MGVAVMAVPPGK	4.710000038	1171.82956	13.85704	9.207564	9.831794	13.69725	12.71988	12.27216	13.11024	14.87466	16.41322	13.10965	13.45393	16.82704	13.5795	13.14968	12.42064	12.37314	13.95294	13.97101	12.3796	12.83425	11.57885	10.32995	12.5951	15.4501	14.21403	0	12.82885	0	0	13.69495	0	11.9745	13.56228	13.11329	13.07852	15.20195	0	10.15627	16.46953	0	10.74658	13.85345	11.88051	0	14.3028	13.28351	14.78924	12.45695	10.96192	0	0	12.24446	13.41953	0
I3JLB4	I3JLB4_ORENI		signal transduction [GO:0007165]	Rho GTPase activating protein 39	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]	cytoskeleton [GO:0005856]; signal transduction [GO:0007165]		MDVNNLAMVMAPNCLRCQSDDPR	2.619999886	2738.816543	16.29707	0	0	10.76324	0	0	0	0	0	0	0	0	0	11.45031	0	0	0	0	14.97091	13.52184	0	0	0	0	0	14.32634	0	0	15.54398	0	0	0	0	0	0	0	12.49729	0	10.74969	0	0	0	0	0	0	0	0	0	0	11.78714	0	12.72202	14.20557	0
A0A669EEX7	A0A669EEX7_ORENI		signal transduction [GO:0007165]	Rho GTPase activating protein 44	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; signal transduction [GO:0007165]		DGYDPSVMGVR	4.809999943	1211.315646	11.44712	14.21307	12.38633	0	12.70554	0	13.22507	0	0	0	0	12.20023	0	0	0	0	0	18.14941	11.23686	12.05883	14.32246	15.05358	14.38079	18.57741	15.35549	11.5051	10.74302	14.98878	14.58084	0	13.6312	10.7437	0	13.70926	0	0	0	11.57878	0	0	0	12.79497	9.145647	0	13.89557	13.27388	0	0	14.20049	11.95715	14.66041	9.433178	14.73285	0
A0A669DSY2	A0A669DSY2_ORENI	ARHGAP6	signal transduction [GO:0007165]	Rho GTPase activating protein 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signal transduction [GO:0007165]		LLEALQLSLPEEAAGNTK	4.340000153	1892.114223	16.22154	15.29517	15.33198	15.40628	0	15.68833	17.28943	13.53589	15.69113	14.10348	14.04093	14.12571	14.70139	15.49434	15.76785	15.54338	13.84952	14.27527	15.47084	13.9689	15.44615	15.0021	14.93391	0	17.22608	0	13.17774	14.91344	16.43805	12.86775	13.89868	0	16.06942	14.30702	13.17985	16.01452	15.49863	15.28101	0	13.61932	0	0	15.82499	16.34446	0	15.40018	15.69402	0	15.72385	12.41213	0	0	0	15.1245
A0A669D530	A0A669D530_ORENI	ARHGAP8	signal transduction [GO:0007165]	Rho GTPase activating protein 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signal transduction [GO:0007165]		ELPEPLLTFR	26.18000031	1214.218736	0	0	0	0	20.27977	21.63282	0	0	0	16.91129	0	0	0	0	16.56099	0	0	0	21.08617	0	17.52952	18.03742	0	17.92565	0	16.9926	0	0	0	0	0	0	0	0	0	0	19.54514	0	0	16.84646	0	0	0	0	0	0	14.75427	17.73853	18.1786	18.77345	0	0	0	0
I3JP56	I3JP56_ORENI	ARHGAP26	actin cytoskeleton organization [GO:0030036]; regulation of small GTPase mediated signal transduction [GO:0051056]; signal transduction [GO:0007165]	Rho GTPase-activating protein 26 (Rho-type GTPase-activating protein 26)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]; focal adhesion [GO:0005925]	cytoskeleton [GO:0005856]; focal adhesion [GO:0005925]; GTPase activator activity [GO:0005096]; actin cytoskeleton organization [GO:0030036]; regulation of small GTPase mediated signal transduction [GO:0051056]; signal transduction [GO:0007165]	GTPase activator activity [GO:0005096]	TGLIPENYVEFV	5.710000038	1381.577255	11.68658	11.12684	8.211733	0	0	0	11.91512	0	0	0	0	11.8518	0	11.87692	10.63198	12.62864	0	0	7.403232	10.50407	0	0	15.15874	10.74927	14.11691	14.3379	0	0	9.908916	18.32185	0	14.08152	0	0	0	6.218783	13.69313	0	8.822383	13.62314	0	0	0	9.504307	12.00856	0	0	0	0	0	0	12.34078	0	0
A0A669CVR6	A0A669CVR6_ORENI	LOC100696392	regulation of Rho protein signal transduction [GO:0035023]; signal transduction [GO:0007165]	Rho GTPase-activating protein 7 (Rho-type GTPase-activating protein 7) (START domain-containing protein 12) (StAR-related lipid transfer protein 12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; focal adhesion [GO:0005925]; membrane [GO:0016020]	cytoplasm [GO:0005737]; focal adhesion [GO:0005925]; membrane [GO:0016020]; GTPase activator activity [GO:0005096]; lipid binding [GO:0008289]; regulation of Rho protein signal transduction [GO:0035023]; signal transduction [GO:0007165]	GTPase activator activity [GO:0005096]; lipid binding [GO:0008289]	NNDVNR	2.359999895	731.5548314	14.41604	14.25655	13.882	13.0679	14.37589	13.58198	15.69804	14.45587	15.56915	13.50848	15.43866	14.23193	14.75059	0	11.61407	16.16919	14.04804	13.53115	14.13297	12.01014	14.40734	15.01822	0	0	12.19133	0	15.49889	0	0	0	19.59036	17.98135	15.68194	11.21188	0	14.92754	15.51327	15.18034	0	0	14.17892	11.78188	14.54739	16.39724	13.75031	14.83116	14.65071	15.57678	14.98818	16.63391	0	0	16.42721	15.29319
I3JM01	I3JM01_ORENI			Rho guanine nucleotide exchange factor (GEF) 40	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	HPSFDLQALLAPRR	14.82999992	1621.220393	17.06222	0	0	15.51093	12.79534	0	17.5718	18.48721	18.91419	20.00218	0	16.03849	0	0	16.48169	0	0	15.64382	0	0	18.82466	18.60268	0	0	0	0	20.01033	0	16.94324	0	19.40451	0	0	20.68327	20.65845	0	0	18.15101	21.24973	0	0	15.48634	17.41014	0	0	0	13.97422	0	0	17.05524	17.36974	0	0	0
A0A669CRN4	A0A669CRN4_ORENI		intracellular signal transduction [GO:0035556]	Rho guanine nucleotide exchange factor (GEF) 7b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	lamellipodium [GO:0030027]	lamellipodium [GO:0030027]; guanyl-nucleotide exchange factor activity [GO:0005085]; intracellular signal transduction [GO:0035556]	guanyl-nucleotide exchange factor activity [GO:0005085]	GNGGPPK	5.489999771	626.2500419	0	13.65968	16.86033	16.51563	15.18933	15.6846	14.78478	15.96534	17.0411	15.41092	14.6939	13.99869	15.60197	14.03102	17.49255	14.26172	15.61853	15.16489	16.11806	15.09151	13.79997	16.31115	16.69017	12.76805	13.49251	14.24789	15.71363	17.01158	15.79931	15.06722	0	17.19207	0	0	15.06192	16.00235	0	16.40731	14.1231	15.35262	14.56085	15.61559	15.02498	15.27788	15.8866	18.5824	18.40418	16.32624	15.89701	11.01044	15.82422	16.18339	16.4805	13.36217
I3J9A4	I3J9A4_ORENI	arhgef3	intracellular signal transduction [GO:0035556]; myeloid cell development [GO:0061515]	Rho guanine nucleotide exchange factor 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; guanyl-nucleotide exchange factor activity [GO:0005085]; intracellular signal transduction [GO:0035556]; myeloid cell development [GO:0061515]	guanyl-nucleotide exchange factor activity [GO:0005085]	TLSCHGELK	7.039999962	1044.461187	0	0	16.73021	16.5342	0	0	13.95637	13.63526	14.41866	13.6875	0	14.07128	0	0	0	15.86011	0	16.20711	0	16.08919	15.76208	0	15.30311	0	0	0	14.59334	15.40296	0	0	0	0	0	15.64874	0	0	0	0	0	0	11.80754	13.00111	0	12.21083	0	15.48941	15.98699	14.98188	0	0	0	15.8353	0	0
A0A669E4H5	A0A669E4H5_ORENI	ARHGAP6	signal transduction [GO:0007165]	Rho-GAP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signal transduction [GO:0007165]		ASQSPSP	15.71000004	673.8259986	0	0	15.22037	11.86118	14.00682	13.54679	11.32679	13.37766	14.81576	15.16611	15.46496	15.08679	15.41647	15.83978	0	0	16.30074	15.70656	14.47667	13.09714	15.98265	10.30661	13.34233	15.82458	14.52883	0	14.28902	14.32679	14.90042	14.37941	0	16.11085	17.20314	15.41201	15.6137	15.27166	13.37868	14.97752	0	0	14.91489	15.5377	0	15.16696	13.95409	15.27733	14.93755	14.94212	16.26818	16.26961	15.21349	0	0	0
I3KQN2	I3KQN2_ORENI			Rho/rac guanine nucleotide exchange factor (GEF) 18a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	IINTGTTGEKLK	8.81000042	1274.009164	18.0671	0	17.24994	17.01503	18.14101	16.61378	16.89791	16.08549	15.50662	16.17844	17.50718	17.11165	0	17.57638	16.75712	18.14198	0	0	16.08044	0	0	0	0	0	0	0	15.45591	16.25962	0	0	12.55045	0	14.19929	15.57564	0	0	0	0	0	14.39568	13.87087	0	0	0	0	0	0	0	0	15.53141	0	0	0	0
A0A669ENM5	A0A669ENM5_ORENI	pde6g	response to stimulus [GO:0050896]; visual perception [GO:0007601]	"Rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma (EC 3.1.4.35)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"3',5'-cyclic-GMP phosphodiesterase activity [GO:0047555]; cGMP binding [GO:0030553]; response to stimulus [GO:0050896]; visual perception [GO:0007601]"	"3',5'-cyclic-GMP phosphodiesterase activity [GO:0047555]; cGMP binding [GO:0030553]"	MNLEPPK	9.720000267	829.3513432	0	17.81763	0	0	16.78786	16.86254	0	0	0	18.09514	17.10838	16.9427	17.55571	17.02054	0	0	0	16.92725	0	17.12015	19.22437	0	17.657	0	18.98755	0	16.35494	0	0	17.3968	0	0	17.7388	0	18.62832	0	17.30494	16.15654	17.31503	16.34705	16.40801	0	16.58023	0	17.24988	18.04373	0	0	0	0	0	15.71079	17.66572	16.48025
A0A669BQ23	A0A669BQ23_ORENI	RHBDF2		Rhomboid domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; serine-type endopeptidase activity [GO:0004252]	serine-type endopeptidase activity [GO:0004252]	DAQIVSLIK	2.690000057	987.6916527	14.77729	14.46227	14.59209	14.37959	13.76231	0	13.27316	12.67282	16.0024	13.96655	14.29046	14.84443	0	0	0	0	11.86576	12.5945	11.65189	0	15.14712	0	13.68347	0	12.68101	13.25738	14.2215	13.30282	14.13678	13.28896	13.87827	15.08913	12.70664	12.2284	13.86447	14.74493	10.90131	0	8.448194	0	12.8592	13.31062	0	15.44842	0	14.85996	14.57954	0	14.69483	18.83939	14.92122	0	14.00777	0
I3K162	I3K162_ORENI	RTKN	Rho protein signal transduction [GO:0007266]; septin cytoskeleton organization [GO:0032185]	Rhotekin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		small GTPase binding [GO:0031267]; Rho protein signal transduction [GO:0007266]; septin cytoskeleton organization [GO:0032185]	small GTPase binding [GO:0031267]	IDHEIRMR	3.25	1086.456961	0	14.67033	0	14.96292	0	15.21135	0	14.66589	0	15.38606	12.12833	0	15.33843	14.55597	13.72462	0	15.2944	14.8778	15.03544	0	16.32646	15.63228	14.2915	0	0	0	18.33701	12.44334	16.70882	0	15.48396	15.61259	17.4672	0	11.97762	14.90354	16.38333	12.82834	16.48465	15.30708	12.95769	15.46304	15.36506	13.67451	15.75198	16.07096	15.06796	15.34989	14.83521	15.15034	15.2713	16.45964	17.11738	15.62915
A0A669CPH4	A0A669CPH4_ORENI	ktn1	microtubule-based movement [GO:0007018]; protein transport [GO:0015031]	Rib_recp_KP_reg domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of endoplasmic reticulum membrane [GO:0030176]	integral component of endoplasmic reticulum membrane [GO:0030176]; kinesin binding [GO:0019894]; microtubule-based movement [GO:0007018]; protein transport [GO:0015031]	kinesin binding [GO:0019894]	EAPIVAETK	10.61999989	957.6536511	12.81488	13.34851	14.20988	13.6593	13.63862	16.57642	14.22995	14.0132	11.93634	14.21727	15.33893	14.20732	14.92962	9.604591	13.92279	14.2567	0	16.25677	0	0	12.79001	0	0	15.96655	14.99884	14.62884	14.99817	14.98157	13.66131	0	16.42379	15.83512	14.17626	14.72143	13.08692	13.50318	12.56752	13.65287	14.35307	14.38612	12.43961	13.89646	13.14836	9.051202	0	0	0	14.73341	0	14.2124	14.07234	11.68777	0	16.57079
A0A669AYP5	A0A669AYP5_ORENI		DNA integration [GO:0015074]	Ribonuclease H	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		nucleic acid binding [GO:0003676]; nucleotidyltransferase activity [GO:0016779]; RNA-DNA hybrid ribonuclease activity [GO:0004523]; DNA integration [GO:0015074]	nucleic acid binding [GO:0003676]; nucleotidyltransferase activity [GO:0016779]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	AAPLKEQK	8.670000076	885.1706287	16.6177	14.55579	16.02612	0	0	0	0	0	15.41313	0	0	15.99965	0	0	16.42196	16.01274	13.0514	0	0	0	15.12409	16.90041	15.7363	0	0	0	0	0	14.33718	13.3971	17.874	15.37393	16.91036	11.09865	14.93202	0	0	15.00613	14.06888	0	13.53772	0	15.22931	0	0	0	0	0	0	0	0	0	16.23702	0
I3JHR4	I3JHR4_ORENI	rnaseh2b		Ribonuclease H2 subunit B (Ribonuclease HI subunit B)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]; ribonuclease H2 complex [GO:0032299]	nucleus [GO:0005634]; ribonuclease H2 complex [GO:0032299]		DEEFPACSR	6.269999981	1111.336579	13.19185	13.94624	14.29148	13.95553	13.30797	0	13.37626	14.69082	0	14.91218	17.09316	17.69723	0	17.09117	13.6822	14.97399	15.2294	14.23768	15.38452	0	0	14.5162	0	14.91874	0	0	12.95697	15.01169	15.05834	13.96821	18.90478	0	0	0	0	14.19886	0	0	0	14.81813	0	0	14.35012	0	0	0	0	11.22633	0	19.06645	14.39664	0	14.62557	14.45352
I3KXC6	I3KXC6_ORENI		tRNA 5'-leader removal [GO:0001682]	Ribonuclease P/MRP 38 subunit	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		tRNA 5'-leader removal [GO:0001682]		DKLISMGLEK	10.97999954	1149.801624	15.44064	0	0	12.03241	15.33963	0	12.49346	0	0	0	15.92012	14.39262	14.73532	14.23545	13.81913	0	0	15.3837	13.14081	13.63774	0	11.86777	15.12615	0	13.02218	14.88112	0	15.39804	0	14.8391	15.24512	0	15.90331	0	0	12.68161	0	0	14.4628	0	0	0	0	0	0	0	0	13.9149	0	0	14.78378	14.37704	15.31021	0
B3IUN6	B3IUN6_ORENI	L32	translation [GO:0006412]	Ribosomal protein L32	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ribosome [GO:0005840]	ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	KPRGIDNR	2.579999924	955.8945695	14.06044	15.47875	16.55817	14.98401	14.37037	14.87809	0	14.14114	15.09688	15.64028	0	0	15.66887	14.59171	15.18731	15.69886	15.07201	15.9309	16.2724	0	0	0	16.31312	0	0	0	0	0	15.11616	0	0	0	0	0	0	0	0	0	15.44506	14.45518	14.99005	0	0	0	14.93079	0	0	0	0	0	0	0	0	0
I3JKS5	I3JKS5_ORENI	rpl37	translation [GO:0006412]	Ribosomal protein L37	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ribosome [GO:0005840]	ribosome [GO:0005840]; metal ion binding [GO:0046872]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	metal ion binding [GO:0046872]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]	MTKGTSSFGK	8.399999619	1059.959836	0	15.63664	0	15.07598	0	16.06708	15.7313	0	15.99458	13.74845	0	16.18952	16.24685	0	0	15.42606	0	16.06086	0	0	0	14.41203	0	0	0	17.24838	0	0	0	16.04816	0	0	14.19188	16.25003	16.25501	16.06654	0	0	15.25738	15.13836	0	0	16.35063	0	0	0	0	0	0	0	0	14.98678	0	0
A0A669AW50	A0A669AW50_ORENI		intracellular signal transduction [GO:0035556]	Ribosomal protein S6 kinase (EC 2.7.11.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; intracellular signal transduction [GO:0035556]	ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	DVYDEGR	4.789999962	852.891282	13.69947	13.56769	0	12.89217	0	13.37477	14.95272	13.27102	15.40378	14.00331	12.60388	14.11247	14.05937	14.48981	14.46479	0	0	13.21833	0	16.17953	15.56351	13.19264	15.354	13.53748	14.72632	0	14.55559	15.60968	13.57435	14.17212	0	0	0	16.58875	0	15.26095	13.57604	10.72534	15.18625	15.25143	12.51841	12.59699	13.55269	0	11.38591	0	15.44007	15.30904	14.3907	14.06658	15.01681	8.971096	14.44164	15.94804
A0A669D4A1	A0A669D4A1_ORENI	mrps10	translation [GO:0006412]	Ribosomal_S10 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial small ribosomal subunit [GO:0005763]	mitochondrial small ribosomal subunit [GO:0005763]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	structural constituent of ribosome [GO:0003735]	SLKNMASLMVR	2.289999962	1281.35597	15.61992	13.75985	14.20452	13.2804	12.40122	14.73214	11.19623	13.64465	13.37386	11.33921	0	14.40622	13.50403	13.18423	11.50311	13.70718	9.459007	0	12.50332	12.70694	0	8.981568	12.52926	14.04771	13.14805	0	0	10.95384	14.023	13.36374	0	0	0	14.18466	13.57934	12.50289	13.54397	14.19182	0	0	0	0	13.18702	13.11431	13.06222	15.04964	0	0	11.46621	13.80647	14.78814	14.92023	0	0
A0A669B4G8	A0A669B4G8_ORENI	bop1 BOP1	"maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000466]; maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463]"	Ribosome biogenesis protein BOP1 (Block of proliferation 1 protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; preribosome, large subunit precursor [GO:0030687]"	"nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; preribosome, large subunit precursor [GO:0030687]; ribonucleoprotein complex binding [GO:0043021]; maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000466]; maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463]"	ribonucleoprotein complex binding [GO:0043021]	CMKMVQVGGAVK	7.329999924	1320.533828	12.56319	10.57147	10.79159	12.36896	14.06203	0	12.77345	12.4013	11.1232	11.98984	9.580481	0	0	0	12.95512	11.45152	0	12.86062	0	12.9874	13.08195	0	10.68906	17.89357	13.61369	13.22113	13.4066	0	0	12.42807	0	11.3133	0	0	0	0	13.32981	0	0	0	0	0	11.38428	0	0	10.44998	0	0	0	0	0	0	0	0
A0A669CFC0	A0A669CFC0_ORENI	nop53	ribosomal large subunit assembly [GO:0000027]	Ribosome biogenesis protein NOP53	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; ribosomal large subunit assembly [GO:0000027]		ISESNSTGSQK	8.43999958	1136.47799	14.17086	13.89773	18.39002	0	0	0	11.64343	11.35261	12.38808	0	0	12.19434	0	0	12.17216	13.91706	10.255	0	14.35312	11.9601	0	19.58544	0	0	18.4376	17.62376	14.20447	14.77301	9.509895	16.3641	0	0	13.0916	9.890589	18.20753	11.357	0	0	11.6904	0	12.1528	0	13.94971	13.06465	10.23179	0	0	0	0	0	0	15.71439	0	0
I3JN16	I3JN16_ORENI	LOC100696766		Rieske domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"2 iron, 2 sulfur cluster binding [GO:0051537]; flavin adenine dinucleotide binding [GO:0050660]; metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]"	"2 iron, 2 sulfur cluster binding [GO:0051537]; flavin adenine dinucleotide binding [GO:0050660]; metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]"	DDVVVAAASLMFDPAVAR	6.690000057	1861.951275	0	14.62328	0	13.19841	13.40989	14.10387	0	13.63108	14.20696	16.07956	11.65663	15.3689	13.55611	14.97894	13.64125	0	0	14.20098	16.3562	15.11152	14.99321	15.64234	12.92344	0	16.56953	0	15.04869	0	15.62617	12.50282	15.47554	0	15.585	15.24318	15.57325	15.23001	0	13.84213	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669BIV0	A0A669BIV0_ORENI	rif1	cell cycle [GO:0007049]	Rif1_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]"	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]; cell cycle [GO:0007049]"		LRAAAAMEMGMPLLLEK	8.529999733	1894.952822	10.53052	9.962804	0	12.3867	0	13.92198	13.40897	6.9401	0	12.54673	14.55269	12.26041	0	11.47035	14.92084	0	12.47276	0	9.858027	0	13.53791	13.35703	14.87786	16.11034	11.47829	0	14.21973	13.29253	0	15.44827	13.8956	0	10.91101	0	0	14.5373	0	0	0	12.39336	0	0	0	0	0	0	0	0	0	0	0	15.38505	0	0
A0A669BN85	A0A669BN85_ORENI			Ring finger protein 220a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ATALLEGGFR	19.76000023	1035.205566	14.82453	0	14.59152	14.97547	16.48964	16.07366	16.74971	0	0	0	0	0	0	0	15.28896	0	0	0	13.26526	0	0	0	0	0	0	0	0	0	0	0	0	0	17.98459	0	0	0	0	0	16.1803	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669EUA1	A0A669EUA1_ORENI		cilium organization [GO:0044782]	Rotatin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	centrosome [GO:0005813]; ciliary basal body [GO:0036064]	centrosome [GO:0005813]; ciliary basal body [GO:0036064]; cilium organization [GO:0044782]		LTVEILR	12.48999977	842.2874782	12.68692	0	0	14.99931	14.35849	14.83716	15.2043	14.1576	15.4508	15.3833	15.84357	16.9187	16.6575	15.82385	14.67303	16.1003	17.61796	16.93439	15.37508	14.83993	16.63851	16.22191	17.28829	18.14903	17.05315	15.68306	15.73189	16.11754	16.1664	15.51974	19.08514	18.7037	18.68105	17.2135	12.47995	0	0	14.59386	15.20745	15.9017	0	0	16.47792	0	16.44968	15.43698	15.34109	0	19.65615	19.324	17.95544	0	17.19285	0
A0A669CDY2	A0A669CDY2_ORENI		axon midline choice point recognition [GO:0016199]; Roundabout signaling pathway [GO:0035385]	"Roundabout, axon guidance receptor, homolog 1 (Drosophila)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; axon guidance receptor activity [GO:0008046]; axon midline choice point recognition [GO:0016199]; Roundabout signaling pathway [GO:0035385]	axon guidance receptor activity [GO:0008046]	GVRTPK	6.170000076	657.1862488	16.10312	15.99814	13.731	16.13008	0	16.15931	0	16.35326	16.8125	16.79093	16.67714	16.04555	0	17.40853	16.75026	16.96553	16.15934	17.17154	17.12868	0	0	16.96029	16.22053	0	16.5607	0	17.32249	15.46624	0	17.72303	16.70847	16.41364	16.88414	16.57897	16.65312	17.53396	0	0	15.95803	0	16.05087	0	17.34014	16.03193	15.4656	15.41376	15.52595	17.52443	15.61865	0	15.60064	16.86748	18.62752	16.80692
A0A669C345	A0A669C345_ORENI			"Roundabout, axon guidance receptor, homolog 2 (Drosophila)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		SDAGMYICVGTNMVGER	7.579999924	1876.629885	14.77256	0	15.62071	14.45009	0	16.64665	15.91075	16.77932	12.58945	15.13244	15.3667	13.6579	13.37051	15.53456	15.23439	0	0	0	0	0	16.25431	0	0	0	0	0	0	0	0	14.87697	0	0	0	0	0	0	0	16.09119	0	0	13.54048	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KFG7	I3KFG7_ORENI		angiogenesis [GO:0001525]; axon guidance [GO:0007411]; cell adhesion [GO:0007155]; endothelial cell migration [GO:0043542]; filopodium assembly [GO:0046847]; lamellipodium assembly [GO:0030032]; positive regulation of cell-matrix adhesion [GO:0001954]; positive regulation of Rac protein signal transduction [GO:0035022]; regulation of cell migration [GO:0030334]	"Roundabout, axon guidance receptor, homolog 4 (Drosophila)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; intrinsic component of plasma membrane [GO:0031226]	integral component of membrane [GO:0016021]; intrinsic component of plasma membrane [GO:0031226]; angiogenesis [GO:0001525]; axon guidance [GO:0007411]; cell adhesion [GO:0007155]; endothelial cell migration [GO:0043542]; filopodium assembly [GO:0046847]; lamellipodium assembly [GO:0030032]; positive regulation of cell-matrix adhesion [GO:0001954]; positive regulation of Rac protein signal transduction [GO:0035022]; regulation of cell migration [GO:0030334]		LIIAPAEK	18.28000069	854.6885949	14.26618	14.30769	0	0	14.36509	14.36776	15.43318	15.22304	15.1559	16.51935	13.19063	13.79718	15.37651	0	15.33509	16.91598	17.68225	16.33777	15.10733	17.85258	16.27283	16.82283	17.59176	16.3657	16.88766	15.14578	17.15246	0	15.85766	16.3258	16.41903	17.585	15.61444	14.49288	14.17284	15.2835	16.06249	15.29125	15.30735	15.10585	0	13.76956	16.43598	0	16.78897	0	16.76703	0	16.66953	16.95816	18.49729	16.1641	17.25247	16.23703
I3KS74	I3KS74_ORENI	ruvbl1	DNA recombination [GO:0006310]; DNA repair [GO:0006281]	RuvB-like helicase (EC 3.6.4.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Ino80 complex [GO:0031011]; NuA4 histone acetyltransferase complex [GO:0035267]; R2TP complex [GO:0097255]	Ino80 complex [GO:0031011]; NuA4 histone acetyltransferase complex [GO:0035267]; R2TP complex [GO:0097255]; 5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; DNA recombination [GO:0006310]; DNA repair [GO:0006281]	5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]	AQTEGISISEEALTHLAEIGTK	14.72999954	2298.820532	15.21795	0	0	13.48558	15.19464	14.78407	0	16.74404	0	0	14.66471	15.72425	0	14.18866	0	0	0	0	0	16.47097	11.8327	14.58219	18.99819	0	15.17739	15.62929	14.93423	0	15.54961	0	14.26654	15.57637	15.74579	0	15.15124	16.16971	0	15.60969	15.7518	12.81749	9.328417	14.71379	16.02343	0	0	12.16452	13.27704	0	14.35007	15.31732	20.88119	0	0	0
A0A669D986	A0A669D986_ORENI			Ryanodine receptor 1b (skeletal)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; sarcoplasmic reticulum membrane [GO:0033017]	integral component of membrane [GO:0016021]; sarcoplasmic reticulum membrane [GO:0033017]; calmodulin binding [GO:0005516]; ryanodine-sensitive calcium-release channel activity [GO:0005219]	calmodulin binding [GO:0005516]; ryanodine-sensitive calcium-release channel activity [GO:0005219]	KVILHQEGHMDDALTVSR	5.599999905	2064.812098	12.31734	11.20316	12.62406	18.13431	13.2426	0	13.42458	14.80343	13.08566	0	10.94139	10.9268	12.81063	13.80449	14.79672	0	11.6277	13.4064	14.34593	0	13.01114	0	11.69845	11.51858	12.2574	14.69787	12.07491	13.84292	0	13.81653	0	14.8249	13.99548	13.54613	0	14.70651	0	11.31077	13.95971	16.99553	10.04623	10.24156	17.52568	11.13885	13.39082	15.56185	11.60508	0	10.3266	13.38037	0	0	0	0
A0A669CIB8	A0A669CIB8_ORENI	RYR2		Ryanodine receptor 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; sarcoplasmic reticulum membrane [GO:0033017]	integral component of membrane [GO:0016021]; sarcoplasmic reticulum membrane [GO:0033017]; calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516]; ryanodine-sensitive calcium-release channel activity [GO:0005219]	calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516]; ryanodine-sensitive calcium-release channel activity [GO:0005219]	EPDLEK	2.529999971	730.4756083	14.9491	11.87164	14.90505	0	16.02369	14.20284	0	0	13.91124	16.56908	0	0	16.16058	15.13711	15.83666	16.84576	16.37149	0	17.279	15.80237	14.93613	17.24642	16.45901	16.54628	0	15.09114	0	15.70988	16.73821	16.60289	0	17.96468	16.94135	15.82817	15.31968	14.19261	0	15.5709	16.64271	13.97122	14.48018	15.88707	16.22729	17.06123	15.62228	15.95147	15.7515	16.22723	16.26474	17.06204	17.29537	16.6539	0	0
I3K269	I3K269_ORENI	RYR3		Ryanodine receptor 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; sarcoplasmic reticulum membrane [GO:0033017]	integral component of membrane [GO:0016021]; sarcoplasmic reticulum membrane [GO:0033017]; calmodulin binding [GO:0005516]; ryanodine-sensitive calcium-release channel activity [GO:0005219]	calmodulin binding [GO:0005516]; ryanodine-sensitive calcium-release channel activity [GO:0005219]	MPITNK	16.29000092	702.942943	10.16983	18.33823	0	15.41805	14.28516	14.85456	16.64365	0	0	0	18.18678	0	16.06981	15.52399	0	0	0	17.69745	0	17.49299	17.36329	0	16.652	0	18.16885	17.20848	16.11886	0	0	0	0	0	0	16.75092	0	0	15.57929	17.17289	16.08222	0	16.39668	16.16755	0	0	16.76887	0	0	0	0	0	0	0	15.82866	0
A0A669FCH2	A0A669FCH2_ORENI		ethanol oxidation [GO:0006069]	S-(hydroxymethyl)glutathione dehydrogenase (EC 1.1.1.284)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		alcohol dehydrogenase (NAD+) activity [GO:0004022]; S-(hydroxymethyl)glutathione dehydrogenase NAD activity [GO:0106322]; S-(hydroxymethyl)glutathione dehydrogenase NADP activity [GO:0106321]; zinc ion binding [GO:0008270]; ethanol oxidation [GO:0006069]	alcohol dehydrogenase (NAD+) activity [GO:0004022]; S-(hydroxymethyl)glutathione dehydrogenase NAD activity [GO:0106322]; S-(hydroxymethyl)glutathione dehydrogenase NADP activity [GO:0106321]; zinc ion binding [GO:0008270]	TVALHP	7.619999886	636.191736	15.24244	16.40551	15.07812	15.67959	15.98917	17.1709	17.27872	17.01782	0	17.40869	17.11581	17.65932	17.1677	16.62128	0	17.7255	16.11003	0	17.40474	15.12153	15.97926	15.50238	17.06827	0	16.22046	16.35672	16.19508	17.18624	17.40826	0	18.34855	17.46729	16.66654	17.6188	0	15.57031	16.11406	17.55604	16.9127	15.71598	17.30985	17.50745	17.65648	15.53661	16.33216	18.47597	17.21622	17.29864	16.99544	17.28576	16.52148	17.72877	18.00921	17.95655
A0A669DN12	A0A669DN12_ORENI		one-carbon metabolic process [GO:0006730]; S-adenosylmethionine biosynthetic process [GO:0006556]	S-adenosylmethionine synthase (EC 2.5.1.6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; metal ion binding [GO:0046872]; methionine adenosyltransferase activity [GO:0004478]; one-carbon metabolic process [GO:0006730]; S-adenosylmethionine biosynthetic process [GO:0006556]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; methionine adenosyltransferase activity [GO:0004478]	VLMEMVIK	8.149999619	978.6978365	11.78926	13.49442	13.41549	14.96469	14.27544	13.95575	14.13123	14.42819	12.89449	0	12.86498	12.66557	13.5166	14.13384	0	0	9.139438	14.92263	14.00271	13.95349	0	0	0	0	0	0	0	0	0	15.45046	0	17.18754	14.03136	0	14.03842	0	0	13.26914	13.59162	9.769491	0	0	0	0	0	0	14.27225	0	16.6996	15.66362	15.11685	0	0	14.36981
I3KGY7	I3KGY7_ORENI	esd	formaldehyde catabolic process [GO:0046294]	S-formylglutathione hydrolase (EC 3.1.2.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; carboxylic ester hydrolase activity [GO:0052689]; S-formylglutathione hydrolase activity [GO:0018738]; formaldehyde catabolic process [GO:0046294]	carboxylic ester hydrolase activity [GO:0052689]; S-formylglutathione hydrolase activity [GO:0018738]	MSISGHSMGGHGAIICALK	9.829999924	1942.640266	15.75743	14.21848	0	0	0	14.13272	13.15306	16.53621	11.7398	14.30954	0	0	11.62261	12.75969	14.41932	12.67622	13.49757	0	12.26864	0	0	0	11.05278	12.26721	15.61333	13.21119	0	11.41446	9.60349	13.8422	14.42766	0	15.90314	0	0	0	13.3422	0	0	10.69233	13.56888	0	9.696144	16.57712	12.53111	0	13.22889	17.82788	0	15.01308	0	13.82921	12.41672	13.48222
I3KLX3	I3KLX3_ORENI	MTAP mtap	L-methionine salvage from methylthioadenosine [GO:0019509]; purine ribonucleoside salvage [GO:0006166]	S-methyl-5'-thioadenosine phosphorylase (EC 2.4.2.28) (5'-methylthioadenosine phosphorylase) (MTA phosphorylase) (MTAP) (MTAPase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; S-methyl-5-thioadenosine phosphorylase activity [GO:0017061]; L-methionine salvage from methylthioadenosine [GO:0019509]; purine ribonucleoside salvage [GO:0006166]	S-methyl-5-thioadenosine phosphorylase activity [GO:0017061]	NVDCVLLAR	2.930000067	1060.167896	0	0	16.54878	15.35834	15.05352	14.46681	14.02414	16.24668	0	0	16.10325	15.25262	16.20066	16.60557	15.63996	13.49521	15.85597	16.97093	15.50362	12.28605	0	16.27084	14.05667	0	15.73066	0	0	0	12.53385	0	0	0	0	0	0	14.90939	0	0	0	14.82951	0	15.38619	0	0	0	17.02621	16.87049	16.22042	16.02524	0	0	0	0	0
I3IXW6	I3IXW6_ORENI	mrps5	translation [GO:0006412]	S5 DRBM domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840]	ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840]; RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]	RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]	VLQNSKMAASIGVCCALR	5.730000019	1994.582868	12.56294	0	11.31446	0	0	14.18275	0	15.95059	10.1235	0	0	15.20033	14.35298	16.03388	16.03595	0	0	0	0	0	13.95731	16.05975	0	0	14.83397	12.96458	14.31576	13.43721	15.67673	0	9.966652	0	0	0	0	16.66829	0	12.16503	0	13.45265	13.3137	18.02151	0	14.57858	12.47407	12.80954	14.21144	0	0	0	16.94147	0	17.92025	0
A0A669DA83	A0A669DA83_ORENI			SAM and SH3 domain containing 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DPDSLTTSPSSSSVDTCSSQK	2.559999943	2186.293689	0	0	12.07541	12.03262	10.8484	0	12.45318	16.79386	0	16.56735	17.05133	16.34627	0	16.37488	0	14.8453	16.24112	0	0	0	15.63055	19.18737	19.11498	14.91767	13.46664	15.25713	17.663	0	12.47835	0	18.03052	16.55658	0	0	14.38703	0	0	0	14.50451	0	15.7739	14.78617	15.9508	12.65087	15.34943	0	0	19.39163	17.36567	0	12.15541	19.19169	12.64879	21.00779
I3JBG7	I3JBG7_ORENI	LOC100700004	multicellular organism development [GO:0007275]	SAM domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]; multicellular organism development [GO:0007275]	RNA binding [GO:0003723]	KMLLAISGESR	7.329999924	1221.254273	15.05256	11.3878	14.92288	0	14.75082	13.35622	14.34108	13.25266	13.45183	0	11.28687	0	13.85817	0	0	0	13.71184	0	15.91332	0	0	16.48619	16.72371	14.37644	13.70075	14.67451	15.73335	11.83411	11.8254	0	14.29361	0	15.26667	0	0	0	0	0	0	0	13.79529	13.94265	0	12.92813	14.52187	0	0	10.54118	0	15.091	0	14.40523	0	12.52028
I3JR99	I3JR99_ORENI		methylation [GO:0032259]	SAM_MT_RSMB_NOP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		methyltransferase activity [GO:0008168]; RNA binding [GO:0003723]; methylation [GO:0032259]	methyltransferase activity [GO:0008168]; RNA binding [GO:0003723]	AQETSK	1.210000038	664.5151316	14.23377	10.66865	10.84108	0	15.00067	13.72982	14.80419	14.93638	14.31899	14.96867	13.55901	13.90259	13.78025	11.98325	14.65124	15.21437	15.4148	11.69801	0	0	0	17.18922	11.91572	16.19865	0	16.04136	11.21978	11.96101	14.90344	10.87573	17.34611	17.65246	17.10833	15.39126	0	14.73814	15.0504	13.93222	13.65714	14.24633	0	15.08381	0	15.59399	15.26123	14.55772	14.99529	14.52468	0	17.50005	15.18934	14.83831	14.59878	14.13121
A0A669DTJ9	A0A669DTJ9_ORENI	bdp1		SANT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TMQSNSQSTK	3.00999999	1125.52191	0	0	13.14207	14.16013	0	0	0	12.89868	11.76412	0	0	14.07349	0	0	14.93275	13.61014	17.87646	16.38269	17.68535	14.93402	14.34996	0	15.79651	18.51137	16.0695	0	15.54116	0	0	0	12.64347	12.59117	0	0	0	0	12.95239	0	12.21967	14.57037	0	0	0	0	0	0	0	14.45199	14.7996	0	0	0	13.14178	15.30577
A0A669E1D1	A0A669E1D1_ORENI	mrtfa	positive regulation of transcription via serum response element binding [GO:0010735]	SAP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; actin monomer binding [GO:0003785]; transcription coactivator activity [GO:0003713]; positive regulation of transcription via serum response element binding [GO:0010735]	actin monomer binding [GO:0003785]; transcription coactivator activity [GO:0003713]	ERPPQMDSSYAK	1.570000052	1423.791475	12.41853	15.51476	13.67155	0	0	0	15.80336	14.31745	11.5217	14.76031	15.22428	0	14.71478	14.99818	13.89865	15.48252	14.77648	14.36659	15.90629	16.67874	16.53786	0	16.30195	16.62599	14.77426	15.31116	15.31142	12.96795	0	15.42498	16.40959	15.80001	15.0332	14.4946	15.39707	0	14.96179	15.19327	13.88978	0	14.90976	16.6567	15.38846	0	15.32644	0	15.73306	0	17.26124	0	16.68422	16.35281	0	0
A0A669CKV6	A0A669CKV6_ORENI	sap130	"regulation of transcription, DNA-templated [GO:0006355]"	SAP130_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; regulation of transcription, DNA-templated [GO:0006355]"		DTMMKVLDHK	5.019999981	1218.664435	10.87842	0	0	14.18266	12.41308	12.73064	0	10.56307	12.53914	0	11.9463	14.60555	0	0	0	0	14.75051	16.24312	11.86665	14.40045	12.16077	0	12.51729	12.77826	0	0	0	0	14.92631	10.82537	0	15.66165	13.59097	9.567882	15.25187	10.21332	0	12.49978	8.602705	14.253	15.03918	11.23088	14.25213	0	0	15.64595	0	0	0	16.76161	0	0	0	15.21249
I3JA23	I3JA23_ORENI		chromatin remodeling [GO:0006338]	SATB homeobox 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		DNA binding [GO:0003677]; chromatin remodeling [GO:0006338]	DNA binding [GO:0003677]	AEGCDLAVDPRPPPAKLAR	6.010000229	2033.552166	15.26344	0	12.9404	0	12.48358	0	0	0	10.70052	8.501762	13.16955	13.29388	12.92065	14.55272	0	0	13.67866	0	0	0	0	13.96616	13.11112	0	13.62124	11.15076	0	12.91812	13.02058	0	13.49369	14.66485	0	0	9.58976	0	0	12.89032	15.12064	13.8866	0	0	0	0	0	9.96638	0	14.16179	12.91962	0	0	12.53997	13.03534	9.278081
I3JQ14	I3JQ14_ORENI	LOC100707057		SCA7 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LRSPTPAPQTQQR	12.82999992	1480.90784	13.72806	0	13.29833	15.0574	10.84636	14.55535	15.01655	14.25168	14.30764	11.567	15.30332	11.63035	13.11272	14.6624	11.60979	0	13.1896	0	11.38625	0	0	0	0	0	15.34983	12.94053	13.35585	14.02231	14.07018	0	0	17.32029	0	0	0	0	0	0	15.38563	0	0	0	0	0	14.5928	0	0	0	0	0	0	15.08505	0	0
A0A669F948	A0A669F948_ORENI			SCAN box domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KMEVEAETAVK	26.54999924	1234.840908	19.59356	19.79883	18.75071	19.79465	18.91577	16.97643	19.56481	0	18.55031	20.11276	19.54231	19.37552	19.78163	15.6718	18.47559	19.14704	18.67321	15.08694	17.14351	18.67894	18.98443	18.60703	18.04936	0	14.33875	0	18.55626	18.85833	17.07586	0	15.61635	14.74533	14.39103	17.14843	20.03787	19.32876	17.53479	19.09285	18.82402	0	20.41041	10.4352	0	0	0	0	21.62322	20.56853	18.73214	19.86948	19.22216	18.10191	18.13761	18.34086
I3JID1	I3JID1_ORENI	LOC100692362		SCD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DSEVSVQTMK	7.340000153	1140.121772	11.1983	0	14.76865	14.37287	13.08725	13.63389	15.37319	13.8598	16.12788	16.28375	17.53198	17.19972	0	15.4911	16.07544	15.52523	0	10.46645	14.55832	14.9689	16.55327	18.01182	0	15.00587	16.33984	0	14.97426	15.76256	0	17.20912	0	14.28595	0	0	0	14.35034	12.83128	0	0	0	19.1641	14.12812	0	16.48346	0	0	16.8705	0	0	15.19254	0	0	0	0
A0A669C6U8	A0A669C6U8_ORENI			SCP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]		NVLPKGTGNTHTHFLFYLK	5.570000172	2186.132342	11.48924	0	10.29006	15.40079	0	10.48398	12.61797	14.77676	0	6.479484	12.9885	14.16278	6.919751	11.49365	0	0	0	12.21187	11.76093	0	13.20829	0	13.50738	15.5097	14.87238	0	12.85251	0	11.58983	18.183	14.41225	0	12.32962	9.702228	0	14.12074	14.68175	0	12.59987	12.29389	10.63058	14.6386	13.42742	0	13.86365	13.21838	0	0	0	14.22112	13.67455	15.1172	0	10.04853
I3JXS4	I3JXS4_ORENI	LOC100710115	immune response [GO:0006955]	SCY domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]	extracellular space [GO:0005615]; chemokine activity [GO:0008009]; immune response [GO:0006955]	chemokine activity [GO:0008009]	GKVVSYIK	6.769999981	893.8118418	14.11038	14.82147	14.02884	14.88791	16.38478	0	0	0	17.35309	16.31899	17.5382	0	16.5094	16.38208	15.77135	15.51799	15.38598	13.28369	13.44403	15.48435	17.01722	0	16.8293	16.5702	13.16881	15.90572	16.58803	15.86628	17.63552	16.89752	17.46707	16.80128	16.9973	16.66195	16.05953	17.52376	17.5857	17.63377	15.42563	17.57085	17.12329	14.87864	17.62673	16.60179	16.59489	16.94227	17.87452	16.92279	16.58243	15.12587	16.46355	17.79582	17.44305	16.3733
A0A669DV65	A0A669DV65_ORENI	usp5	protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cysteine-type peptidase activity [GO:0008234]; thiol-dependent ubiquitin-specific protease activity [GO:0004843]; zinc ion binding [GO:0008270]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	cysteine-type peptidase activity [GO:0008234]; thiol-dependent ubiquitin-specific protease activity [GO:0004843]; zinc ion binding [GO:0008270]	DGPGK	2.059999943	470.4321122	15.68216	15.49714	14.48957	13.73033	15.8439	16.97408	14.99928	17.05153	0	0	15.4157	16.76988	15.28349	13.04082	16.15981	15.81753	13.49413	14.36623	13.17898	15.44683	15.93096	16.73371	14.59888	16.43769	16.44326	15.4197	0	15.22592	0	0	0	16.82945	0	16.49494	0	17.09702	14.65218	0	15.29649	0	0	14.75344	15.58208	0	16.3212	0	14.24271	15.15068	16.11192	0	16.09834	16.07303	16.71163	15.43668
A0A669DPI2	A0A669DPI2_ORENI	SCYL2		SCY1 like pseudokinase 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	CTFSHK	2.910000086	779.0656918	0	0	0	13.2671	0	14.56219	15.14926	15.01719	14.70418	0	0	0	16.63321	14.3329	0	17.2356	0	12.38755	0	17.26015	15.84709	19.57143	16.71971	16.45078	0	17.05623	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.63401	0	0	0	0	16.82482	15.02527	16.94112
A0A669BHW0	A0A669BHW0_ORENI		visual perception [GO:0007601]	SEA domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell projection [GO:0042995]; extracellular region [GO:0005576]; interphotoreceptor matrix [GO:0033165]	cell projection [GO:0042995]; extracellular region [GO:0005576]; interphotoreceptor matrix [GO:0033165]; extracellular matrix structural constituent [GO:0005201]; heparin binding [GO:0008201]; hyaluronic acid binding [GO:0005540]; visual perception [GO:0007601]	extracellular matrix structural constituent [GO:0005201]; heparin binding [GO:0008201]; hyaluronic acid binding [GO:0005540]	NLWENQTHAELHLML	1.309999943	1865.40993	0	12.85373	0	0	13.85338	14.8585	13.69503	14.69154	0	0	16.25583	0	12.41297	0	0	14.28253	0	0	13.94858	0	12.89577	13.92552	13.52045	0	0	13.12325	13.63475	0	0	0	0	14.66811	13.98058	0	11.8612	14.76297	14.22499	12.64641	15.25445	12.42238	11.15942	0	12.81854	12.51631	12.31422	0	0	0	0	0	9.256728	0	0	15.29525
A0A669CJ11	A0A669CJ11_ORENI	SEC14L1		SEC14 like lipid binding 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DFNMDK	8.630000114	770.2390043	12.97514	7.299452	12.63228	14.07653	12.09322	12.76051	0	14.00419	14.87912	16.56426	13.33243	14.34381	11.38981	15.57591	13.00591	13.53495	13.35069	13.02705	13.82741	13.30159	14.74385	13.85701	16.11019	14.5039	12.21927	12.97419	14.31249	13.32522	16.90744	14.56614	16.10901	16.13268	10.97802	0	10.1851	9.570543	14.50056	15.22901	15.29754	13.33714	15.26338	0	14.62003	13.64821	0	0	0	15.10889	0	15.16274	14.94073	17.12014	13.91132	0
A0A669DT49	A0A669DT49_ORENI			SEC14-like lipid binding 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VNLEPK	7.940000057	699.1310073	18.56447	16.85271	18.10201	18.49365	0	16.22056	18.49962	15.05885	17.29639	16.96342	18.28264	0	15.61771	13.52325	16.32725	0	0	0	16.60474	0	0	16.5277	0	16.91918	18.65877	17.83364	0	15.54171	0	0	18.70018	16.78517	16.9832	17.08824	14.56228	0	0	0	17.12487	0	14.4404	0	0	0	0	0	0	0	0	0	18.67087	0	18.67197	19.49376
A0A669DGB4	A0A669DGB4_ORENI		endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; intracellular protein transport [GO:0006886]	"SEC24 homolog C, COPII coat complex component"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	COPII vesicle coat [GO:0030127]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]	COPII vesicle coat [GO:0030127]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; zinc ion binding [GO:0008270]; endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; intracellular protein transport [GO:0006886]	zinc ion binding [GO:0008270]	CKAYMCPYMQFIEGGR	8.869999886	2043.643005	14.35284	11.18892	11.74007	11.2802	12.88611	13.01766	14.93994	12.93267	0	14.09489	15.23947	0	18.51855	13.89532	0	13.44704	0	12.19238	13.17903	0	0	17.82173	13.67222	0	0	0	13.63467	14.61454	0	0	16.01742	14.86112	11.20816	5.613904	0	0	13.53614	12.40165	14.24814	0	15.45891	12.58973	17.83697	4.329078	0	0	12.67192	16.61964	0	0	0	0	0	0
A0A669CDW1	A0A669CDW1_ORENI	IQSEC1	positive regulation of GTPase activity [GO:0043547]; regulation of ARF protein signal transduction [GO:0032012]	SEC7 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; guanyl-nucleotide exchange factor activity [GO:0005085]; positive regulation of GTPase activity [GO:0043547]; regulation of ARF protein signal transduction [GO:0032012]	guanyl-nucleotide exchange factor activity [GO:0005085]	ASLDDSYAMGEGLKR	5.369999886	1612.469665	0	0	16.88081	17.97244	14.1711	13.96338	14.48274	15.9608	17.04606	15.15409	0	0	0	0	17.71467	16.93946	0	0	0	16.57631	15.57848	0	16.52011	0	0	0	0	0	15.08727	0	0	0	0	0	0	15.47638	0	14.23507	14.60333	0	0	0	15.75489	0	16.83309	16.56618	0	0	0	0	0	0	0	0
I3KW84	I3KW84_ORENI	serpina10	blood coagulation [GO:0007596]	SERPIN domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]	extracellular space [GO:0005615]; serine-type endopeptidase inhibitor activity [GO:0004867]; blood coagulation [GO:0007596]	serine-type endopeptidase inhibitor activity [GO:0004867]	TEGKITEMISALDEQTK	5.800000191	1909.914881	0	14.26673	15.26289	15.25398	0	16.29987	0	16.69114	14.27539	0	17.06304	12.44856	15.20017	14.03779	0	15.68433	15.81068	14.85818	0	0	13.20468	18.70623	16.30309	0	16.69693	16.78359	0	14.98696	15.32719	0	13.62463	14.33813	16.71863	0	15.83502	14.32984	0	15.22592	0	16.91746	14.29969	14.60087	14.87323	16.32118	14.92268	13.94961	15.98756	16.36769	0	18.13624	0	13.77021	0	0
I3KYZ1	I3KYZ1_ORENI	cdca4		SERTA domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TGEQVFGTFEIK	8.31000042	1355.90921	11.62038	0	11.03092	11.60247	0	10.102	0	0	0	12.6517	0	12.25372	16.01361	0	0	0	10.86136	0	10.78562	0	0	13.77934	0	0	0	13.88863	0	13.08285	0	0	0	0	9.68341	13.98084	0	0	0	0	7.431095	0	0	0	10.11699	11.90902	12.29888	10.65124	11.61891	9.167215	0	0	0	0	0	0
A0A669DES6	A0A669DES6_ORENI			SET and MYND domain containing 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		histone-lysine N-methyltransferase activity [GO:0018024]	histone-lysine N-methyltransferase activity [GO:0018024]	EAALKNKPMTMIQTL	5.940000057	1705.167542	0	14.45132	13.02161	7.761733	0	12.83708	14.73259	13.6272	13.99898	0	10.15106	0	14.21419	0	0	0	0	0	0	0	0	0	0	14.67985	0	0	0	0	0	0	0	0	0	0	13.6517	0	0	0	0	0	14.99684	0	0	15.36545	0	15.11661	0	13.84148	16.7193	12.58977	0	15.49329	0	0
A0A669C7B7	A0A669C7B7_ORENI	LOC100689879		SH2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NKDGAYLIR	1.059999943	1049.773193	0	14.28535	14.28802	0	13.49153	15.22505	13.72041	13.86149	12.22812	13.8302	10.48465	14.8131	12.37105	0	0	0	0	0	13.89264	0	14.00649	0	0	15.5185	15.54198	0	10.79858	0	0	12.30229	14.71289	0	11.85585	11.36321	15.35645	10.28994	12.99944	0	0	0	0	13.54652	11.01346	12.87622	11.91191	15.62389	14.60234	13.54531	0	0	0	13.76203	12.80838	14.67905
I3JSG1	I3JSG1_ORENI		signal transduction [GO:0007165]	SH2B adaptor protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signaling adaptor activity [GO:0035591]; signal transduction [GO:0007165]	signaling adaptor activity [GO:0035591]	ASGTPGSSKNK	13.10000038	1033.186551	17.56535	17.73467	15.55181	0	16.07224	0	17.82542	17.19953	13.56456	0	17.06468	18.07402	0	15.79357	17.4806	16.20354	0	16.49217	16.8046	0	0	17.3969	16.27442	0	17.00652	17.10454	0	0	15.19313	0	0	0	0	16.09669	14.53831	16.81759	17.08751	14.45373	0	0	0	15.35836	12.65254	16.08257	0	15.5869	16.47898	16.48873	0	0	0	17.96254	0	0
A0A669CQ05	A0A669CQ05_ORENI		bone development [GO:0060348]; eye development [GO:0001654]; heart development [GO:0007507]; podosome assembly [GO:0071800]	SH3 and PX domains 2B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell projection [GO:0042995]; cytoplasm [GO:0005737]; podosome [GO:0002102]	cell projection [GO:0042995]; cytoplasm [GO:0005737]; podosome [GO:0002102]; phosphatidylinositol binding [GO:0035091]; bone development [GO:0060348]; eye development [GO:0001654]; heart development [GO:0007507]; podosome assembly [GO:0071800]	phosphatidylinositol binding [GO:0035091]	TEAPGPAVFMK	13.30000019	1163.847488	14.61661	0	0	14.88643	12.18036	13.22131	14.24769	0	10.74457	0	0	0	11.43559	0	0	0	0	0	0	15.53247	13.84414	16.8487	0	0	0	13.57389	0	0	14.45948	0	14.14854	15.56227	14.91159	0	0	0	13.64333	0	0	0	0	0	0	14.58411	13.31516	0	9.62938	0	15.62245	0	0	0	13.30016	0
A0A669CMJ7	A0A669CMJ7_ORENI			SH3 and multiple ankyrin repeat domains 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; postsynaptic density [GO:0014069]	cytoplasm [GO:0005737]; postsynaptic density [GO:0014069]		EGGRAGELQR	5.210000038	1070.880444	14.3495	13.36146	14.83837	15.18767	13.89159	14.70714	0	13.42457	14.86058	0	10.705	15.02137	12.74412	0	0	0	14.33855	12.70758	13.38846	0	11.78123	14.42804	10.89027	15.28209	0	12.93838	0	0	0	0	13.58461	0	0	13.78969	17.25046	0	0	0	14.04121	0	0	14.87479	14.6363	14.19392	0	16.85665	0	0	11.99254	14.64789	0	12.20424	0	0
A0A669C0R4	A0A669C0R4_ORENI			SH3 and multiple ankyrin repeat domains 3b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]		LSPSGGGHVETSPPSSPPPTPQMRK	5.849999905	2543.381883	11.41328	0	13.49708	0	0	0	0	13.95104	13.91592	0	11.41299	12.00782	9.959772	0	0	0	0	0	0	0	0	13.04196	0	0	9.880283	0	13.40106	0	11.63818	12.81926	0	0	13.02744	0	0	0	12.15623	0	12.647	10.76582	0	0	9.15308	0	0	12.31287	11.11925	10.60097	0	0	0	12.55123	10.49295	6.73421
I3ITS4	I3ITS4_ORENI	LOC100700393	actin filament polymerization [GO:0030041]	SH3 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]; actin filament polymerization [GO:0030041]	actin binding [GO:0003779]	MDKVAVGSDYVAEVEK	10.18999958	1754.723547	16.57799	16.48739	14.42874	16.45686	15.39804	0	17.48457	0	16.24569	0	15.17626	14.34463	16.36082	14.56153	14.32906	15.06699	14.69255	15.41091	0	16.89211	16.97662	17.35799	15.61169	17.55566	15.75292	0	16.08693	16.20483	16.52908	16.40388	0	14.73247	15.73237	0	0	0	0	0	17.45921	0	0	0	0	0	0	0	19.618	0	0	0	16.15012	19.36896	0	0
I3JUL3	I3JUL3_ORENI			SH3GL interacting endocytic adaptor 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	clathrin-coated pit [GO:0005905]	clathrin-coated pit [GO:0005905]		EDGGETVTSPK	10.78999996	1118.63578	11.3693	0	0	13.00833	11.32931	17.10616	14.3331	17.52388	14.02001	0	0	17.92072	15.37712	13.01326	12.6519	14.9253	0	12.51633	15.50922	12.81684	13.85668	18.57924	15.53835	15.71122	16.49591	15.6996	14.24602	17.45942	13.47361	0	9.753402	15.35428	13.08583	13.56163	13.84196	0	14.37789	0	0	0	18.08962	0	14.43126	9.9276	13.97593	13.77461	15.80212	12.04583	9.722232	0	14.92734	14.23406	0	0
I3JNI6	I3JNI6_ORENI	LOC100691347	epidermis development [GO:0008544]; intermediate filament cytoskeleton organization [GO:0045104]	SH3_10 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cornified envelope [GO:0001533]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cornified envelope [GO:0001533]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; intermediate filament binding [GO:0019215]; structural molecule activity [GO:0005198]; epidermis development [GO:0008544]; intermediate filament cytoskeleton organization [GO:0045104]	intermediate filament binding [GO:0019215]; structural molecule activity [GO:0005198]	DLFMDVGGAK	8.090000153	1053.148268	0	13.21546	0	0	14.3522	14.18003	0	11.80961	14.85196	11.87018	15.87406	0	14.95644	15.09941	13.22574	13.693	15.11886	0	0	12.79517	13.28277	16.01822	15.46922	15.72748	14.06944	13.72064	13.25968	0	13.69831	13.99395	16.34976	0	14.95709	15.32065	12.78931	13.61957	0	0	13.75324	13.91891	13.91635	11.29061	14.07043	0	12.0392	12.94065	12.22414	12.77865	14.86059	16.65638	15.92014	0	0	16.24928
A0A669ENJ9	A0A669ENJ9_ORENI		negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transforming growth factor beta receptor signaling pathway [GO:0030512]	SKI-like proto-oncogene a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		SMAD binding [GO:0046332]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transforming growth factor beta receptor signaling pathway [GO:0030512]	SMAD binding [GO:0046332]	IVVEIMQMYSR	5.619999886	1368.289165	12.897	11.66777	12.05408	0	12.60646	0	12.12039	14.17722	11.80334	0	11.23982	6.192413	13.74743	12.26105	17.65265	0	0	8.92174	12.10552	0	14.60117	13.11239	0	11.37305	13.76061	0	14.55597	12.89944	0	0	0	0	11.87572	0	0	0	9.23988	0	0	12.75787	0	0	11.53364	0	12.24261	0	13.10189	12.0766	14.04725	0	0	13.39542	14.57795	0
I3KYB0	I3KYB0_ORENI		axonogenesis [GO:0007409]; regulation of presynapse assembly [GO:1905606]	"SLIT and NTRK-like family, member 4"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; axonogenesis [GO:0007409]; regulation of presynapse assembly [GO:1905606]		GAFNKLHK	2.529999971	914.3577905	15.09839	10.31729	13.74357	7.710207	15.00519	13.5096	0	14.89457	13.89706	11.3524	14.1748	10.46108	14.31048	11.89364	14.61874	14.40739	12.53699	14.39014	14.67939	15.37897	14.69729	13.93283	15.98964	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.84227	0	0	0	0	0	0	0	0
A0A669EKD1	A0A669EKD1_ORENI	smchd1	chromosome organization [GO:0051276]; double-strand break repair [GO:0006302]	SMC hinge domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]	chromosome [GO:0005694]; ATP binding [GO:0005524]; chromosome organization [GO:0051276]; double-strand break repair [GO:0006302]	ATP binding [GO:0005524]	INVVANQPVK	6.570000172	1082.521824	13.2624	0	12.63647	10.67585	11.97876	13.16598	12.97681	0	0	13.43184	0	14.18513	13.3461	13.29315	12.09059	14.3866	0	0	0	12.55874	14.52387	0	0	14.72737	12.92306	12.09964	14.72307	12.62929	0	0	18.96692	0	21.17074	8.826442	0	15.34766	0	0	0	0	0	0	0	0	0	0	0	0	0	13.61754	0	15.1474	0	12.62509
A0A669B4L5	A0A669B4L5_ORENI			SMK-1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				HAFLALCALRFMR	1.950000048	1604.978146	14.52691	13.82545	12.96824	14.17789	0	0	12.61046	0	15.47749	0	13.7585	15.21795	16.43875	0	0	0	15.82739	14.22984	15.47522	16.31533	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3J635	I3J635_ORENI	LOC100695222	lipid transport [GO:0006869]	SMP-LTD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; lipid binding [GO:0008289]; lipid transport [GO:0006869]	lipid binding [GO:0008289]	MEASEGTRER	2.450000048	1181.357792	12.7825	14.33699	13.77947	13.06937	13.56869	14.5529	12.26832	14.37866	0	0	0	0	12.71437	14.71313	0	15.74187	13.7367	0	14.67676	13.93081	15.68613	0	14.6034	0	0	14.12856	14.3504	0	0	14.7454	15.62062	15.36808	0	0	0	0	14.54247	0	0	0	0	0	0	0	0	13.42513	14.79699	0	0	0	0	0	0	14.95181
I3JLZ3	I3JLZ3_ORENI			SMYLE_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DFQRQMVDPSALPLVER	9.729999542	2017.087275	15.21333	13.3423	13.09811	0	0	0	0	0	11.69957	16.27458	16.42353	14.98282	0	19.1767	12.39203	15.14973	12.84036	14.61441	15.27635	15.76511	16.04545	13.01711	16.43602	17.65102	15.82729	0	0	0	16.3982	15.23703	0	0	14.84691	0	13.24404	0	0	14.97952	0	12.37774	10.44092	12.98887	12.62339	14.54781	10.8915	0	0	0	0	15.03061	0	0	0	0
A0A669E8C0	A0A669E8C0_ORENI	LOC100701391		SP-RING-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	MNTLPSMDR	3.940000057	1080.192178	14.02155	13.02369	0	13.52647	12.56705	14.1365	13.73329	12.62996	12.47399	14.5137	14.94965	19.37645	13.43586	0	13.63693	19.27589	0	12.32049	0	0	19.59174	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.27073	0	7.285931	0	0	0	0	0	12.08776	0	13.5743	17.84948	0	0	18.58715	0	0	0
I3JBH6	I3JBH6_ORENI			"SPARC (osteonectin), cwcv and kazal like domains proteoglycan 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; calcium ion binding [GO:0005509]	calcium ion binding [GO:0005509]	TKAHSSSAK	5.599999905	917.273023	14.04059	14.69213	14.40114	14.45608	12.0382	11.89229	13.6967	14.11212	14.69492	15.27423	14.75743	14.92467	14.9961	15.04944	14.17106	11.11413	12.07524	12.94411	14.29784	9.264716	13.52055	14.69197	12.21306	13.46535	12.72863	13.39507	14.51594	12.54297	9.687897	14.76157	12.15119	0	0	15.41837	13.92885	14.70058	14.69485	13.64659	0	14.73901	15.15049	0	0	15.24038	14.12597	12.66007	14.02347	13.47048	16.03137	15.01492	0	14.82781	15.33492	0
I3JZC6	I3JZC6_ORENI			SPOUT domain containing methyltransferase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GVVVAPHVPR	4.840000153	1031.988767	8.434597	13.3529	14.19931	14.71973	0	13.56382	0	15.76853	15.23784	18.01912	13.5706	19.85749	14.3943	19.81791	14.78172	13.45125	0	17.16432	15.25272	13.38336	10.68035	14.35797	15.57515	14.62903	15.6414	0	14.50922	19.06321	11.03572	15.5858	12.57222	17.04786	13.62451	0	14.4149	13.25614	12.02729	14.46759	15.34645	17.42454	15.3766	15.84219	10.58011	14.17892	14.80546	14.0825	14.56393	13.27701	11.81684	14.18892	16.39135	15.33459	19.72984	16.27345
A0A669ER62	A0A669ER62_ORENI			SRP40_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KASSNVPFR	5.510000229	1006.343807	0	14.81374	0	14.38197	16.33081	0	0	15.02592	16.00874	0	12.83962	0	12.41106	0	0	15.91202	12.19411	14.52116	0	15.73833	0	0	14.6858	15.31889	0	0	0	14.36992	0	0	0	0	0	15.54206	15.93519	14.17853	13.30462	12.00142	0	15.15921	18.20141	13.66533	9.523205	0	14.24459	0	0	0	0	13.16609	0	0	0	13.66515
A0A669B9B8	A0A669B9B8_ORENI	srpra	SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	SRP54 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	signal recognition particle receptor complex [GO:0005785]	signal recognition particle receptor complex [GO:0005785]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; signal recognition particle binding [GO:0005047]; SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]; signal recognition particle binding [GO:0005047]	KEAPAAQPAK	4.880000114	1009.729938	12.74885	15.44694	14.35155	16.27925	12.32662	13.05744	15.45583	13.0619	13.34486	16.13457	16.87602	13.86336	12.25644	16.42209	0	17.92864	13.25152	0	13.61108	15.88687	0	15.76684	0	16.80102	14.38586	12.68636	13.32553	13.52266	14.76293	0	0	14.20439	0	14.94842	0	15.06606	0	0	15.61116	16.00355	15.89256	13.1516	14.64477	15.86338	15.47337	11.28187	0	17.21554	15.24215	20.08226	13.2088	0	16.9019	15.25518
I3KWJ8	I3KWJ8_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	SRY-box transcription factor 13	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; sequence-specific DNA binding [GO:0043565]; regulation of transcription, DNA-templated [GO:0006355]"	sequence-specific DNA binding [GO:0043565]	EVGGK	13.10000038	488.4005058	14.74429	0	15.35852	15.4044	13.32781	0	0	15.60417	12.99594	15.07801	16.03163	15.63297	14.28564	14.35506	14.86813	16.49961	14.85855	15.6759	13.84324	14.93504	15.07016	16.83612	16.84854	15.01707	0	15.6938	13.52384	17.69997	13.88173	17.99624	18.52864	13.65242	17.6908	15.14691	15.64716	15.93813	15.96456	13.32952	15.02287	14.58862	14.3737	14.37901	15.69683	15.73752	15.06857	16.1719	14.98159	16.1227	15.79971	13.65828	15.79012	12.77298	15.22412	15.53557
A0A669E233	A0A669E233_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	SRY-box transcription factor 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	KLLCYLQFISFMQVSPGAK	8.25	2245.104426	6.733868	10.77954	0	0	0	7.271798	11.04575	17.57271	0	0	0	0	0	0	0	0	13.58314	13.30316	13.08547	0	0	0	0	12.12293	0	12.52401	14.81552	12.40169	14.61943	5.35554	0	0	18.50227	12.72289	0	11.15211	0	13.69518	14.26132	0	17.37588	0	0	9.362227	0	0	14.16808	0	0	0	0	0	0	0
A0A669DDH1	A0A669DDH1_ORENI	NPC1L1		SSD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; lipid transporter activity [GO:0005319]	lipid transporter activity [GO:0005319]	AVVRDESGEIIGR	6.460000038	1399.981059	0	13.1939	12.85122	0	0	0	8.468574	10.4038	0	11.19203	0	0	0	0	0	0	5.760993	12.42281	0	12.88828	18.33007	0	0	0	0	0	8.779195	0	0	0	0	0	0	0	12.25638	17.24415	0	0	10.14581	0	0	0	0	0	0	12.80221	13.22938	0	15.014	0	0	0	0	9.229285
A0A669END8	A0A669END8_ORENI			SSFA2_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	plasma membrane [GO:0005886]	plasma membrane [GO:0005886]; actin binding [GO:0003779]	actin binding [GO:0003779]	RSLNLFR	29.03000069	905.7199756	17.90079	17.62759	17.79982	17.56624	16.77664	17.37004	16.38538	16.87693	16.68174	17.51488	17.87156	17.7804	17.78727	17.58568	17.41883	15.8066	17.42516	18.2397	17.61452	16.88923	17.4997	17.52614	16.39463	17.06568	16.93846	16.92893	17.5478	17.05128	16.89585	17.21499	16.22336	17.65955	18.43739	17.0614	17.15817	17.73516	17.70624	16.92555	16.77246	16.80742	17.67376	17.46238	17.13754	17.40992	16.39166	17.6427	17.31339	16.96004	16.84265	17.68189	17.46231	17.48077	16.71938	17.16285
I3KIX7	I3KIX7_ORENI	stard10		START domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		lipid binding [GO:0008289]	lipid binding [GO:0008289]	DVSAETMYDVLHDIEYR	1.5	2072.205953	11.61426	14.11719	13.71967	0	7.044369	13.65104	10.34674	15.15822	13.10114	17.96762	0	13.68261	17.01751	0	15.65334	0	14.63562	0	0	0	0	0	0	0	0	0	0	13.51532	14.11564	0	13.85822	12.83955	18.92242	13.29643	13.55682	10.82547	0	14.18058	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3J8J5	I3J8J5_ORENI	hdhd2		STAS domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		phosphatase activity [GO:0016791]	phosphatase activity [GO:0016791]	MILDGAPLIAIHKAR	2.799999952	1617.82226	15.91902	0	16.88585	0	0	0	17.43707	0	15.84105	16.59865	0	16.62875	0	15.95963	0	16.8611	12.27953	13.04034	15.07133	0	0	0	0	0	15.45799	0	0	17.36266	15.65368	16.77339	17.02634	0	0	16.4138	16.28618	16.27873	15.5842	16.58536	0	0	0	16.81407	17.91345	0	0	0	16.40787	16.42939	15.57516	0	17.96536	17.22481	0	0
A0A669AY94	A0A669AY94_ORENI		protein desumoylation [GO:0016926]	SUMO specific peptidase 5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]; ubiquitin-like protein-specific protease activity [GO:0019783]; protein desumoylation [GO:0016926]	ubiquitin-like protein-specific protease activity [GO:0019783]	ELCDCK	7.050000191	824.3383802	12.61649	13.69995	0	0	0	0	0	14.53105	0	16.01931	13.26035	14.12212	14.43993	14.10337	16.97123	15.679	0	14.85277	14.18418	10.35065	13.57571	13.33959	15.18482	12.70016	14.45687	15.46479	13.37263	13.94339	0	16.87294	0	0	12.45303	0	12.7641	10.96853	13.48753	14.244	16.23623	14.32619	13.38996	0	16.15264	13.8451	11.8672	15.61243	15.50254	0	0	13.76392	0	13.25564	15.30563	12.43895
A0A669EK25	A0A669EK25_ORENI	LOC100693460		SUN domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NLIGSAK	32.65999985	701.4740556	17.05585	17.10202	17.10527	16.94997	16.69377	17.41079	0	0	0	0	16.18969	17.12862	14.77896	0	16.03516	0	14.89848	13.09579	14.36602	0	12.658	0	10.83021	0	10.83482	0	0	0	0	0	16.16154	16.16642	17.50881	16.90992	16.35409	16.59773	16.6103	17.1806	0	16.62193	0	16.31936	16.70804	16.80322	17.17271	16.54035	0	17.50546	16.48981	0	0	0	0	0
I3JZC0	I3JZC0_ORENI	surf6	heart development [GO:0007507]	SURF6 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; heart development [GO:0007507]		SDTGPPKK	5.019999981	830.6901794	0	11.5785	16.8021	12.63308	13.31925	14.61195	15.02314	0	10.34002	14.77662	0	0	13.94199	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.98541	0	15.98685	0	0	0	15.61915	0	0	17.47676	0	0	17.30091	15.38775	0	0	14.43601	0	15.959	0	15.29976	17.2517	14.45004	0	0	0
I3KRQ9	I3KRQ9_ORENI	LOC100710744		SUZ domain-containing protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SASSPVRTAVVVQDDSLPAAPPPQIR	6.920000076	2658.09433	8.942623	6.408659	0	10.18618	0	7.762863	0	12.53059	8.593644	0	0	13.96211	11.24356	0	0	13.32055	0	0	7.887189	0	0	17.019	0	9.868564	0	0	14.25361	0	0	0	0	0	0	13.54072	10.33037	0	0	0	0	11.25662	12.85064	11.17815	0	0	0	0	0	0	0	0	0	0	0	0
A0A669F484	A0A669F484_ORENI			"SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; nBAF complex [GO:0071565]; npBAF complex [GO:0071564]; SWI/SNF complex [GO:0016514]	integral component of membrane [GO:0016021]; nBAF complex [GO:0071565]; npBAF complex [GO:0071564]; SWI/SNF complex [GO:0016514]		EREALEYQR	4.559999943	1192.432865	9.941556	11.08597	12.34162	14.98445	11.41323	11.06706	16.07102	17.56882	15.6935	14.79827	15.18484	14.46189	12.53736	14.7148	13.53835	11.73042	0	14.12484	13.36335	15.19639	10.27527	13.67511	14.1253	14.28453	12.56049	15.83392	14.04343	0	13.86504	12.77156	14.86334	7.862782	15.09029	13.96228	10.14655	11.61532	0	14.20416	0	13.41037	0	13.00971	13.20464	0	0	16.63127	13.05792	0	14.51848	0	14.2747	8.953926	0	14.40706
A0A669DT05	A0A669DT05_ORENI			"SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nBAF complex [GO:0071565]; npBAF complex [GO:0071564]; SWI/SNF complex [GO:0016514]	nBAF complex [GO:0071565]; npBAF complex [GO:0071564]; SWI/SNF complex [GO:0016514]		KPVGFPGANEMPARQMDMR	7.889999866	2164.187487	8.870326	0	0	15.23555	0	16.79995	0	0	14.22974	0	13.49249	0	0	13.73497	14.43302	0	15.31513	0	0	0	0	18.84118	17.97341	17.21365	0	15.55679	0	0	0	0	0	0	15.86193	10.13188	0	0	0	0	0	0	14.24502	0	15.62368	14.18082	0	14.03612	0	0	15.71216	17.94179	0	14.72681	14.37577	17.92038
I3JJE4	I3JJE4_ORENI	zswim8		SWIM-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	KGLSVSGGGGMLVR	3.390000105	1334.193844	0	14.18618	0	14.19499	14.87951	15.44345	12.40238	16.54503	0	14.02075	14.17498	16.84246	0	15.32979	0	0	17.30683	15.74948	14.40212	0	0	16.57106	15.92373	16.42525	15.26162	0	0	15.89608	16.23229	16.05713	15.25158	0	0	0	0	16.58301	14.77992	0	0	14.17015	0	16.382	0	14.63414	0	0	15.86626	0	15.14593	15.50925	0	18.33189	18.01025	15.41181
A0A669D1W9	A0A669D1W9_ORENI	s100a14		S_100 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MTNKLVK	1.090000033	833.6154397	14.99606	15.29951	14.6271	13.133	14.60819	0	0	0	17.07588	17.15699	0	16.20304	0	0	0	14.73944	0	16.40108	15.8483	16.96782	0	0	15.76556	0	15.23886	0	16.1487	0	14.64111	0	13.84713	15.04831	16.00264	15.25226	0	13.71567	0	0	0	15.47872	0	15.58481	0	0	0	0	15.75872	0	0	0	0	0	0	0
I3KL58	I3KL58_ORENI			Sarcolemma associated protein b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GSSGDSEKTIQR	4.960000038	1265.218678	12.43128	0	0	0	19.31335	0	0	15.49164	0	0	0	0	0	17.8471	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23.73348	22.71307	23.77581	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.77461	0	0	0
I3KER4	I3KER4_ORENI	rab3il1		Sec2p domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	EMNVAK	5.849999905	707.7572766	15.4567	15.65473	0	13.54393	14.66145	0	13.16621	14.77881	16.66032	16.60551	17.0346	16.94816	13.0624	15.92934	15.65228	16.34241	0	0	0	15.60063	17.12425	16.08945	16.6642	16.25119	17.4137	16.43085	15.48928	14.58951	17.46551	16.69271	16.25315	16.15245	17.97942	0	15.96624	15.22024	15.90034	0	0	0	0	16.26912	0	16.7971	0	16.54552	15.43792	0	15.53274	15.63868	17.32841	16.97898	0	18.38059
I3JNX7	I3JNX7_ORENI	LOC100695734	protein transport [GO:0015031]	Secretory carrier-associated membrane protein (Secretory carrier membrane protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; protein transport [GO:0015031]		MAENNFPPLPR	2.440000057	1285.82721	12.85707	12.88986	0	0	0	11.09015	0	8.903481	0	12.72195	15.75881	15.36929	0	19.11233	14.30993	7.815569	18.84843	0	0	13.81604	11.84719	13.67378	0	10.83869	12.33501	0	0	14.31183	0	0	0	16.71142	0	0	0	0	0	14.08942	12.53491	12.93826	0	12.65023	0	15.24784	0	11.05227	10.08286	7.092772	11.75766	11.10156	10.18268	13.25884	19.90376	0
A0A669B9H5	A0A669B9H5_ORENI			Seizure related 6 homolog (mouse)-like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		ITTNTSSVG	2.00999999	879.807446	12.12569	10.17262	13.39852	11.84916	10.76377	11.66006	12.32402	11.43944	11.98088	14.60173	9.552401	11.01125	0	14.56308	0	14.31372	10.55135	0	16.12235	14.09992	0	0	0	13.2768	13.62619	0	0	0	0	0	0	0	0	0	0	0	0	13.90175	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DPM9	A0A669DPM9_ORENI			Seizure related 6 homolog a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GMCYEPFVK	1.690000057	1143.092478	12.74208	10.94027	0	11.71454	12.63618	12.62062	10.19611	12.82714	12.4295	17.23212	0	12.96843	12.29629	11.81197	0	0	13.29356	0	17.92013	16.70217	0	0	0	0	14.96885	12.49736	15.11408	12.4097	0	0	0	0	0	0	0	14.63488	0	0	0	14.80483	0	13.5787	0	0	0	0	0	0	0	0	0	0	15.53527	0
A0A669ENN5	A0A669ENN5_ORENI			"Selenide, water dikinase (EC 2.7.9.3)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"ATP binding [GO:0005524]; selenide, water dikinase activity [GO:0004756]"	"ATP binding [GO:0005524]; selenide, water dikinase activity [GO:0004756]"	EEVIEAYQEAMFSMATLNR	8.760000229	2248.259242	0	8.976163	12.65023	0	0	12.53606	11.6308	13.665	0	0	12.68123	10.39524	0	0	0	0	15.3251	13.07234	12.97324	14.64612	0	9.508394	14.23127	0	15.06635	13.27476	14.49476	4.077682	13.95893	11.27802	0	12.88244	0	0	0	13.31628	12.43598	0	13.79486	12.5896	0	0	0	0	0	17.34088	14.42049	0	8.606269	0	0	0	0	0
A0A669B6X8	A0A669B6X8_ORENI			Selenoprotein J	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TPQKLIPSVFTNA	6.079999924	1415.440253	0	0	0	13.95615	0	0	14.14547	14.9262	15.11264	0	0	14.98996	15.10642	0	0	0	0	0	0	14.48322	0	0	0	15.33886	0	11.67143	0	0	15.21247	0	0	15.41025	0	0	14.91476	0	0	13.04076	0	0	13.50149	0	0	0	0	16.08442	0	0	0	15.25282	0	11.93188	15.28756	14.85047
A0A669DAU6	A0A669DAU6_ORENI	LOC100694323		Sema domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		semaphorin receptor binding [GO:0030215]	semaphorin receptor binding [GO:0030215]	TFGGFDSTK	6.730000019	960.5684366	8.039023	0	12.03644	11.23999	0	13.53995	18.46995	11.49834	14.90334	15.27382	13.38707	15.21223	12.4037	14.01298	14.09698	13.74269	15.39092	11.59153	0	14.90586	13.87076	0	10.68974	13.72064	0	12.41256	0	0	0	8.202576	0	13.84251	13.60121	12.65704	15.36589	12.98658	13.51576	14.6218	14.59398	13.2546	13.84794	0	17.70759	14.08604	0	15.76125	15.32161	0	15.03963	15.44365	14.4232	14.50199	0	11.60394
A7TZ04	A7TZ04_ORENI	SPP120		Seminal plasma glycoprotein 120	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				IQTIQGSLR	13	1014.814571	0	14.8	11.29956	0	15.23342	0	11.44388	11.21059	14.29834	14.34708	9.852991	17.63923	0	0	13.14841	13.14659	14.82658	0	13.62698	18.09382	0	16.05946	14.41746	15.61568	18.07238	10.15792	14.54314	13.83611	15.01882	12.58313	16.90445	14.45274	16.309	15.04599	0	0	0	12.22808	14.09991	14.45894	15.45724	13.64267	19.87218	14.50868	15.65937	0	0	12.70965	15.25957	12.55304	0	15.51053	19.5224	17.41788
I3KSG7	I3KSG7_ORENI	espl1	chromosome segregation [GO:0007059]	Separase (EC 3.4.22.49)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; nucleus [GO:0005634]	integral component of membrane [GO:0016021]; nucleus [GO:0005634]; cysteine-type endopeptidase activity [GO:0004197]; chromosome segregation [GO:0007059]	cysteine-type endopeptidase activity [GO:0004197]	ESILRR	13.05000019	773.3187368	16.43667	17.30334	16.80554	16.41318	19.107	15.73313	17.68014	17.50083	16.96721	17.33002	18.50067	18.96315	14.31025	20.29509	16.5742	15.82469	17.94365	17.6761	14.60672	15.4791	13.68447	16.00273	21.57606	22.0655	18.48139	0	0	0	18.82347	18.75194	16.80721	0	12.72794	17.35728	16.91379	16.02738	0	0	14.8119	14.66764	15.00839	16.34223	16.27648	16.29712	0	11.30473	18.93066	16.80413	14.80573	15.60776	15.55087	14.70526	18.022	6.856493
I3K460	I3K460_ORENI	spr	tetrahydrobiopterin biosynthetic process [GO:0006729]	Sepiapterin reductase (EC 1.1.1.153)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		sepiapterin reductase activity [GO:0004757]; tetrahydrobiopterin biosynthetic process [GO:0006729]	sepiapterin reductase activity [GO:0004757]	MSSADPASLGR	7.610000134	1107.320477	0	11.31572	0	12.64351	18.36378	0	0	13.57798	0	14.06769	14.26359	19.19381	0	13.70574	16.4915	0	15.2489	14.6895	20.17819	0	13.78404	0	0	0	15.73553	0	14.10404	0	13.7839	0	0	0	11.66929	0	12.63068	13.01251	10.98735	15.32988	0	10.00849	0	14.34177	0	0	13.87431	0	0	14.72647	12.55767	0	0	0	0	12.46138
A0A669DS30	A0A669DS30_ORENI	LOC100700755	cell division [GO:0051301]	Septin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ciliary membrane [GO:0060170]; cleavage furrow [GO:0032154]; midbody [GO:0030496]; spindle [GO:0005819]	ciliary membrane [GO:0060170]; cleavage furrow [GO:0032154]; midbody [GO:0030496]; spindle [GO:0005819]; GTP binding [GO:0005525]; cell division [GO:0051301]	GTP binding [GO:0005525]	YIPGAAEKIER	6.639999866	1244.537225	13.01923	13.8269	13.90582	0	0	10.13622	0	13.87195	11.70751	0	13.47645	0	15.46816	13.82911	13.3115	0	15.20247	0	0	11.58545	0	0	14.15845	13.22855	18.26781	16.4143	0	0	0	0	14.79432	11.12704	0	13.80866	15.23599	17.75258	9.40742	13.83328	10.28987	0	0	13.8671	12.7799	13.49751	0	0	14.15886	0	14.44791	12.95723	17.06775	11.07586	0	0
A0A669CE87	A0A669CE87_ORENI	LOC100702031		Septin-type G domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]	GTP binding [GO:0005525]	GTSSSVTFGG	4.539999962	900.1202499	14.22851	0	15.33403	0	0	15.14845	14.90927	14.70391	15.40384	14.98921	16.16733	15.72336	15.43653	0	15.07892	0	15.7129	16.83697	16.21722	0	8.094295	0	19.80403	16.83416	0	0	15.76272	15.54713	0	15.02046	0	0	0	0	0	0	0	0	0	0	0	15.71036	16.04889	14.91446	14.34883	0	0	0	0	16.55696	16.7455	0	17.77632	0
A0A669B4S7	A0A669B4S7_ORENI	SRSF10		Serine and arginine rich splicing factor 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	SESPRDSR	2.670000076	932.6327301	0	0	0	15.12131	0	0	13.63818	14.14217	0	0	0	0	14.51515	12.48642	14.57542	0	0	13.17038	12.22021	0	15.34586	0	14.26357	7.730064	12.86521	14.1426	12.94717	11.39315	0	0	12.67255	0	11.39004	13.10385	0	13.68568	0	12.58817	12.72001	0	13.69908	15.85339	11.05901	15.20264	0	14.14033	10.08517	14.43528	0	13.83813	17.89806	0	15.16904	12.41669
A0A669CX85	A0A669CX85_ORENI	LOC100695852	glycine biosynthetic process from serine [GO:0019264]; tetrahydrofolate interconversion [GO:0035999]	Serine hydroxymethyltransferase (EC 2.1.2.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		glycine hydroxymethyltransferase activity [GO:0004372]; pyridoxal phosphate binding [GO:0030170]; glycine biosynthetic process from serine [GO:0019264]; tetrahydrofolate interconversion [GO:0035999]	glycine hydroxymethyltransferase activity [GO:0004372]; pyridoxal phosphate binding [GO:0030170]	IMGLDISDGGHLSHGYMSDVKR	5.610000134	2403.387278	13.08797	0	11.92094	11.90211	0	10.94971	0	0	15.18565	15.2799	9.943775	8.87331	0	0	0	8.591137	0	0	13.41626	0	0	0	9.785205	0	0	0	0	0	11.95579	14.4878	13.64238	0	14.09875	14.07543	0	0	0	13.50441	9.626186	0	11.54998	12.84265	13.948	0	13.45491	14.41325	12.48009	0	0	10.71866	0	0	11.44828	0
I3IZP6	I3IZP6_ORENI		phosphatidylserine metabolic process [GO:0006658]; sphingolipid metabolic process [GO:0006665]	Serine incorporator 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; phosphatidylserine metabolic process [GO:0006658]; sphingolipid metabolic process [GO:0006665]		MGAVLGLCSMASWIPCLCGSAPCLLCR	2.730000019	3056.143707	0	12.06085	0	9.864687	14.55922	8.80769	14.79146	14.19848	15.1167	0	14.07064	12.54089	0	16.64721	14.13864	14.57882	13.78697	0	0	0	0	0	15.92546	0	13.58493	14.80118	0	15.02425	14.76267	0	0	0	15.9414	14.93682	14.89733	13.69103	0	0	15.04399	13.25251	0	16.8006	0	15.22916	16.13609	0	17.6336	15.07292	15.85131	16.48834	15.03785	17.20719	14.3182	0
I3JSK4	I3JSK4_ORENI	LOC100695205	"regulation of alternative mRNA splicing, via spliceosome [GO:0000381]"	"Serine/arginine-rich splicing factor 2 (Splicing component, 35 kDa) (Splicing factor SC35) (Splicing factor, arginine/serine-rich 2)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; RNA binding [GO:0003723]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]"	RNA binding [GO:0003723]	GGGPSR	2.49000001	530.2007009	0	0	0	16.21694	16.59425	16.90067	16.21209	17.86567	16.25401	0	20.22068	19.73545	0	0	0	0	0	19.94039	20.03452	0	0	18.96884	19.22299	19.45458	0	18.86462	19.89898	19.35107	17.69666	0	16.66693	15.50284	0	16.79284	15.83839	0	17.41104	0	0	15.41769	0	16.14782	16.79881	16.88758	0	16.21994	0	16.50008	15.97822	16.29933	16.82231	0	17.03871	19.3718
A0A669F7B1	A0A669F7B1_ORENI	LOC100694131	signal transduction [GO:0007165]	Serine/threonine protein phosphatase 2A regulatory subunit	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	protein phosphatase type 2A complex [GO:0000159]	protein phosphatase type 2A complex [GO:0000159]; protein phosphatase regulator activity [GO:0019888]; signal transduction [GO:0007165]	protein phosphatase regulator activity [GO:0019888]	AAGGMVLDGPSSNGPFQPVALMHFR	10.06000042	2573.108408	0	12.60731	11.94461	0	0	11.15059	13.05468	0	0	13.53309	0	0	0	8.615753	0	0	0	0	0	0	0	0	0	0	0	0	0	14.71919	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3JTU8	I3JTU8_ORENI	LOC100704168	negative regulation of apoptotic process [GO:0043066]	Serine/threonine-protein kinase (EC 2.7.11.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; negative regulation of apoptotic process [GO:0043066]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	VGTGFR	7.880000114	638.0710959	0	16.44351	16.86922	16.30526	17.02614	14.88226	16.20585	14.58526	16.10348	0	15.37508	17.11385	14.97093	16.22527	15.53405	14.06622	16.80563	16.33458	0	15.63334	14.896	16.47405	16.07602	16.13645	15.35823	15.87241	14.43838	15.18697	15.51396	13.19118	16.58981	17.24153	15.81422	0	17.20807	16.84299	14.38847	16.14075	15.04952	14.69539	17.26649	15.96183	16.37667	15.35729	17.50022	14.00975	14.94593	15.91498	16.04389	15.41343	16.44835	16.91838	15.39333	16.14674
A0A669E566	A0A669E566_ORENI	PRKD3	intracellular signal transduction [GO:0035556]	Serine/threonine-protein kinase (EC 2.7.11.13)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; membrane [GO:0016020]	cytoplasm [GO:0005737]; membrane [GO:0016020]; ATP binding [GO:0005524]; calcium-dependent protein kinase C activity [GO:0004698]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; intracellular signal transduction [GO:0035556]	ATP binding [GO:0005524]; calcium-dependent protein kinase C activity [GO:0004698]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	DVGQSWEK	5.989999771	948.0578459	15.09442	11.27845	13.11543	9.355838	14.42513	11.51262	13.52205	12.60333	12.99054	17.12037	14.0581	13.55991	12.49402	13.57862	13.23592	14.04418	0	14.68343	10.41868	13.81807	12.70997	12.03215	13.34999	0	0	14.67247	12.48478	0	0	13.82965	0	11.96137	0	0	14.23825	15.17437	12.64768	12.55918	0	13.23616	12.45376	14.09401	11.00083	11.48722	14.0402	9.858836	11.99526	13.09484	0	13.1803	14.74328	15.16602	12.84931	14.44431
A0A669EZM5	A0A669EZM5_ORENI	LOC100689806	ribosome biogenesis [GO:0042254]	Serine/threonine-protein kinase RIO1 (EC 2.7.11.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; ribosome biogenesis [GO:0042254]	ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	NLIRLQTAGIPSPEPLLLR	4.880000114	2100.091122	0	0	0	0	0	15.35504	0	19.05546	0	17.46706	0	0	16.80355	16.82266	14.72098	15.89128	0	0	0	13.97642	14.76274	0	15.34289	0	0	15.79036	0	0	0	18.31503	0	0	0	0	0	0	15.59172	0	15.62438	15.24368	15.62883	14.75708	16.02605	15.01094	0	0	0	0	15.94748	0	14.45534	0	0	0
A0A669C9I4	A0A669C9I4_ORENI	mtor		Serine/threonine-protein kinase TOR (EC 2.7.11.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]; protein-containing complex binding [GO:0044877]	ATP binding [GO:0005524]; protein-containing complex binding [GO:0044877]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ILLNIEHR	12.60999966	1006.768619	13.40683	11.34337	15.6619	0	16.02249	12.89023	14.79067	0	16.19393	0	16.17481	16.47741	15.30696	15.93715	12.421	16.11054	0	16.1903	13.52268	13.44125	16.64038	0	16.09706	0	17.28002	14.74078	16.5708	0	15.05952	16.75159	17.00661	0	0	0	16.69386	16.9997	0	13.50345	14.66528	12.61329	17.84364	16.3213	0	15.69195	0	15.76042	16.70623	18.44582	15.80957	15.93489	17.52794	0	0	0
A0A669D5Z0	A0A669D5Z0_ORENI	bmpr1b		Serine/threonine-protein kinase receptor (EC 2.7.11.30)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; transmembrane receptor protein serine/threonine kinase activity [GO:0004675]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; transmembrane receptor protein serine/threonine kinase activity [GO:0004675]	QSNILDSMLLKASSK	1.49000001	1647.897108	0	15.28782	14.15528	0	0	15.57802	15.90768	12.93942	14.64886	15.48151	14.65497	16.27597	16.15088	16.08663	0	15.63592	14.15171	15.5206	0	0	0	0	0	0	0	17.93835	0	0	0	0	0	0	0	0	0	15.99894	0	0	16.77867	0	0	0	0	0	0	17.14393	0	0	0	0	0	0	0	17.52856
A0A669DAC9	A0A669DAC9_ORENI	LOC100708080		Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	protein phosphatase type 2A complex [GO:0000159]	protein phosphatase type 2A complex [GO:0000159]; protein phosphatase regulator activity [GO:0019888]	protein phosphatase regulator activity [GO:0019888]	DVTLEASR	9.100000381	891.1338028	16.47602	16.99751	16.96542	17.2171	0	13.57639	14.96807	16.17834	15.91958	17.30039	17.57878	16.25931	15.09435	17.11443	0	18.32994	15.89653	16.09516	16.26644	15.25872	11.47438	15.71756	10.89225	0	0	15.30163	15.92987	17.38316	16.42988	16.41991	0	0	0	16.24156	16.10749	0	0	15.25454	14.4277	16.09545	16.35024	17.52266	18.46483	14.46463	15.6024	0	16.73164	0	15.83161	0	0	0	0	0
A0A669CZ90	A0A669CZ90_ORENI	LOC100690594	calcineurin-mediated signaling [GO:0097720]	Serine/threonine-protein phosphatase (EC 3.1.3.16)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calmodulin binding [GO:0005516]; calmodulin-dependent protein phosphatase activity [GO:0033192]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]; calcineurin-mediated signaling [GO:0097720]	calmodulin binding [GO:0005516]; calmodulin-dependent protein phosphatase activity [GO:0033192]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]	NGTNAQA	1.149999976	673.0625693	0	13.9816	13.72431	15.63931	0	14.65638	0	0	14.7059	15.25589	16.47816	15.28504	14.71255	0	15.30821	0	0	0	14.98795	0	0	14.42098	15.90325	14.8105	6.010993	11.67421	14.9336	0	14.90071	0	16.62753	0	15.83101	15.15273	13.87583	14.78435	0	0	0	11.81091	13.12383	13.99171	0	0	0	13.42107	15.68646	15.14595	0	15.06559	14.92809	15.29563	15.56079	16.13941
I3JL70	I3JL70_ORENI		detection of stimulus involved in sensory perception [GO:0050906]	Serine/threonine-protein phosphatase with EF-hands (EC 3.1.3.16)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]; iron ion binding [GO:0005506]; manganese ion binding [GO:0030145]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]; detection of stimulus involved in sensory perception [GO:0050906]	calcium ion binding [GO:0005509]; iron ion binding [GO:0005506]; manganese ion binding [GO:0030145]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]	SHECKQDGYEFCHNR	2.450000048	1966.246745	14.35043	15.01642	0	13.6052	0	14.26329	14.58153	16.42275	16.40754	0	0	14.66084	0	14.92582	13.61908	15.45006	13.63807	0	12.54132	12.0109	0	16.50356	16.42885	15.14927	15.16692	16.35115	15.95144	15.81921	15.51677	15.28311	16.31744	13.56574	16.67503	15.11926	13.85404	15.1279	14.77159	14.79938	14.26237	13.74166	14.82637	15.8766	14.73711	15.75583	14.69466	13.68722	16.57822	15.71788	0	15.83445	16.9452	17.01161	15.58054	16.10587
A0A669E4C0	A0A669E4C0_ORENI	sars1	seryl-tRNA aminoacylation [GO:0006434]	Seryl-tRNA synthetase (EC 6.1.1.11)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; serine-tRNA ligase activity [GO:0004828]; seryl-tRNA aminoacylation [GO:0006434]	ATP binding [GO:0005524]; serine-tRNA ligase activity [GO:0004828]	EIGNLLHPSVPISNDEDADNK	6.940000057	2277.60105	0	0	18.31505	13.42845	0	8.206343	13.54638	14.95754	0	0	0	8.413508	11.58813	14.02853	0	0	10.87323	0	0	12.45746	0	10.37876	0	16.17078	16.64663	14.91598	12.72461	0	15.01198	0	0	18.30925	11.83722	13.50888	11.41806	0	0	13.59723	13.39977	10.5577	16.06288	7.555196	14.32373	0	0	0	0	0	0	0	0	0	0	12.58028
I3K575	I3K575_ORENI		multicellular organism development [GO:0007275]	Shootin-1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; filopodium [GO:0030175]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; perikaryon [GO:0043204]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; filopodium [GO:0030175]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; perikaryon [GO:0043204]; multicellular organism development [GO:0007275]		GMLDNMKR	4.809999943	996.6886086	13.39997	13.43664	13.39015	12.93602	14.49992	14.45725	0	14.02404	0	14.44937	14.0149	14.06962	14.50383	13.14023	14.20828	14.46634	12.14561	0	12.98575	14.70653	14.72252	0	18.08906	15.01795	13.79668	13.67011	12.82047	14.14787	14.91414	15.31081	11.00339	0	17.1103	0	0	12.00924	14.74625	12.97779	0	0	13.10335	0	0	0	0	14.50028	0	14.50326	0	0	0	0	13.59915	0
A0A669ESZ1	A0A669ESZ1_ORENI			"Short chain dehydrogenase/reductase family 39U, member 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DLFSSRVDTTK	1	1268.697321	0	12.37763	9.511531	13.31495	0	8.140428	13.42627	13.75401	0	16.2965	0	0	9.382207	11.23008	9.220762	10.63743	10.89822	14.20221	14.45729	12.11826	12.1276	0	0	0	15.03976	13.48157	13.56669	10.99694	0	13.60505	11.76904	15.82638	0	0	0	0	0	0	0	12.53752	8.393044	0	10.63534	0	0	9.395468	0	0	0	0	0	0	0	0
A0A669CZR1	A0A669CZR1_ORENI		multicellular organism development [GO:0007275]	Short stature homeobox	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; multicellular organism development [GO:0007275]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]"	TNFTLEQLNELERLFDETHYPDAFMR	5.199999809	3244.372827	9.218786	11.68238	0	11.43813	16.95071	12.06529	11.44786	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.30315	0	0	0	0	0	0	0	0	0	0	0	0
I3JEY5	I3JEY5_ORENI	trpc1	angiogenesis [GO:0001525]; filopodium assembly [GO:0046847]; vasculogenesis [GO:0001570]	Short transient receptor potential channel 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium channel activity [GO:0005262]; angiogenesis [GO:0001525]; filopodium assembly [GO:0046847]; vasculogenesis [GO:0001570]	calcium channel activity [GO:0005262]	GLLEDRMNLSR	4.300000191	1303.228937	0	13.95669	0	12.15016	12.29742	14.48165	10.0463	14.94427	0	13.94457	13.71489	14.56224	13.29272	0	12.28667	7.732275	0	12.58842	10.03493	13.45352	15.18726	0	13.79102	14.14852	0	12.34837	0	14.03894	13.60245	0	19.86096	18.40265	20.41981	0	0	13.35792	0	13.48901	10.94746	13.87519	13.6244	12.28257	14.83175	14.0292	0	13.93632	13.43536	15.63034	0	0	0	13.286	15.63191	12.8596
I3JM06	I3JM06_ORENI		lipid transport [GO:0006869]; lipoprotein metabolic process [GO:0042157]	Si:cabz01007807.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; lipid binding [GO:0008289]; lipid transport [GO:0006869]; lipoprotein metabolic process [GO:0042157]	lipid binding [GO:0008289]	TEMVARLK	5.300000191	960.9318168	12.19106	0	7.426539	14.13553	11.02451	15.15207	16.02135	13.28964	15.07772	0	15.90012	0	15.58844	0	14.13373	15.17195	0	0	15.98492	13.83877	0	16.14014	0	0	0	16.6485	0	0	0	16.18874	16.73691	0	14.31473	0	0	0	0	0	0	16.98645	0	14.93321	14.95856	0	17.47585	16.58726	0	17.19908	0	0	13.06625	16.99143	0	0
I3J0V2	I3J0V2_ORENI		transmembrane transport [GO:0055085]	Si:ch1073-100f3.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transport [GO:0055085]		MRMIGMTLNVVR	12.71000004	1468.912476	8.385658	13.15486	10.55294	15.24624	13.74797	14.16592	0	12.31518	14.86038	18.05151	13.6635	13.07032	0	0	0	16.2698	15.21385	17.32477	0	0	0	0	0	17.34393	0	0	0	0	0	0	16.00925	0	14.47034	0	0	12.90798	15.88895	15.5632	0	0	0	15.67437	15.65815	0	16.38082	16.84018	16.32367	16.38235	13.4553	15.71356	0	0	0	0
A0A669DRD5	A0A669DRD5_ORENI			Si:ch1073-296d18.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		nucleic acid binding [GO:0003676]	nucleic acid binding [GO:0003676]	FCVHISPK	5.96999979	987.8753756	14.12264	16.49889	12.37979	15.74401	15.83294	13.69557	0	14.58161	0	10.42752	13.77702	12.29278	16.98839	0	15.25073	15.16186	0	14.63376	12.0927	13.10864	0	0	13.42189	0	0	0	15.87311	0	16.68981	0	0	0	14.82863	0	0	0	15.87711	0	14.71227	15.27286	0	0	17.25298	0	0	0	14.36389	14.6647	0	15.90303	15.62211	15.93112	15.76868	15.51343
I3K502	I3K502_ORENI		regulation of small GTPase mediated signal transduction [GO:0051056]	Si:ch1073-90m23.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]; regulation of small GTPase mediated signal transduction [GO:0051056]	GTPase activator activity [GO:0005096]	SQCMMGDQSLIAVPTSEGLR	5.909999847	2212.586869	13.65722	9.550236	6.14191	0	14.15121	12.43618	0	12.15211	0	13.38344	16.18236	16.70083	13.14568	0	0	13.12803	13.93219	0	15.33785	0	0	14.50741	15.90391	0	15.91557	13.0284	15.98738	0	11.56349	10.46521	13.17335	13.99136	14.82405	11.90531	12.04821	9.545135	0	10.00246	10.96037	11.57366	0	0	12.67412	12.56098	0	12.33625	0	11.06974	0	0	12.57788	14.22347	14.78459	14.50477
I3KEL9	I3KEL9_ORENI		reciprocal meiotic recombination [GO:0007131]	Si:ch211-10e2.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	synaptonemal complex [GO:0000795]	synaptonemal complex [GO:0000795]; SUMO transferase activity [GO:0019789]; reciprocal meiotic recombination [GO:0007131]	SUMO transferase activity [GO:0019789]	LEHMCQIVIFQQMQMER	11.68999958	2252.228704	0	12.68474	12.88664	10.06494	12.17849	12.04702	0	0	0	0	11.559	11.91921	0	8.548022	11.06038	0	18.81647	14.59958	14.27135	13.45337	13.05861	0	0	13.73548	10.41298	13.56805	0	0	13.81611	18.18298	13.04149	0	12.2691	0	12.93665	14.92777	10.9038	16.41986	11.02296	0	11.69294	10.03338	11.25669	0	15.4039	9.010627	0	12.83753	0	13.88733	0	17.46248	13.52228	12.92191
A0A669CGL8	A0A669CGL8_ORENI		regulation of ion transmembrane transport [GO:0034765]	Si:ch211-113j13.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; inward rectifier potassium channel activity [GO:0005242]; regulation of ion transmembrane transport [GO:0034765]	inward rectifier potassium channel activity [GO:0005242]	ASEGNESEEATGFDRSPK	13.61999989	1910.367115	16.3072	15.66367	14.07806	15.37257	16.36079	16.53831	14.62993	15.82411	15.77912	0	14.46192	15.56714	17.70271	17.70018	15.49656	0	17.11269	18.86169	0	17.96294	0	17.4364	19.07383	14.61906	15.92156	0	15.08965	0	17.94613	0	17.45368	17.40229	15.58313	15.2628	18.4661	0	0	16.62975	0	16.14479	16.11527	16.2617	16.02085	15.43735	0	16.2924	15.50325	15.46974	17.9052	19.43824	19.04883	14.90803	0	0
I3JDA1	I3JDA1_ORENI		signal transduction [GO:0007165]	Si:ch211-114m9.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; signal transduction [GO:0007165]		KLAPVPPK	11.75	848.1290148	14.26165	14.90596	13.57281	0	16.96841	15.36152	0	16.58389	14.11774	13.95367	15.46516	16.6738	0	0	15.30578	0	0	0	16.45282	0	0	16.35393	16.42763	0	16.0218	15.88305	16.80517	16.00081	14.90377	16.53828	0	17.47881	14.96807	15.57573	0	0	0	0	0	0	0	0	0	0	0	16.71059	0	15.28767	0	0	0	0	17.5952	0
A0A669BFD8	A0A669BFD8_ORENI			Si:ch211-130m23.5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LTQYLQLCDRESEPVR	6.610000134	2006.701651	12.47276	0	8.999215	12.02592	11.72453	0	0	13.81232	0	0	0	0	0	0	0	0	0	13.13779	0	0	12.85942	9.688684	0	18.75543	14.6271	0	0	0	0	0	0	0	13.53188	15.0712	0	0	0	0	0	0	0	0	8.636703	0	0	12.17976	0	13.99323	0	15.88299	0	0	0	0
I3KDP3	I3KDP3_ORENI			Si:ch211-132g1.7	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		IVESTKEMGTVAVTPTGK	12.69999981	1863.839856	13.81134	0	10.8751	10.67813	0	0	10.64339	6.583843	7.944282	0	16.40681	14.41935	13.26366	11.29016	14.13567	12.26255	12.97734	12.01146	0	8.941274	0	13.21874	13.60172	12.70778	11.7902	14.94982	14.39996	0	13.52879	0	0	0	0	0	11.86889	0	11.3874	13.23257	13.45697	0	0	12.74698	0	0	12.61768	0	13.59446	13.23379	0	0	9.337715	12.29507	0	0
A0A669BCG0	A0A669BCG0_ORENI			Si:ch211-146m13.3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; junctional membrane complex [GO:0030314]	integral component of membrane [GO:0016021]; junctional membrane complex [GO:0030314]		DLTLSPPLK	3.74000001	983.0119683	10.6572	13.12265	12.75447	12.15049	13.20654	0	0	0	0	13.56973	14.66271	9.002273	13.99627	13.75745	13.20518	13.98784	12.592	10.59719	0	0	12.14836	15.11298	13.94138	10.19212	11.16837	13.90415	14.31624	11.92615	14.19715	14.58993	12.88333	14.44525	13.9657	0	11.17156	17.4341	11.96903	15.66397	13.9297	13.55017	10.0663	0	0	12.18082	0	0	11.07032	0	0	13.20247	13.22952	0	0	0
A0A669D388	A0A669D388_ORENI			Si:ch211-156b7.4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AKVSDPAQFAQK	2.079999924	1288.498086	10.19697	13.71353	12.43532	0	0	0	0	11.80733	0	17.08233	0	0	13.09947	0	0	14.05022	0	12.76549	0	11.5569	6.449753	11.60147	0	8.741419	8.128464	12.29742	5.190365	0	11.3643	0	0	0	14.89714	13.4493	0	0	13.46733	13.63596	13.2156	14.41259	11.18931	11.63782	8.831367	12.61357	0	9.009243	12.91114	0	0	0	0	0	0	0
I3IUQ6	I3IUQ6_ORENI			Si:ch211-15p9.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; protein serine/threonine phosphatase activity [GO:0004722]	metal ion binding [GO:0046872]; protein serine/threonine phosphatase activity [GO:0004722]	WSAEMLSR	3.930000067	979.1400653	13.20554	14.68331	14.2681	17.3905	13.05308	0	13.86696	10.35144	16.64674	11.98669	14.97061	14.20282	14.87574	14.32946	0	8.216106	0	13.35012	13.61023	0	0	9.817327	0	15.24422	13.92576	15.80052	14.2415	13.11272	5.488381	13.87959	12.86591	14.42154	14.41651	13.62066	14.42025	0	14.47311	15.24721	13.15842	14.27045	0	12.49713	14.45235	13.03212	14.59785	0	13.29643	14.07275	11.95282	11.13903	14.22778	14.11348	14.97185	0
I3K5J0	I3K5J0_ORENI			Si:ch211-168d1.3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]	GTPase activator activity [GO:0005096]	RSIFGGMVQDFLLEQR	10.55000019	1908.394121	11.14699	14.89694	14.93208	12.70227	12.97213	0	13.66538	14.07873	0	0	13.21815	14.09261	0	10.44705	15.93241	16.19034	0	20.24633	0	16.33612	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.36414	0	0	0
I3KU61	I3KU61_ORENI		cell adhesion [GO:0007155]; signal transduction [GO:0007165]	Si:ch211-176g6.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cell adhesion [GO:0007155]; signal transduction [GO:0007165]		RAVTDSALR	2.940000057	988.9175186	11.21251	11.95895	12.87582	10.76243	13.47135	0	14.16019	0	15.02263	14.46593	14.87673	12.70505	14.6186	0	0	19.97312	18.20287	0	0	0	0	0	0	0	14.80227	0	0	0	0	0	17.47731	0	0	14.43143	0	0	0	13.89699	13.72734	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KQY8	I3KQY8_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	Si:ch211-195d17.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	"nucleus [GO:0005634]; transcription regulator complex [GO:0005667]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; protein dimerization activity [GO:0046983]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]; metal ion binding [GO:0046872]; protein dimerization activity [GO:0046983]	TDLGTRR	12.46000004	818.5664111	14.10996	12.56895	0	14.69277	15.17692	0	0	15.58384	0	17.08358	16.16336	14.43984	0	13.51449	0	14.75156	13.909	11.62904	0	0	0	0	0	14.60318	9.865332	12.97482	0	0	13.38697	0	14.36497	0	16.05668	15.38517	0	15.52877	13.28072	14.16533	13.05476	13.90538	0	0	0	16.0305	14.75968	0	14.91663	0	0	0	0	0	0	13.8609
A0A669BRZ4	A0A669BRZ4_ORENI			Si:ch211-214e3.5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KNSESQEAQR	5.449999809	1177.290353	14.72142	0	0	0	13.5014	0	0	0	0	0	16.98115	0	0	14.2936	0	11.99833	0	0	0	14.69203	0	14.00696	0	14.79748	15.40759	0	14.40871	0	12.78913	0	17.8707	18.02354	18.39783	0	0	0	14.31206	0	0	15.36996	0	0	0	0	15.16677	15.03997	0	0	0	16.31998	14.52	0	0	14.70696
I3IWJ1	I3IWJ1_ORENI			Si:ch211-214j24.15	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]	GTP binding [GO:0005525]	CQAGQEMVLGR	8.729999542	1247.844718	14.89591	12.91821	13.22349	0	14.56936	15.18561	0	15.31182	9.665097	15.56659	14.53112	14.66755	14.87996	13.90441	14.26122	0	15.49994	15.13468	12.56223	13.10459	14.32452	17.35993	14.33421	13.38173	11.43404	14.80829	0	14.25241	0	14.14479	16.63401	15.59291	0	16.01612	0	15.10613	16.17661	0	0	15.38359	0	12.88666	15.05876	15.89683	14.3933	15.22085	0	15.3579	0	15.73212	13.35289	14.34704	15.08489	0
A0A669BQB3	A0A669BQB3_ORENI			Si:ch211-220f12.4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GTLQAILQELRAMR	9.140000343	1616.978607	17.75306	0	15.83374	0	0	0	17.16239	17.66103	0	16.46166	16.2951	13.89021	16.37883	17.95977	14.45586	0	14.3214	17.50431	17.18981	14.03103	14.40414	14.43569	0	17.36329	15.89178	0	17.17101	15.31857	14.87708	16.31121	15.88532	15.33488	14.70277	14.8041	17.07455	16.84854	0	16.3419	0	0	17.21923	0	0	18.01454	0	0	16.53173	0	0	18.8364	0	18.3505	0	0
A0A669BAJ2	A0A669BAJ2_ORENI			Si:ch211-226m7.4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LQFTRKPK	10.97000027	1017.15911	13.11118	14.98459	0	14.09056	13.95996	15.4949	12.86955	0	13.60069	15.29316	13.24089	14.87617	11.29684	13.20373	14.76789	0	14.39427	14.20918	12.75584	14.64548	0	14.08495	13.48077	0	0	0	13.83312	16.64159	0	0	0	0	15.74379	0	0	13.26373	13.5172	11.81059	0	13.97181	0	13.28583	13.53808	13.41544	12.23049	13.06783	13.82309	12.88708	12.70235	15.7868	14.07993	17.51275	13.03534	0
A0A669CUR4	A0A669CUR4_ORENI		multicellular organism development [GO:0007275]	Si:ch211-232b12.5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; multicellular organism development [GO:0007275]	DNA binding [GO:0003677]	KMFNTVFQGGAPQK	3.730000019	1551.615221	0	11.70017	13.85378	16.78773	13.97435	0	10.72469	12.80582	15.1621	14.08861	10.30598	12.49703	14.80636	15.4544	16.53184	0	15.85064	0	13.8197	15.27474	0	0	0	0	13.89041	0	15.7069	0	0	0	15.25975	0	0	0	15.37326	0	0	0	0	0	16.75126	0	0	16.39325	0	0	0	0	15.54243	0	16.84553	17.01175	15.89649	0
A0A669E6N3	A0A669E6N3_ORENI		multicellular organism development [GO:0007275]	Si:ch211-236k19.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; multicellular organism development [GO:0007275]"	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]"	QHSSCYVKNK	10.77999973	1250.722962	12.55712	0	0	0	14.73411	0	7.733091	0	0	13.17711	11.33461	0	14.28557	0	0	17.51656	0	15.75561	9.870624	11.6131	0	12.81307	12.3335	0	0	0	11.90537	0	0	11.25645	0	0	0	0	0	0	0	12.03006	0	0	0	0	10.8476	10.46188	0	0	0	9.936665	0	14.279	9.903502	12.80838	0	0
I3JV53	I3JV53_ORENI			Si:ch211-242b18.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]	cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]		MSPPSK	1.5	661.7267926	18.32936	16.65264	18.54263	15.34812	18.83569	15.50786	16.96742	17.00639	0	0	16.2352	15.97358	0	16.12808	0	18.28956	0	0	0	0	0	16.51054	17.48709	15.8471	16.56421	0	15.07616	0	0	0	16.68781	0	15.65936	14.58361	0	15.64963	0	0	15.02716	0	14.8897	0	15.10432	16.82589	0	0	18.40736	15.22196	0	18.94119	19.05996	0	15.75211	0
A0A669F7K8	A0A669F7K8_ORENI			Si:ch211-250n8.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GLQQPVLSLVHR	4.550000191	1347.687445	0	0	0	0	11.18436	16.85449	0	0	11.79073	0	0	0	0	0	12.80909	11.4808	0	10.14941	16.6059	0	0	0	0	0	12.95994	13.58124	0	0	0	0	0	12.90518	0	0	0	0	11.42827	0	0	0	0	0	0	11.1805	0	0	10.60758	0	12.91157	0	13.9151	0	15.68673	11.38927
A0A669DWY7	A0A669DWY7_ORENI			Si:ch211-253p14.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SGSVWTFLLQLPK	10.75	1474.889619	15.36447	13.43959	10.84981	12.05956	15.49575	15.25561	0	15.09785	15.61226	14.65246	14.23436	15.93624	0	0	0	0	15.0277	0	15.59993	0	14.257	0	16.31025	14.45514	0	0	16.54917	0	0	15.51079	0	15.45794	17.14026	15.91237	0	13.82703	15.40955	13.61436	14.14137	0	13.91529	14.40771	0	17.14835	15.37196	14.0976	14.71643	13.06107	7.854077	13.80699	16.39527	0	15.77818	0
A0A669E6W2	A0A669E6W2_ORENI		tRNA aminoacylation for protein translation [GO:0006418]	Si:ch211-256m1.8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"aminoacyl-tRNA ligase activity [GO:0004812]; ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; transferase activity, transferring acyl groups [GO:0016746]; tRNA aminoacylation for protein translation [GO:0006418]"	"aminoacyl-tRNA ligase activity [GO:0004812]; ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; transferase activity, transferring acyl groups [GO:0016746]"	DIHIIPR	1.289999962	863.0941333	13.71746	16.48439	15.77498	0	13.90656	13.53711	15.07592	0	12.63978	15.67161	0	0	17.15707	10.64075	12.78634	14.10156	10.49838	11.41847	13.83664	10.86841	13.4572	0	14.42563	11.98812	14.46766	13.30308	0	0	16.60941	13.42166	15.71479	16.56829	16.0985	11.55784	0	17.27516	0	12.84184	13.93642	10.64972	10.96693	14.4119	13.3411	13.60572	11.14152	13.35144	15.62963	0	15.5949	14.29757	14.49106	0	10.7802	11.58772
I3JZU9	I3JZU9_ORENI		intracellular signal transduction [GO:0035556]	Si:ch211-265o23.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		intracellular signal transduction [GO:0035556]		QLLHDISSSKR	7.190000057	1282.384029	14.1415	0	11.96582	15.75598	0	0	16.51541	15.58284	14.44385	16.43623	0	0	0	0	0	0	0	14.52429	0	0	0	0	0	0	0	13.73684	0	0	0	13.66238	21.95266	21.89702	13.66291	12.23676	0	0	0	15.37236	0	12.98989	13.46094	0	14.49004	0	13.68671	19.97337	0	0	15.59546	0	0	0	0	0
A0A669DWI4	A0A669DWI4_ORENI		embryonic skeletal system development [GO:0048706]	Si:ch211-285f17.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		embryonic skeletal system development [GO:0048706]		HTLGGAR	1.110000014	712.1233964	12.39691	14.80054	15.06779	14.11033	0	14.70149	0	0	14.937	0	15.0703	0	13.29489	13.04488	0	13.07725	0	0	15.32306	0	0	14.04144	14.52953	0	0	15.77831	0	0	0	0	0	16.33358	0	0	0	0	0	0	0	0	0	0	0	15.89852	0	15.41887	0	0	0	0	0	0	14.64129	0
A0A669EXL6	A0A669EXL6_ORENI			Si:ch211-288d18.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				IISHQPDSISPDQSPSK	3.069999933	1837.296625	12.04824	12.22867	0	13.49915	13.838	0	0	15.54175	11.49141	0	13.8688	14.44947	15.69376	13.63146	0	0	14.35052	0	0	0	0	0	0	0	0	14.92777	14.30323	16.14473	14.63232	0	16.24707	14.86802	0	12.96628	14.08275	14.0941	0	0	0	16.26898	0	14.19013	13.63126	0	0	0	0	0	0	14.89055	0	0	15.59415	14.91635
I3IYF8	I3IYF8_ORENI			Si:ch211-63o20.7	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	TNSGSRLQDR	6.110000134	1133.533401	12.67585	12.47976	12.10403	0	12.15376	0	0	0	0	0	9.760303	12.51881	14.03247	17.85851	0	0	0	0	0	14.37828	0	0	0	0	15.13706	11.03499	0	12.86844	0	0	15.05544	15.54759	15.53075	11.15667	0	0	0	9.684743	0	0	13.24839	0	0	0	0	0	13.46359	12.99513	0	0	0	0	0	0
I3KT63	I3KT63_ORENI			Si:ch73-194h10.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; myosin complex [GO:0016459]	cytoplasm [GO:0005737]; myosin complex [GO:0016459]; actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	GGQEQHAPWRLIFR	13.23999977	1695.152368	0	0	16.84722	16.77831	0	0	0	0	17.09104	16.82864	0	0	0	0	0	0	0	0	0	0	16.50442	0	0	12.79738	0	0	0	0	0	0	17.54625	14.2298	18.17312	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.85238	0	0	0	0	0
I3K7X1	I3K7X1_ORENI			Si:ch73-290k24.5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QVSAAMEMMEK	1.940000057	1269.171285	12.14839	0	14.23497	0	13.69034	14.33423	13.77132	0	0	14.43904	0	14.65954	14.01524	13.62954	14.25919	14.91191	0	0	14.9255	12.9513	0	0	14.90182	0	0	0	0	0	0	0	0	0	18.01965	0	15.24916	0	0	0	0	0	0	0	0	16.71019	0	0	0	0	0	0	0	0	0	0
A0A669DP67	A0A669DP67_ORENI		insulin receptor signaling pathway [GO:0008286]	Si:ch73-335l21.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		insulin receptor binding [GO:0005158]; insulin receptor signaling pathway [GO:0008286]	insulin receptor binding [GO:0005158]	ESAMSAGSAGGGGGYLDVAGEFK	5.420000076	2134.979413	13.16116	12.16753	12.74815	0	0	12.28075	13.21652	0	12.39283	11.3128	18.00673	6.017379	0	13.97847	0	0	12.15793	11.38028	10.93661	0	14.35437	0	11.48623	13.01949	0	13.67767	14.34846	13.79815	0	17.4208	13.5035	15.24337	0	14.30092	13.32676	10.04954	11.38934	13.65239	12.09535	11.53134	9.771997	11.52592	12.80497	14.38259	11.40449	13.38288	13.08936	0	15.05859	0	15.2919	17.87946	13.25858	11.86447
I3J2Z3	I3J2Z3_ORENI			Si:ch73-335m24.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; carbohydrate binding [GO:0030246]	carbohydrate binding [GO:0030246]	FHPTQGMNHSFSLSVYLHSILK	11.48999977	2559.039075	11.86001	0	13.97905	0	0	11.8655	13.8029	13.63834	13.89386	0	16.31586	0	14.67687	13.96329	12.39564	0	11.30982	0	12.29367	5.352578	13.73491	0	13.89493	14.62907	0	14.49519	13.61248	0	0	12.2048	13.37706	14.93053	0	0	12.76324	11.56696	0	11.3311	13.89312	11.20387	0	0	13.50854	0	0	13.22726	0	11.09808	14.23159	0	0	0	14.35842	0
A0A669BMM4	A0A669BMM4_ORENI		homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	Si:ch73-379j16.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	calcium ion binding [GO:0005509]	GQPPMTTDCR	5.849999905	1161.534716	12.46054	0	14.32096	11.7302	0	0	0	0	0	13.06478	0	0	0	0	0	0	0	0	0	12.93123	0	0	0	0	14.60532	0	0	0	0	8.465446	0	0	0	12.6486	0	13.96271	12.23414	0	13.46985	0	0	14.0309	0	11.18236	0	15.53066	10.48984	8.001301	0	0	14.75599	0	0	0
I3KSY5	I3KSY5_ORENI			Si:ch73-389b16.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				HTEQYNGGMSK	1.179999948	1268.185647	15.39578	15.9812	16.11572	15.32452	15.06696	15.20165	15.79014	15.11626	13.89237	16.27003	14.54332	15.65129	16.18875	12.63445	0	15.89428	16.26225	15.6893	14.61086	13.95055	14.02346	12.41448	16.46478	9.450279	15.34864	16.79407	13.39168	0	14.85928	13.77484	16.97654	17.24463	0	0	14.35401	14.95507	14.50327	15.85537	0	0	15.35297	15.62017	13.16616	14.76617	15.59511	0	16.5338	15.58247	9.996842	17.45431	0	0	15.98166	0
I3JK17	I3JK17_ORENI			Si:ch73-60h1.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	AARFSHMDTTQR	9.850000381	1437.714558	0	14.49232	16.40601	0	13.49542	0	12.7828	15.28006	11.74362	14.87978	0	0	0	0	0	0	0	0	15.21182	0	0	0	0	0	0	0	0	0	0	0	13.22934	0	16.80669	14.14744	15.34752	0	0	0	0	0	15.40851	0	0	0	0	0	14.90816	0	0	13.64091	0	16.6953	14.53122	0
I3JLS7	I3JLS7_ORENI		homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	Si:ch73-74h11.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	desmosome [GO:0030057]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	desmosome [GO:0030057]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; calcium ion binding [GO:0005509]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	calcium ion binding [GO:0005509]	ETYDFYR	3.900000095	993.0581756	0	14.92022	14.12927	13.06086	15.08447	13.58564	0	13.42601	0	0	14.20058	13.83862	15.16455	0	19.27758	0	10.93806	14.29442	13.92563	9.959698	0	0	15.05259	0	14.52203	0	0	0	0	0	13.71482	11.93173	0	15.09249	0	0	13.98019	0	11.8774	0	12.29336	11.39941	0	0	0	9.67706	12.69617	0	13.86772	12.38337	14.16573	0	13.86093	0
A0A669F9V5	A0A669F9V5_ORENI			Si:dkey-119f1.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]	chromosome [GO:0005694]		VDEAEKK	4.920000076	818.3601847	0	0	15.73823	0	14.70776	0	15.09808	14.73963	15.61639	16.0574	15.78092	17.34194	15.11172	15.87552	11.54733	14.6204	0	13.31004	15.86763	13.46286	0	15.63006	15.40585	0	15.93516	0	0	0	0	0	18.07496	19.0685	19.10419	15.64539	0	14.66246	14.95368	14.50045	15.73722	15.74634	15.15546	14.51395	14.60103	16.83758	14.58234	0	0	14.30815	15.38027	16.77554	15.77485	0	16.2438	13.90616
I3JSM2	I3JSM2_ORENI			Si:dkey-16l2.16	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	NDDPSKK	15.30000019	802.4342254	18.27878	0	17.31914	0	0	16.51299	15.96219	0	15.03602	16.24245	14.67794	0	15.71523	15.93382	0	0	0	0	15.16849	0	0	0	0	0	13.54116	0	0	0	0	0	0	15.01244	0	13.92972	10.22288	0	0	0	0	0	0	0	0	12.09923	13.56159	13.77434	12.52426	0	13.25874	13.91683	14.97122	0	0	0
I3J4G7	I3J4G7_ORENI		regulation of Rho protein signal transduction [GO:0035023]	Si:dkey-172h23.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cAMP-dependent protein kinase activity [GO:0004691]; regulation of Rho protein signal transduction [GO:0035023]	cAMP-dependent protein kinase activity [GO:0004691]	SLTVGILPQAGCGK	9.180000305	1401.619563	0	0	0	0	0	15.8481	0	0	0	0	0	15.97999	0	0	14.83849	0	12.74419	0	0	13.80893	0	0	0	13.05744	14.02204	0	14.92757	13.84106	0	13.95446	0	0	17.05904	0	0	0	0	0	0	0	0	14.82977	0	0	0	0	0	16.24663	0	12.89127	0	0	0	12.78824
A0A669B219	A0A669B219_ORENI			Si:dkey-175m17.7	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; MAP kinase tyrosine/serine/threonine phosphatase activity [GO:0017017]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]; protein tyrosine phosphatase activity [GO:0004725]	MAP kinase tyrosine/serine/threonine phosphatase activity [GO:0017017]; protein serine phosphatase activity [GO:0106306]; protein threonine phosphatase activity [GO:0106307]; protein tyrosine phosphatase activity [GO:0004725]	GGGGGGFSNSLGR	4.949999809	1123.091854	13.07249	0	16.6573	0	0	0	0	0	9.668746	9.440823	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20.76754	0	21.27903	0	15.47794	0	0	0	0	0	0	0	0	0	0	16.47452	0	16.50349	0	0	0	0	0	0
A0A669BID2	A0A669BID2_ORENI		metabolic process [GO:0008152]	Si:dkey-183c6.8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"hydrolase activity, acting on glycosyl bonds [GO:0016798]; metabolic process [GO:0008152]"	"hydrolase activity, acting on glycosyl bonds [GO:0016798]"	LYNIRPYHSKDK	3.839999914	1528.035737	13.32572	14.26887	0	13.01584	13.29056	0	15.14495	15.76532	0	0	12.89277	0	0	10.67166	0	13.57009	0	0	15.83443	0	14.87923	15.28175	0	14.13904	0	15.75043	14.75558	0	15.42077	0	12.3726	16.03772	0	14.41782	0	15.87347	15.58619	13.51785	0	0	0	0	14.88292	13.85905	15.00792	0	0	0	0	0	0	16.99502	14.67705	0
I3K9Y9	I3K9Y9_ORENI			Si:dkey-193c22.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		EVIFKLDEGPK	8.670000076	1274.737889	16.59572	14.74266	0	14.96939	15.39447	15.59007	15.19687	16.48784	0	0	0	15.67092	16.02421	15.91894	0	16.98796	15.15644	15.13811	16.12687	15.08368	0	16.73167	0	17.91342	16.27626	16.49111	16.66716	15.05248	0	0	17.40915	16.7909	16.48847	14.17922	16.20397	14.15687	15.46955	0	0	14.74065	16.3529	15.00095	15.67092	0	9.72507	0	0	0	18.68281	0	0	15.07237	0	15.94791
A0A669BUU5	A0A669BUU5_ORENI		miRNA mediated inhibition of translation [GO:0035278]	Si:dkey-217f16.6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		nucleic acid binding [GO:0003676]; miRNA mediated inhibition of translation [GO:0035278]	nucleic acid binding [GO:0003676]	GGGGYR	7.489999771	565.4545155	0	15.85796	0	15.54405	0	0	14.98923	0	15.63576	0	0	0	0	15.32514	16.509	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.47507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.88578	0	0	0	0	0
A0A669BVR2	A0A669BVR2_ORENI			Si:dkey-219e21.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VFFLHSEEAMMEMK	5.21999979	1759.043618	15.83323	15.53027	13.88498	15.53661	17.11362	16.6338	0	0	0	17.27729	0	0	12.8116	11.01439	0	0	0	0	0	0	0	10.75697	0	15.53182	12.40887	12.19489	9.222369	0	12.99845	12.26246	14.61139	0	15.28778	0	13.45951	0	15.92883	0	0	0	13.48708	11.50704	11.59432	0	0	0	0	0	11.86346	12.12688	14.74066	14.47863	0	0
I3KVI8	I3KVI8_ORENI			Si:dkey-220f10.4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NPSQTPK	11.06999969	771.1953755	12.79421	0	18.71498	16.6625	0	15.07101	0	0	17.99596	15.51993	18.20591	16.74589	0	0	17.08515	0	17.05386	14.80103	0	16.854	16.95709	16.95848	18.4328	15.50324	15.78677	16.84593	17.2494	17.89472	18.46855	0	16.12061	16.84476	16.05615	15.21274	0	0	0	0	15.52692	15.64456	19.55823	14.22703	18.66058	17.10387	0	17.57123	0	16.37611	17.20064	0	15.0494	0	15.79399	16.62502
A0A669ENR4	A0A669ENR4_ORENI			Si:dkey-222n6.2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	keratin filament [GO:0045095]	keratin filament [GO:0045095]		MDGWMDGWMDGWMTIDVR	4.980000019	2218.543417	0	0	0	0	0	14.50542	12.92808	12.83324	0	15.40786	10.91476	13.71417	0	13.56561	0	14.17642	12.30851	0	0	13.53306	0	9.581093	15.5057	0	0	0	0	0	9.595511	11.91829	0	0	14.21901	12.68258	0	0	12.98189	0	13.92922	0	0	0	17.41637	0	0	0	0	0	14.36195	0	0	0	15.46001	0
A0A669ECS5	A0A669ECS5_ORENI		chromatin remodeling [GO:0006338]	Si:dkey-226m8.10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	SWI/SNF complex [GO:0016514]	SWI/SNF complex [GO:0016514]; ATPase activity [GO:0016887]; chromatin remodeling [GO:0006338]	ATPase activity [GO:0016887]	GKPADDDVFR	9.819999695	1119.595853	9.538074	12.0578	0	11.78003	15.74597	13.44451	12.8973	0	16.27395	13.68625	14.76682	11.94326	14.1261	14.54724	14.92732	0	0	15.03129	0	0	14.78802	0	0	0	0	0	0	0	0	19.44644	16.76507	0	0	0	0	0	0	0	13.2264	13.8401	0	15.00013	0	16.55891	0	0	10.1496	12.95303	15.02262	14.6775	0	14.7369	0	0
I3KCR3	I3KCR3_ORENI			Si:dkey-266m15.5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VFLLLFR	27.63999939	906.9065411	15.67172	15.95573	15.55389	13.67418	15.48188	0	0	0	13.34755	0	0	15.72376	0	0	0	17.00435	16.19481	15.75628	16.1819	15.32521	17.39942	0	0	0	0	0	0	0	15.926	16.6521	0	17.39676	0	0	0	15.33184	0	0	0	0	0	15.08597	0	0	16.77468	0	0	0	15.6576	0	15.87501	0	0	0
I3K1V1	I3K1V1_ORENI			Si:dkey-48p11.3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				RQMEEAPAGR	8.479999542	1160.070047	14.17277	0	0	13.37503	13.88012	11.55657	0	0	14.10004	15.51768	17.23553	13.66479	9.492759	16.70205	11.7356	13.43008	0	0	16.80171	18.91476	13.64711	0	11.67018	18.52052	13.28012	14.67441	13.97183	12.7368	0	11.16782	11.92867	12.28386	13.31067	15.28462	13.24126	0	12.12771	13.03132	12.7171	0	0	0	16.89264	0	13.65978	12.74434	0	14.11937	0	0	10.9516	13.29737	0	15.27815
A0A669BTG5	A0A669BTG5_ORENI			Si:dkey-54n8.4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VLACSGHDGLFSSPSSTR	1.110000014	1878.633806	14.9475	12.31186	12.53284	0	0	0	11.60305	15.63101	0	13.41321	0	0	13.82057	14.22921	13.10657	14.81551	0	0	15.97236	11.17747	12.62822	0	13.13892	0	0	0	11.95256	0	0	13.9951	14.2194	14.4956	17.34339	14.36593	14.51359	14.02518	11.239	12.61598	0	13.41567	10.98765	16.25695	8.826633	9.090784	9.79671	0	13.99065	14.92094	14.89328	12.82268	15.65835	0	0	15.25734
I3J869	I3J869_ORENI		endocytosis [GO:0006897]	Si:dkey-88l16.3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium ion binding [GO:0005509]; endocytosis [GO:0006897]	calcium ion binding [GO:0005509]	NILKCR	8.159999847	804.4739528	15.01748	12.96913	13.45571	16.8424	14.61522	14.43345	15.99806	16.49804	14.59579	15.8792	15.27452	16.89777	16.44137	16.40558	14.98972	15.4753	14.86563	13.47385	16.16067	14.69748	15.5655	15.30471	16.04961	15.77444	16.44093	15.58001	16.08564	16.35993	16.6729	14.83174	0	15.91337	0	0	16.53521	16.52864	0	12.50864	14.20089	16.35912	14.62267	14.05169	15.92723	15.52372	15.16778	15.19354	15.61825	15.18657	16.69496	16.28094	15.79251	16.7022	18.52857	17.01481
A0A669DKJ5	A0A669DKJ5_ORENI			Si:dkey-93h22.7	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		TNPQDSGSYK	6	1096.572546	13.66413	0	13.99568	14.08863	15.04751	15.0385	14.27185	16.05514	0	14.16859	0	13.50315	14.24697	15.7875	15.11882	0	16.30134	0	12.42521	13.89247	0	13.96441	15.28195	14.24428	0	0	0	15.61722	0	15.40039	17.89984	0	16.45783	0	0	15.80029	0	0	0	15.91452	0	0	16.33539	0	15.4352	15.71553	0	0	14.49135	0	0	0	0	15.48756
I3JNA7	I3JNA7_ORENI			Si:dkeyp-69e1.8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]	GTP binding [GO:0005525]	ALDVLK	3.579999924	658.5120183	13.56064	0	13.57901	6.547617	12.36662	15.39549	0	0	0	0	15.89802	14.32885	13.59365	8.650173	14.02988	0	15.86885	11.71911	14.39769	0	14.5158	0	0	15.48493	11.20376	11.12374	13.23401	9.787739	10.22475	0	0	17.74054	14.86289	15.91671	14.85493	0	12.48967	15.25113	0	14.45507	0	11.96841	14.78866	0	0	0	0	0	0	15.89876	15.74163	0	14.87325	0
I3K5M9	I3K5M9_ORENI			Si:dkeyp-77h1.4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		DVHLMR	3.400000095	784.2623839	9.707383	12.83181	13.40837	11.16374	13.44002	13.32278	14.15426	14.92608	14.27126	9.753171	14.33803	15.46769	13.30637	13.4633	13.66207	13.59328	8.108231	0	14.85971	0	11.89902	13.04626	13.54706	13.15515	14.87182	13.05324	13.08216	14.41451	8.638132	11.33522	16.99857	17.57673	16.39932	12.48232	12.51904	15.61892	0	14.2709	15.03473	13.28805	13.29043	14.46556	12.59431	11.14732	14.80188	12.38596	13.86624	13.90468	15.17132	14.93195	14.99272	13.79794	16.03416	12.28172
I3J5F7	I3J5F7_ORENI			Sidekick cell adhesion molecule 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LNDSDSR	17.42000008	807.0227021	17.76522	0	18.59339	0	0	0	15.30231	0	0	0	0	16.39669	16.22653	16.72716	0	0	14.42286	0	14.81442	0	0	0	15.73064	0	0	20.22252	0	0	13.81606	0	0	0	14.23874	14.70533	0	14.43026	0	18.74683	13.99433	0	0	0	0	0	0	0	13.6559	0	0	0	0	0	0	0
I3J8L2	I3J8L2_ORENI	sigmar1		Sigma 1-type opioid receptor (Sigma non-opioid intracellular receptor 1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; nuclear inner membrane [GO:0005637]; nuclear outer membrane [GO:0005640]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; nuclear inner membrane [GO:0005637]; nuclear outer membrane [GO:0005640]		QWKEGTTK	7.340000153	977.0815792	9.757666	10.97871	10.26592	13.52767	0	13.74247	15.18619	0	14.26886	0	15.32215	13.27871	13.37383	14.69797	13.25144	12.92684	0	14.21354	11.07605	14.64133	10.58269	13.80342	14.83191	0	0	14.04762	8.496471	7.367434	11.70035	10.31038	14.96894	15.74252	15.34105	14.16249	12.03668	13.06985	0	15.84774	14.52015	14.06138	14.02391	14.44358	13.63821	0	0	13.93918	0	0	0	0	0	14.17622	14.53862	9.226591
A0A669DBQ8	A0A669DBQ8_ORENI	srp54 SRP54	SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	Signal recognition particle 54 kDa protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"nuclear speck [GO:0016607]; signal recognition particle, endoplasmic reticulum targeting [GO:0005786]"	"nuclear speck [GO:0016607]; signal recognition particle, endoplasmic reticulum targeting [GO:0005786]; 7S RNA binding [GO:0008312]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; SRP-dependent cotranslational protein targeting to membrane [GO:0006614]"	7S RNA binding [GO:0008312]; GTPase activity [GO:0003924]; GTP binding [GO:0005525]	NVNPSQMAK	9.619999886	987.114823	0	0	14.9994	0	0	0	0	16.00499	15.8361	13.74756	0	13.97063	15.93591	11.69694	14.55296	14.99306	0	13.68627	14.23574	0	0	14.57409	14.07291	15.1057	16.5276	13.88778	14.67158	0	0	0	0	0	0	12.96005	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.20253	0
A0A669CT78	A0A669CT78_ORENI	srp68	SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	Signal recognition particle subunit SRP68 (SRP68)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"signal recognition particle, endoplasmic reticulum targeting [GO:0005786]"	"signal recognition particle, endoplasmic reticulum targeting [GO:0005786]; 7S RNA binding [GO:0008312]; endoplasmic reticulum signal peptide binding [GO:0030942]; signal recognition particle binding [GO:0005047]; SRP-dependent cotranslational protein targeting to membrane [GO:0006614]"	7S RNA binding [GO:0008312]; endoplasmic reticulum signal peptide binding [GO:0030942]; signal recognition particle binding [GO:0005047]	MAADK	2.450000048	551.0258814	14.59051	14.52488	0	14.24578	13.86762	0	13.75146	13.19217	13.80433	12.38847	14.99371	13.66824	13.27375	13.05183	14.50764	13.31023	14.5343	13.15701	0	14.68953	12.77332	16.79417	0	0	0	0	14.53205	0	13.90528	14.11584	14.26054	15.60419	15.38784	14.54769	14.34528	13.15184	15.39296	13.25386	0	0	12.77368	0	13.60125	0	16.12046	14.07253	14.53284	15.36052	15.07662	0	0	0	14.68985	0
A0A669BAN3	A0A669BAN3_ORENI	srp72	SRP-dependent cotranslational protein targeting to membrane [GO:0006614]	Signal recognition particle subunit SRP72	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"signal recognition particle, endoplasmic reticulum targeting [GO:0005786]"	"signal recognition particle, endoplasmic reticulum targeting [GO:0005786]; 7S RNA binding [GO:0008312]; SRP-dependent cotranslational protein targeting to membrane [GO:0006614]"	7S RNA binding [GO:0008312]	YTFSSFCHVTKACDVLR	7.130000114	2089.837151	12.16233	0	13.44467	13.90189	0	13.39059	9.978065	12.80822	15.48443	0	13.07407	0	0	13.033	10.81565	0	0	11.74033	11.04581	11.42469	10.4875	10.77601	0	13.72276	0	12.37435	18.25635	12.04899	0	15.58169	14.74481	12.24473	11.19412	0	18.21947	14.24658	0	0	12.66595	13.11985	12.34599	11.42608	0	13.94522	14.06765	13.11817	7.921004	13.42117	0	0	0	12.64265	0	11.58694
A0A669BUW9	A0A669BUW9_ORENI	stat3	signal transduction [GO:0007165]	Signal transducer and activator of transcription	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; signal transduction [GO:0007165]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	YTNSGNTSDLFPMSPR	2.269999981	1803.354694	0	14.72891	13.32777	15.06301	15.45771	0	16.77103	14.61702	0	14.55032	16.55532	0	15.61415	16.18052	14.479	13.00988	15.90554	15.45809	14.92159	16.05622	0	13.75755	14.19531	16.84213	15.79547	17.24213	14.62159	17.82924	17.68849	0	18.21379	0	15.38611	14.77806	15.2302	0	14.94094	12.79709	0	0	15.72388	15.55159	0	0	0	0	17.83208	16.85209	0	17.00655	16.33573	18.28352	0	0
I3JVI4	I3JVI4_ORENI			Signal transducing adaptor family member 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signaling adaptor activity [GO:0035591]	signaling adaptor activity [GO:0035591]	QDLNGSVFR	16.79000092	1035.631604	0	0	16.01485	15.71382	0	15.07033	0	0	15.17213	15.72627	16.67072	14.86201	0	0	0	0	0	15.01554	0	15.03962	0	14.48784	0	13.19761	0	15.59025	14.90354	0	14.59736	14.2846	14.67696	0	0	15.28575	15.72727	0	0	0	15.94733	0	0	14.42179	15.67043	0	14.1952	15.69448	15.65133	0	15.45697	15.81144	15.77608	15.24667	0	15.91674
I3J2V0	I3J2V0_ORENI			Signal transducing adaptor family member 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		signaling adaptor activity [GO:0035591]	signaling adaptor activity [GO:0035591]	GVTDPDNQSR	8.630000114	1087.600392	0	11.4639	0	0	0	9.582438	14.24565	12.9915	13.41907	10.54318	0	13.88114	11.9811	0	14.35014	12.34694	0	11.54413	14.06491	0	0	0	19.76336	0	0	0	0	0	11.02261	0	16.97213	15.04292	13.98158	0	14.93055	16.02559	13.71816	0	0	0	0	14.0394	0	0	0	15.24627	12.2974	0	0	0	0	0	0	14.48396
I3JCY4	I3JCY4_ORENI	SIPA1	regulation of small GTPase mediated signal transduction [GO:0051056]	Signal-induced proliferation-associated 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]; regulation of small GTPase mediated signal transduction [GO:0051056]	GTPase activator activity [GO:0005096]	VRDTLLK	8.199999809	845.3265189	0	14.27969	14.76264	14.09047	14.59636	15.74035	14.19463	16.11351	15.45221	15.21086	14.61347	12.4461	14.19407	15.1087	15.88265	14.95044	14.78143	0	15.54959	13.81695	15.38157	14.29713	15.63824	15.34775	14.74252	14.67262	14.93533	0	14.73903	15.45049	16.44571	0	18.07157	14.68037	14.03025	15.76579	14.53244	14.57033	14.49636	14.67272	13.68744	14.95703	14.9316	15.84037	15.74885	15.4268	14.50536	14.85469	14.45583	13.16099	14.76776	15.26776	14.82981	14.93055
A0A669BZ88	A0A669BZ88_ORENI		regulation of small GTPase mediated signal transduction [GO:0051056]	Signal-induced proliferation-associated 1 like 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]; regulation of small GTPase mediated signal transduction [GO:0051056]	GTPase activator activity [GO:0005096]	IGTMGPPVVQGAPVVPKMGVR	1.570000052	2116.768534	0	14.98623	0	13.30101	16.15187	13.97548	0	13.90241	0	14.32983	14.35143	0	0	15.43194	0	0	14.8774	0	13.11353	0	11.18062	12.81478	0	0	0	14.81561	11.88001	16.52335	15.23595	0	16.53351	16.04123	0	11.6248	11.77746	13.31192	12.77546	13.26618	14.34218	15.06653	14.21417	0	12.20533	13.7323	12.46912	12.86503	14.49863	13.28524	13.05516	13.82479	0	0	14.65126	0
A0A669C7R5	A0A669C7R5_ORENI		regulation of small GTPase mediated signal transduction [GO:0051056]	Signal-induced proliferation-associated 1 like 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]; regulation of small GTPase mediated signal transduction [GO:0051056]	GTPase activator activity [GO:0005096]	SNASMSVVEVATEEQATRLER	8.640000343	2308.220758	12.68188	9.271443	12.59381	10.54042	11.29358	10.78561	13.50661	0	10.12913	11.38427	13.59308	12.30871	14.23408	0	10.96569	13.74436	10.5739	9.14447	11.44676	17.47415	14.19931	12.50014	13.12679	0	0	13.47766	18.235	8.862226	0	12.31739	0	0	13.84822	14.47034	13.76239	0	0	13.16029	13.50233	12.52737	12.16936	12.7804	0	12.72868	18.93998	12.28092	12.7171	0	9.35263	0	12.42771	12.36264	10.9902	0
A0A669E0G0	A0A669E0G0_ORENI			Ski_Sno domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GIRGAEAGTR	12.39000034	987.1961645	10.80639	3.260791	12.95743	13.87905	14.58807	10.1551	13.7231	15.22699	12.69526	12.24001	0	13.34408	0	0	0	14.03153	12.54974	10.05833	12.38234	9.976092	14.35783	14.65961	13.95195	15.33655	12.4075	13.25738	9.187066	15.31692	14.52606	0	18.15446	0	18.59019	16.13807	10.88222	14.62697	13.13863	9.998937	9.95429	9.224368	13.45476	12.67275	7.458166	13.0489	14.34858	13.89282	15.42939	13.93866	0	8.847186	13.70228	12.91158	11.96413	13.27468
I3KPN0	I3KPN0_ORENI		cranial nerve morphogenesis [GO:0021602]; positive regulation of axon extension [GO:0045773]	Slit homolog 1a (Drosophila)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; calcium ion binding [GO:0005509]; cranial nerve morphogenesis [GO:0021602]; positive regulation of axon extension [GO:0045773]	calcium ion binding [GO:0005509]	TNPIETSGAR	11.81999969	1044.573947	16.09403	15.83615	15.24443	0	15.67239	16.87007	20.00333	16.40915	15.53501	14.91685	15.40151	15.30311	11.28014	14.61237	16.67298	21.15008	15.38208	13.53073	12.91095	10.97551	0	12.74583	14.05462	0	14.29418	0	0	20.02446	16.5281	12.23665	16.34128	16.2992	14.15188	19.03052	17.0672	14.00137	15.39567	14.6613	14.49319	15.17135	0	14.53227	15.90247	15.44153	15.65471	13.95011	15.42864	15.04526	14.46882	16.28207	15.95974	0	12.69557	0
A0A669E445	A0A669E445_ORENI		multicellular organism development [GO:0007275]	Slit homolog 1b (Drosophila)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; calcium ion binding [GO:0005509]; multicellular organism development [GO:0007275]	calcium ion binding [GO:0005509]	GMEGMRMLMLR	17.06999969	1357.659456	17.51092	18.93084	16.19058	16.63366	16.5158	15.76519	17.27358	18.75908	17.66969	0	13.03312	15.78086	17.91292	17.04286	0	14.84826	17.67829	13.84112	16.702	9.776507	13.35121	12.99394	12.83249	17.09247	18.15201	17.9435	13.88154	0	15.4303	12.50599	15.49789	0	14.23052	0	17.15429	17.90551	0	17.24158	15.90525	0	0	0	17.25253	13.91819	18.30896	9.530419	18.11337	17.93042	13.06757	15.51237	0	0	0	0
A0A669D7G6	A0A669D7G6_ORENI		multicellular organism development [GO:0007275]	Slit homolog 2 (Drosophila)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]; multicellular organism development [GO:0007275]	calcium ion binding [GO:0005509]	LLLTTPSKK	5.03000021	1000.72706	14.26442	0	14.6504	14.66856	15.13034	14.82451	0	0	0	14.94299	14.02446	0	11.65557	14.35345	9.981536	0	7.013271	15.15421	0	11.23101	13.62457	13.97559	0	15.36515	0	14.89361	0	13.12422	0	15.49486	14.41969	0	14.84357	14.27175	16.35087	15.36532	15.22974	13.48232	14.34103	0	14.05148	12.38595	13.68253	13.96646	14.97845	13.88627	0	12.57578	0	14.07207	15.05281	15.3091	14.33266	11.8267
I3KBN3	I3KBN3_ORENI	KRAS	signal transduction [GO:0007165]	Small monomeric GTPase (EC 3.6.5.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; signal transduction [GO:0007165]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	VNKISK	7.760000229	689.2740449	0	14.43936	12.86268	14.23606	15.81319	14.18435	13.45056	14.63072	13.11963	15.59625	16.67333	16.287	15.87071	17.29188	15.73147	16.0532	14.52777	10.79429	15.04904	15.96645	11.89838	13.1747	15.13802	14.67531	0	12.0209	12.42253	13.4006	14.90363	15.81252	16.43614	17.65866	16.6393	16.98979	17.2588	16.28778	15.07313	13.9925	13.81662	11.17416	0	15.04301	14.48598	13.9885	13.22215	15.18178	13.64996	13.12049	15.2975	15.42389	12.86298	0	15.87147	14.80156
A0A669AWU9	A0A669AWU9_ORENI			Snf2-related CREBBP activator protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; nucleosome-dependent ATPase activity [GO:0070615]	ATP binding [GO:0005524]; nucleosome-dependent ATPase activity [GO:0070615]	DTGSVSTTP	7.610000134	863.6505971	15.80937	16.73051	15.40382	0	15.5335	15.07272	15.47182	0	15.01097	15.36814	0	12.83543	16.03769	16.39165	0	15.77746	15.72155	15.79887	15.80097	15.37754	17.02823	0	15.5252	0	16.00415	14.08631	14.73775	0	16.70941	16.15584	15.01716	0	0	0	0	0	0	15.65271	14.58239	15.95363	16.84506	17.03065	14.27481	14.95637	0	16.22236	17.9879	0	0	0	14.29086	15.58398	0	16.59383
A0A669B6I7	A0A669B6I7_ORENI	LOC100698390	regulation of ion transmembrane transport [GO:0034765]	Sodium channel protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated sodium channel complex [GO:0001518]	voltage-gated sodium channel complex [GO:0001518]; voltage-gated ion channel activity [GO:0005244]; voltage-gated sodium channel activity [GO:0005248]; regulation of ion transmembrane transport [GO:0034765]	voltage-gated ion channel activity [GO:0005244]; voltage-gated sodium channel activity [GO:0005248]	RGSLFLPR	7.96999979	946.2993314	14.13653	14.52046	14.29022	14.59003	0	14.33076	16.94166	15.37645	14.21672	15.21835	12.93988	0	13.79585	15.52056	0	0	15.4489	14.69578	15.58325	17.135	0	15.76697	16.36688	13.98642	17.40141	15.22959	0	16.07402	0	0	17.13444	16.35237	0	15.81621	0	15.21761	0	0	15.29158	14.26767	15.3764	15.61374	0	16.54601	0	15.52934	17.58491	0	0	16.73926	18.77543	18.06235	0	16.90876
I3JFX7	I3JFX7_ORENI	scn3b	regulation of ion transmembrane transport [GO:0034765]	Sodium channel subunit beta-3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated sodium channel complex [GO:0001518]	voltage-gated sodium channel complex [GO:0001518]; sodium channel activity [GO:0005272]; sodium channel regulator activity [GO:0017080]; voltage-gated ion channel activity [GO:0005244]; regulation of ion transmembrane transport [GO:0034765]	sodium channel activity [GO:0005272]; sodium channel regulator activity [GO:0017080]; voltage-gated ion channel activity [GO:0005244]	DNPAAPVTE	2.519999981	913.8349916	0	13.40201	0	12.16743	15.79414	10.30194	0	0	12.28457	6.217082	0	11.34353	12.99817	15.04198	12.44089	11.67622	13.92678	14.45758	0	0	10.36915	0	14.37853	10.85825	13.19992	15.21635	13.99863	11.53599	0	15.02159	16.26831	14.25793	15.03683	12.55679	13.8036	14.51804	13.74028	14.66625	13.40802	7.542535	12.6072	0	14.09185	14.37911	11.8714	13.34724	0	14.30919	0	13.67409	13.71368	0	12.18771	13.68937
I3K0U9	I3K0U9_ORENI	slc10a7	sodium ion transport [GO:0006814]	Sodium/bile acid cotransporter	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; symporter activity [GO:0015293]; sodium ion transport [GO:0006814]	symporter activity [GO:0015293]	AVKLSALQPI	15.64999962	1039.051504	0	0	15.92778	16.80085	14.49814	16.45015	14.89212	13.38684	12.9367	13.13072	12.21093	0	14.6353	14.13022	15.28788	0	0	0	14.66621	15.93856	0	0	15.95203	15.05939	0	15.21454	14.23561	15.20466	11.70706	0	0	16.72221	15.34038	14.53166	15.03093	13.82926	14.86403	0	14.2204	15.57061	15.65884	0	0	0	0	0	0	0	15.6709	0	14.13006	15.65601	16.01492	0
A0A669EHN6	A0A669EHN6_ORENI	LOC100692172	regulation of pH [GO:0006885]	Sodium/hydrogen exchanger	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; sodium:proton antiporter activity [GO:0015385]; regulation of pH [GO:0006885]	sodium:proton antiporter activity [GO:0015385]	GKSISQTK	16.02000046	848.7931409	0	0	0	0	12.56846	12.04802	0	14.73124	0	12.55427	12.83818	13.45959	0	0	16.74517	0	0	0	0	9.701468	0	16.0861	16.36091	17.04732	15.89253	13.80393	15.46736	16.57491	15.54534	15.45852	14.56874	15.65339	17.22404	12.72829	0	16.0348	14.18122	16.17067	15.8935	0	14.38574	16.51196	14.56286	17.00247	17.54831	13.56375	0	12.92325	0	0	17.42658	17.2211	0	0
A0A669B5J1	A0A669B5J1_ORENI	SLC28A3		Sodium/nucleoside cotransporter	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of plasma membrane [GO:0005887]	integral component of plasma membrane [GO:0005887]; nucleoside transmembrane transporter activity [GO:0005337]	nucleoside transmembrane transporter activity [GO:0005337]	SDISSCGLR	1.350000024	993.6421903	13.03815	13.34755	13.45358	0	14.52312	0	15.82056	14.56633	0	15.45314	12.72274	14.87596	16.99269	15.11392	14.78395	0	0	13.43072	0	0	14.70169	0	0	14.43173	0	12.38884	0	0	0	13.68597	17.71763	16.13272	0	16.33891	17.56816	0	13.00044	0	0	12.68731	15.46064	0	0	13.53238	11.6284	17.50607	12.97552	13.15768	0	16.00873	14.90674	15.27394	15.36577	0
A0A669C6R3	A0A669C6R3_ORENI	LOC100694151		Sodium/potassium-transporting ATPase subunit alpha	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; potassium transmembrane transporter activity, phosphorylative mechanism [GO:0008556]"	"ATP binding [GO:0005524]; metal ion binding [GO:0046872]; potassium transmembrane transporter activity, phosphorylative mechanism [GO:0008556]"	VISSTTGDRTVMGR	8.649999619	1479.521651	13.59731	13.91187	0	16.20803	0	12.85042	12.22022	14.49984	14.45461	15.06397	14.35756	13.95309	15.46819	15.30968	12.69122	14.92989	15.10637	13.34741	14.41855	0	0	13.253	14.65978	15.00503	14.40917	15.12476	15.55804	14.0754	16.97031	15.50644	12.20869	17.00272	16.37323	0	13.58647	0	0	16.85046	13.7786	0	0	17.09151	16.69987	0	17.01324	0	0	13.80127	0	0	0	16.27441	0	16.09326
A0A669B0P0	A0A669B0P0_ORENI	LOC100694365	potassium ion transport [GO:0006813]; sodium ion transport [GO:0006814]	Sodium/potassium-transporting ATPase subunit beta	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	sodium:potassium-exchanging ATPase complex [GO:0005890]	sodium:potassium-exchanging ATPase complex [GO:0005890]; potassium ion transport [GO:0006813]; sodium ion transport [GO:0006814]		LHPQYLQPLVALQFTNLTR	14.80000019	2251.980762	0	0	13.28563	16.44731	13.80932	0	0	0	0	0	0	0	0	0	0	18.83693	21.33081	0	18.69504	0	19.09831	0	0	0	18.73653	0	0	18.69965	0	12.69691	17.85485	14.04535	0	0	0	0	0	13.09117	15.23286	15.80972	16.42865	14.42318	0	17.08315	0	0	0	10.80508	14.73263	14.37379	15.52329	14.87607	0	0
A0A669DLX7	A0A669DLX7_ORENI		ion transport [GO:0006811]	"Solute carrier family 12 member 10, tandem duplicate 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]; ion transport [GO:0006811]	transmembrane transporter activity [GO:0022857]	SPQTKNMDR	1.879999995	1091.491636	13.71037	12.72997	12.6643	0	13.18742	13.7868	0	15.29244	0	0	12.48257	16.49473	12.30823	0	15.3688	18.01711	15.44082	9.131484	0	0	0	0	0	0	13.83159	15.83732	13.81805	15.03421	15.70927	13.63576	15.94039	0	16.2051	0	0	0	13.90633	0	0	0	0	0	18.26012	0	0	0	0	0	0	0	0	0	0	14.47205
A0A669CCB3	A0A669CCB3_ORENI			Solute carrier family 18 member B1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	NTDNNTTTESTDPPQR	10.31000042	1789.765122	16.16624	14.43543	11.3353	14.55213	0	0	0	0	8.063227	0	0	0	13.79813	0	0	0	8.669463	0	0	14.93546	15.84289	17.6243	12.75374	13.58359	0	13.43555	0	0	0	0	0	16.37585	15.84116	0	0	11.68863	0	12.4887	0	15.02327	0	13.4135	14.72758	12.02729	0	11.78582	0	0	0	0	0	0	0	0
A0A669DP02	A0A669DP02_ORENI			Solute carrier family 2 member 3a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	EESAKMAMEK	4.320000172	1183.223542	13.23013	0	13.04739	11.78709	12.88802	13.05924	0	12.73077	11.81184	0	9.824028	9.276834	0	15.05005	14.95183	0	0	0	16.73339	14.68602	0	16.46302	14.07241	0	13.35861	0	0	13.17958	13.42305	0	18.81729	0	19.15206	14.43805	0	0	0	14.59996	12.55386	17.20287	15.13774	0	0	0	14.60692	11.21338	0	10.36726	13.56772	13.27432	10.73822	16.51785	13.99768	10.88546
I3JTG6	I3JTG6_ORENI			Solute carrier family 22 member 23	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	SKWIMGHIVEK	5.840000153	1343.138573	14.269	0	12.66595	11.70781	12.73439	11.82718	14.97629	0	17.37883	15.2733	0	13.39354	7.283043	0	0	9.981251	0	0	0	0	0	0	0	15.7554	0	0	0	0	14.96478	0	21.51171	18.88111	21.0873	0	0	0	14.09586	0	0	0	0	18.6694	0	0	14.57138	15.94565	0	18.18306	17.22186	0	0	13.78946	0	0
A0A669DTR7	A0A669DTR7_ORENI	SLC26A9	bicarbonate transport [GO:0015701]	Solute carrier family 26 member 9 (Anion transporter/exchanger protein 9)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; anion:anion antiporter activity [GO:0015301]; chloride channel activity [GO:0005254]; secondary active sulfate transmembrane transporter activity [GO:0008271]; bicarbonate transport [GO:0015701]	anion:anion antiporter activity [GO:0015301]; chloride channel activity [GO:0005254]; secondary active sulfate transmembrane transporter activity [GO:0008271]	MNSGYTMLGIK	7.849999905	1227.899655	7.488732	14.01995	14.0201	15.17887	15.16831	0	15.27998	12.92348	0	11.93355	0	14.87438	14.2382	14.33973	13.74575	11.11816	0	11.55323	0	11.83861	12.3913	15.48679	14.21691	0	10.63085	13.26474	14.97571	12.80272	14.40242	13.57203	17.99214	16.45954	15.35811	0	12.13798	14.76366	16.36973	0	0	0	16.0786	0	13.76134	14.57973	14.0931	0	14.82898	11.39419	0	16.12074	0	15.52371	0	14.00834
A0A669F3Y7	A0A669F3Y7_ORENI			Solute carrier family 27 member 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; fatty acid transmembrane transporter activity [GO:0015245]; long-chain fatty acid-CoA ligase activity [GO:0004467]; very long-chain fatty acid-CoA ligase activity [GO:0031957]	fatty acid transmembrane transporter activity [GO:0015245]; long-chain fatty acid-CoA ligase activity [GO:0004467]; very long-chain fatty acid-CoA ligase activity [GO:0031957]	IAHNVFKK	8.539999962	955.9873129	12.03182	12.32023	12.67485	14.16739	0	14.79425	12.69071	11.55951	12.60002	14.37364	13.12159	14.87171	11.40966	0	0	0	14.5997	15.90401	0	0	13.10706	0	15.79875	13.13793	11.50797	11.12838	13.3426	12.51017	7.540153	11.5047	15.86755	15.84699	15.68896	0	13.05766	13.26241	13.84176	13.86767	0	16.25605	12.24092	0	0	0	14.39042	0	0	0	0	13.46364	12.53312	14.9624	13.70337	9.972949
A0A669BCJ8	A0A669BCJ8_ORENI		carbohydrate metabolic process [GO:0005975]	Solute carrier family 3 member 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; catalytic activity [GO:0003824]; carbohydrate metabolic process [GO:0005975]	catalytic activity [GO:0003824]	ELPDELK	9.409999847	842.9129059	14.05438	13.36669	14.88867	13.79189	14.93881	16.12507	0	12.28584	0	15.61803	14.99914	13.1786	16.01787	15.40059	15.66186	13.87049	0	16.33766	0	14.70291	15.56083	0	14.48306	14.84419	16.54566	0	0	14.01369	0	0	15.74908	0	15.81679	0	12.61516	16.20556	0	14.02274	15.90399	14.43927	14.46643	14.56744	0	0	0	14.93537	14.72083	15.56524	0	0	0	12.78842	0	12.49328
A0A669F248	A0A669F248_ORENI			Solute carrier family 38 member 5a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		VDSHATPLFSQEEFLPHKPGAK	5.409999847	2434.097745	10.33412	13.1775	11.5245	7.975576	12.76689	6.697122	13.09492	13.17692	0	12.23471	0	14.56203	13.81868	11.75624	9.628798	11.83788	0	10.29043	12.23892	16.9273	16.87996	0	13.88144	0	13.77947	0	0	0	0	15.05223	0	0	0	0	17.43078	0	9.932307	0	12.65914	12.02009	11.85529	0	0	0	0	0	8.942286	0	11.66995	0	0	14.12985	0	9.594491
A0A669DDR9	A0A669DDR9_ORENI			Solute carrier family 44 member 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	NGVEQADAAK	5.130000114	1001.430567	17.93598	0	0	0	18.33253	11.91196	15.56631	14.45789	0	0	13.99238	0	0	0	13.48513	12.95935	0	0	0	15.58307	15.1134	15.80546	0	0	0	0	0	0	15.11452	10.49937	16.55554	18.55775	12.66639	14.94139	0	0	0	14.66323	0	0	11.76199	0	0	0	13.59816	0	0	0	0	0	0	0	0	0
I3J4U5	I3J4U5_ORENI			Solute carrier family 5 member 7a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	HSGEIMDK	2.690000057	916.6510316	15.84599	0	0	11.74897	14.92282	0	15.10042	14.71297	0	13.16033	0	14.40295	0	14.05536	14.2754	14.2776	16.26763	15.6348	15.56363	15.01173	13.36517	0	15.74303	0	13.00382	15.15169	14.63424	16.79689	15.66595	15.8624	15.12399	13.66975	15.15273	14.6425	0	0	13.6642	14.48011	16.25115	16.42048	0	14.94358	0	14.93053	14.31427	0	15.68211	15.17041	16.98814	13.64536	0	0	15.38273	15.6903
A0A669BUR5	A0A669BUR5_ORENI	LOC102080194		Solute carrier family 66 member 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MATSTIK	9.149999619	765.219894	15.27108	15.94803	0	16.22294	16.04149	14.92913	16.52343	15.25727	15.08742	16.2305	0	16.42978	0	0	0	0	0	15.7305	0	18.24686	0	0	17.05538	0	0	16.25779	15.00265	0	17.23638	16.3003	16.75258	16.79992	0	13.73505	18.73287	14.75544	15.50558	15.30611	16.23577	16.93005	15.42937	0	16.64053	16.4785	0	16.25597	15.85871	15.60188	16.27418	17.23095	0	17.40135	20.12113	17.32201
A0A669DNF3	A0A669DNF3_ORENI			Solute carrier family 7 member 14b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; transmembrane transporter activity [GO:0022857]	transmembrane transporter activity [GO:0022857]	VIYAMARDGLLFR	12.52999973	1541.350225	0	12.88439	13.5643	0	9.082736	11.36711	11.46009	15.82753	13.62024	14.39377	13.84062	13.72488	0	0	0	0	0	0	11.12266	0	15.24391	0	0	0	0	0	0	11.96141	14.10254	15.65192	12.95943	0	17.14307	0	0	13.9791	11.8235	0	0	0	0	0	0	16.22854	0	12.6292	0	0	15.99645	16.12271	0	0	0	0
I3IXX0	I3IXX0_ORENI		cell communication [GO:0007154]	Solute carrier family 8 member 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; calcium:sodium antiporter activity [GO:0005432]; calmodulin binding [GO:0005516]; metal ion binding [GO:0046872]; cell communication [GO:0007154]	calcium:sodium antiporter activity [GO:0005432]; calmodulin binding [GO:0005516]; metal ion binding [GO:0046872]	DPANKVEEEPLTGK	19.12000084	1527.515929	17.38531	0	0	0	16.95174	0	0	17.05204	17.11093	0	17.41356	0	16.39366	17.65545	0	0	16.84339	16.91601	17.18248	0	0	17.45684	15.18246	16.47911	0	0	0	0	16.32714	16.93364	18.20626	17.83245	0	16.621	0	0	0	0	0	16.64863	0	0	0	15.68329	0	0	0	0	0	0	0	0	17.50513	14.64087
A0A669DW51	A0A669DW51_ORENI	LOC100707278		Solute carrier organic anion transporter family member	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; organic anion transmembrane transporter activity [GO:0008514]; thyroid hormone transmembrane transporter activity [GO:0015349]	organic anion transmembrane transporter activity [GO:0008514]; thyroid hormone transmembrane transporter activity [GO:0015349]	CITPELK	11.69999981	860.2761454	11.70648	15.08093	0	0	0	0	15.93763	15.85561	0	0	0	0	0	19.32785	12.00262	13.9183	0	0	15.23582	16.11805	0	10.11209	15.22241	15.88833	11.67461	0	0	0	0	17.54969	0	0	0	17.42194	0	0	15.33371	15.12794	0	0	15.20773	14.03675	0	0	18.19877	0	0	15.03938	17.98841	0	0	0	0	0
A0A669B970	A0A669B970_ORENI		actin filament organization [GO:0007015]	Sorbin and SH3 domain containing 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; focal adhesion [GO:0005925]; membrane [GO:0016020]	cytoplasm [GO:0005737]; focal adhesion [GO:0005925]; membrane [GO:0016020]; actin filament organization [GO:0007015]		TNSKVELK	10.18999958	916.6105162	0	0	0	0	15.27688	13.4177	0	0	0	0	0	0	0	13.57643	0	12.77285	10.50961	0	8.917168	0	0	0	0	0	0	15.98769	0	0	0	0	0	16.68989	0	0	0	15.42443	0	0	0	0	0	0	0	0	0	14.46389	0	15.75728	0	0	0	0	0	0
A0A669C1Y5	A0A669C1Y5_ORENI		protein transport [GO:0015031]	Sorting nexin 7	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		phosphatidylinositol binding [GO:0035091]; protein transport [GO:0015031]	phosphatidylinositol binding [GO:0035091]	MAEAETLVEQK	5.010000229	1264.069247	12.46277	0	0	0	0	0	12.84277	0	8.736451	10.32269	0	0	0	0	18.24268	0	0	12.63218	15.37006	0	0	11.98425	11.94833	0	10.59944	14.30661	0	12.95743	5.673481	0	13.0877	0	0	0	0	12.79177	0	0	10.75205	0	0	0	11.93155	0	0	13.77775	0	0	0	0	0	0	4.176017	0
I3JUP7	I3JUP7_ORENI	snx5	intracellular protein transport [GO:0006886]; pinocytosis [GO:0006907]	Sorting nexin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		phosphatidylinositol binding [GO:0035091]; intracellular protein transport [GO:0006886]; pinocytosis [GO:0006907]	phosphatidylinositol binding [GO:0035091]	MTSIDENSK	13.19999981	1040.835238	0	13.53114	13.57781	12.8474	13.05145	0	16.33383	12.09059	0	0	12.7839	11.92005	0	0	12.76836	14.32997	12.47648	0	12.62153	0	0	0	11.94579	14.26017	13.49962	0	12.31876	0	0	0	16.17821	0	0	0	14.34087	0	0	14.18372	14.69761	0	0	11.89809	0	0	0	13.94629	12.95213	13.91483	14.59733	0	13.8198	13.99946	0	0
I3K6G6	I3K6G6_ORENI	snx3	erythrocyte differentiation [GO:0030218]; heme biosynthetic process [GO:0006783]; hemoglobin biosynthetic process [GO:0042541]; protein transport [GO:0015031]	Sorting nexin-3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	early endosome [GO:0005769]; phagocytic vesicle [GO:0045335]	early endosome [GO:0005769]; phagocytic vesicle [GO:0045335]; phosphatidylinositol phosphate binding [GO:1901981]; erythrocyte differentiation [GO:0030218]; heme biosynthetic process [GO:0006783]; hemoglobin biosynthetic process [GO:0042541]; protein transport [GO:0015031]	phosphatidylinositol phosphate binding [GO:1901981]	GRYTTYEVR	9.079999924	1143.46963	17.15992	0	16.18521	0	0	0	0	17.86606	0	0	0	18.58762	0	0	0	17.81105	0	0	0	0	18.35863	0	0	0	0	0	0	17.60674	0	0	0	17.79947	0	0	0	0	0	0	17.5368	18.10352	0	15.53725	0	0	17.72228	0	0	0	0	0	16.55184	0	0	0
A0A669CTD5	A0A669CTD5_ORENI			Sosondowah ankyrin repeat domain family member Ab	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				HMSLGEIQK	2.980000019	1039.528533	13.7438	14.30928	0	14.88578	12.73576	13.20125	0	11.50661	0	13.02262	15.04684	13.8141	0	0	13.84138	17.92988	14.2695	12.94858	0	14.94026	0	0	13.89912	14.53727	14.82037	0	0	0	12.51144	14.29306	15.90697	0	0	0	0	13.95027	14.09257	0	14.99439	0	14.34097	0	0	0	0	0	15.81997	0	14.6979	0	0	0	0	0
A0A669C3Q0	A0A669C3Q0_ORENI	spg11		Spatacsin_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DFSWEEVSVHSRGVGGFR	4.71999979	2047.411155	14.05649	11.52931	13.88734	14.95707	11.39695	14.7642	9.251157	12.83902	13.41974	0	0	12.8712	11.57833	0	0	0	0	0	13.5243	0	13.28659	15.58263	13.44988	0	0	0	14.2901	11.64079	8.709797	15.2997	0	0	0	0	0	14.52996	11.49647	0	14.55722	0	0	14.08887	0	12.24685	0	12.62956	14.22523	0	0	0	0	0	14.158	0
I3JIG5	I3JIG5_ORENI	LOC100697102	actin filament capping [GO:0051693]	Spectrin beta chain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	spectrin [GO:0008091]	spectrin [GO:0008091]; actin binding [GO:0003779]; phospholipid binding [GO:0005543]; structural constituent of cytoskeleton [GO:0005200]; actin filament capping [GO:0051693]	actin binding [GO:0003779]; phospholipid binding [GO:0005543]; structural constituent of cytoskeleton [GO:0005200]	ETWLSENQR	2.420000076	1161.556547	13.1896	13.16868	0	0	0	12.13502	14.55029	0	0	14.86899	13.84931	14.02623	9.478447	17.49655	10.44681	13.60192	20.90482	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.86651	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3K6M0	I3K6M0_ORENI			"Spectrin repeat containing, nuclear envelope 1a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; nucleus [GO:0005634]	integral component of membrane [GO:0016021]; nucleus [GO:0005634]		EATANRVSPDVDSTYMGYMR	4.809999943	2279.039656	12.63947	10.29873	0	0	14.44409	12.889	14.14819	15.71323	16.05095	11.83952	12.99551	0	11.50375	11.96188	0	13.31974	12.29444	11.68995	13.93486	14.43443	0	0	0	0	0	0	15.36825	0	11.84602	0	0	0	12.35299	14.64277	12.98086	10.68053	0	0	0	14.15227	14.87526	0	9.796459	0	15.91163	0	0	15.58049	14.4849	0	12.93452	16.62514	0	0
A0A669C895	A0A669C895_ORENI			"Spectrin repeat containing, nuclear envelope 1b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; nuclear outer membrane [GO:0005640]	integral component of membrane [GO:0016021]; nuclear outer membrane [GO:0005640]; actin binding [GO:0003779]	actin binding [GO:0003779]	LLTGSLEAVHLQDLQGELEK	4.96999979	2193.449981	10.52741	14.31983	0	14.27175	14.91959	14.21263	17.69977	0	0	13.67268	0	12.06386	10.46386	14.47932	0	0	0	10.3826	12.55598	0	0	0	17.00374	14.10713	13.05038	0	0	12.82942	0	0	0	14.04866	14.49625	13.77434	0	12.52347	12.81829	12.30914	14.76706	12.72106	0	0	14.01924	17.46812	0	0	9.441456	11.49559	11.95889	15.44286	11.57619	12.50739	12.67676	13.63259
I3J096	I3J096_ORENI			"Spectrin, beta, non-erythrocytic 5"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]	actin binding [GO:0003779]	SEEVTEAMLR	9.829999924	1181.416713	17.46035	0	0	18.41118	0	0	0	0	0	18.93393	0	0	0	0	0	0	19.53457	0	0	0	0	0	0	0	14.57153	0	0	0	0	0	0	0	14.99819	0	14.12716	0	0	0	0	0	18.76526	14.39734	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DV06	A0A669DV06_ORENI			Speedy/RINGO cell cycle regulator family member A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MGHSQELGEVVL	3.799999952	1296.249334	10.6409	0	0	14.31094	13.60277	0	11.46082	0	13.997	12.9204	10.57294	0	12.3226	0	16.83367	13.34164	14.47597	0	14.75279	0	0	13.51243	11.79696	13.6131	9.812916	11.67332	14.51811	14.83632	0	11.70708	14.82396	0	0	0	13.33467	0	13.8323	0	0	0	14.82255	0	11.1342	13.63967	0	13.9288	11.45309	0	14.55271	11.37194	0	15.59197	13.68051	13.9029
A0A669BLU2	A0A669BLU2_ORENI			Sperm antigen with calponin homology and coiled-coil domains 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				PSAITR	11.42000008	644.5281619	13.32202	0	13.13366	0	15.54922	0	0	17.81288	14.10785	17.29587	15.98659	17.69065	16.82811	0	0	15.12259	0	16.95651	0	17.48928	0	0	0	0	0	0	0	15.51722	0	0	14.38637	16.23189	0	0	15.03593	0	0	15.48795	0	0	16.76357	0	0	0	0	0	0	15.10861	17.164	16.95389	14.35798	16.28086	0	0
I3KKK0	I3KKK0_ORENI			Spermatogenesis associated 17	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QVKYQAPTR	11.48999977	1089.54586	7.724147	14.03941	16.99985	14.02995	11.17197	15.2754	0	12.64549	0	14.45518	0	14.94632	18.60707	0	10.30731	0	0	0	0	13.20234	0	0	13.51901	0	18.26646	0	0	0	0	10.64549	15.61741	0	16.0688	0	0	0	18.38279	0	0	0	0	0	16.29691	0	0	0	7.718085	0	0	0	0	0	13.46651	0
A0A669D609	A0A669D609_ORENI			Spermatogenesis associated 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				RCTFDR	2.069999933	855.6544049	15.54412	16.00942	0	15.98425	15.55688	0	14.97061	14.7559	16.0864	11.9444	16.09753	16.05536	0	16.1118	16.68716	0	14.34832	16.20192	14.87833	15.41638	0	15.11206	0	0	0	16.39314	17.04741	15.16139	17.9577	14.99649	13.42754	14.62987	0	17.64901	16.50823	15.58969	16.10799	15.39717	14.94559	0	0	0	0	16.19829	0	16.3113	0	0	15.75168	13.47966	0	14.74692	0	16.08902
A0A669DMP5	A0A669DMP5_ORENI	vipas39		Spermatogenesis-defective protein 39 homolog (VPS33B-interacting protein in apical-basolateral polarity regulator) (VPS33B-interacting protein in polarity and apical restriction)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	early endosome [GO:0005769]; recycling endosome [GO:0055037]	early endosome [GO:0005769]; recycling endosome [GO:0055037]		VVRGSVEER	3.75999999	1031.231103	15.30686	0	14.10974	0	12.87603	0	14.49054	13.17394	12.75018	13.67238	0	13.18355	13.48762	14.13555	14.88529	0	0	14.5351	14.10904	9.209176	0	0	0	0	15.16597	12.85499	14.89778	0	14.84073	13.41101	14.86111	11.86021	16.10494	0	0	0	13.31349	0	0	14.56831	0	13.79654	0	14.52215	0	13.80485	15.24989	0	0	0	0	12.20028	0	0
A0A669D9U9	A0A669D9U9_ORENI	LOC100695336	sphingolipid metabolic process [GO:0006665]	Sphingomyelin phosphodiesterase (EC 3.1.4.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]	extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; sphingomyelin phosphodiesterase activity [GO:0004767]; sphingolipid metabolic process [GO:0006665]	sphingomyelin phosphodiesterase activity [GO:0004767]	ESSISK	1.74000001	649.2520335	11.509	14.57911	15.51688	13.4515	12.42067	13.49712	14.93183	15.38697	0	0	16.20442	0	15.25032	13.4875	15.75481	0	0	0	12.38493	13.42153	0	15.58989	0	12.4928	16.55566	0	9.942238	0	16.0486	16.79269	12.45569	0	15.32398	0	14.58492	16.34204	12.95694	0	17.59603	13.37528	0	12.68556	11.68416	13.99982	0	15.5186	10.46724	14.16713	17.8283	15.56339	0	0	0	0
A0A669F104	A0A669F104_ORENI	SPHK1		Sphingosine kinase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		NAD+ kinase activity [GO:0003951]	NAD+ kinase activity [GO:0003951]	MLNEAGIK	11.56000042	874.6241372	21.87128	0	0	0	0	0	0	22.9582	21.129	0	0	0	0	0	18.82644	0	0	0	0	22.62117	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669E5D4	A0A669E5D4_ORENI	SGPP1		Sphingosine-1-phosphate phosphatase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		TFSVLLTVVR	18.61000061	1128.178831	0	16.15295	15.62205	15.87903	15.39738	15.28592	15.39443	13.83454	15.69801	16.82065	16.3273	15.22398	14.74894	14.27819	16.97781	0	14.60268	15.71928	15.55538	0	15.46535	15.81944	11.19139	16.85089	0	0	0	0	15.94045	14.67627	19.34481	19.1256	18.44933	0	0	14.4418	16.74717	0	0	0	0	0	15.47585	0	16.5919	0	0	0	14.34353	14.98486	0	0	0	0
I3JTV2	I3JTV2_ORENI	tarbp1	RNA processing [GO:0006396]	SpoU_methylase domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]; RNA methyltransferase activity [GO:0008173]; RNA processing [GO:0006396]	RNA binding [GO:0003723]; RNA methyltransferase activity [GO:0008173]	KDNDISR	13.43999958	848.2296462	16.24023	16.57402	20.37892	16.02268	18.2594	19.64059	21.17708	0	16.60237	18.26464	15.83675	15.54824	15.24173	0	15.64886	19.66604	16.99394	18.65009	14.46397	14.3276	0	16.2442	18.94781	16.35248	17.76448	19.61054	17.31416	19.05638	17.90303	0	18.98015	0	20.13247	18.4997	0	19.0173	15.31014	19.60905	18.65733	17.17369	16.04689	17.83376	18.95471	20.10701	16.22504	19.84483	0	16.76934	16.57243	0	0	0	16.26503	19.8777
I3K5Z8	I3K5Z8_ORENI	mrm3	RNA processing [GO:0006396]	SpoU_sub_bind domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]; RNA methyltransferase activity [GO:0008173]; RNA processing [GO:0006396]	RNA binding [GO:0003723]; RNA methyltransferase activity [GO:0008173]	ASPGDK	4.710000038	573.615569	15.02789	14.24856	15.1221	12.26621	0	14.72093	14.91523	0	14.7038	16.12715	13.97502	15.75965	14.85966	16.21777	14.91864	0	14.15897	13.3515	15.09809	14.14574	15.19427	0	16.68577	0	0	0	0	0	13.47762	15.2252	0	0	17.18588	16.50852	0	0	0	14.86372	0	12.80742	15.4322	14.1241	14.81039	0	0	15.56913	0	0	0	0	0	0	0	0
I3IUB7	I3IUB7_ORENI		sterol biosynthetic process [GO:0016126]	Squalene monooxygenase (EC 1.14.14.17)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; flavin adenine dinucleotide binding [GO:0050660]; squalene monooxygenase activity [GO:0004506]; sterol biosynthetic process [GO:0016126]	flavin adenine dinucleotide binding [GO:0050660]; squalene monooxygenase activity [GO:0004506]	SNMVLSFAQR	9.260000229	1167.590105	10.17478	14.87585	17.59688	0	12.73815	10.32356	14.11245	15.24742	14.96104	11.80265	0	19.56221	19.14425	18.66892	20.48032	12.9388	18.89045	0	18.92954	16.84024	13.69361	12.50307	0	16.80237	16.20831	14.09233	0	0	0	11.85756	14.03933	0	0	18.83972	0	14.77441	13.53473	12.347	6.034359	11.59598	13.82945	0	0	0	0	18.29142	0	10.66352	13.07785	13.6734	8.24181	14.68473	15.95534	19.01907
A0A669CNX7	A0A669CNX7_ORENI	fdft1	lipid biosynthetic process [GO:0008610]	Squalene synthase (EC 2.5.1.21)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; farnesyl-diphosphate farnesyltransferase activity [GO:0004310]; squalene synthase activity [GO:0051996]; lipid biosynthetic process [GO:0008610]	farnesyl-diphosphate farnesyltransferase activity [GO:0004310]; squalene synthase activity [GO:0051996]	LDYSMTESLR	10.52000046	1214.226446	12.83831	10.1853	13.84998	0	14.94806	17.25315	18.55918	0	17.48432	18.02621	9.247987	14.42678	14.37079	0	14.46535	13.93087	13.47603	11.17706	12.88596	13.22425	11.40119	17.65052	10.84875	10.0521	8.177141	0	0	0	0	0	16.37536	20.05608	0	0	19.6779	18.01445	16.99701	0	14.13239	16.53482	16.95127	0	13.57505	12.18494	17.51914	0	14.55491	0	9.102791	9.38824	0	0	6.930287	6.778289
A0A669F239	A0A669F239_ORENI		cell adhesion [GO:0007155]	Stabilin 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium ion binding [GO:0005509]; hyaluronic acid binding [GO:0005540]; cell adhesion [GO:0007155]	calcium ion binding [GO:0005509]; hyaluronic acid binding [GO:0005540]	CVCVQNNGECSR	3.640000105	1481.875031	14.3159	13.57272	0	15.42895	13.60778	0	16.5272	15.61536	0	0	16.57424	15.43003	15.23872	16.73177	0	0	14.32124	15.61	13.90857	12.75467	0	14.38101	14.40702	16.43716	17.00981	0	0	14.94139	8.448744	14.05158	17.37558	16.07117	0	15.20651	16.35249	15.70876	17.00843	15.79257	0	0	0	14.33101	17.0965	0	14.59848	16.79303	15.56322	15.08385	15.6447	13.6821	13.19964	17.62691	16.72244	17.13273
A0A669BNQ2	A0A669BNQ2_ORENI		gene silencing by RNA [GO:0031047]	Staphylococcal nuclease domain-containing protein (EC 3.1.31.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; RISC complex [GO:0016442]	cytoplasm [GO:0005737]; RISC complex [GO:0016442]; endoribonuclease activity [GO:0004521]; gene silencing by RNA [GO:0031047]	endoribonuclease activity [GO:0004521]	GNNPEQARLCDLEDQSK	2.220000029	1973.011721	0	14.03225	12.83675	12.60297	0	0	13.47451	13.06866	11.37309	11.45696	15.28534	0	15.68717	14.00844	17.1613	0	12.78169	0	11.18516	0	10.83512	15.79564	0	9.88072	13.32195	11.96393	11.9946	12.73974	13.1244	13.64433	11.9691	0	14.0616	12.75019	11.97041	13.0655	0	13.259	13.57536	0	12.95601	0	0	9.756949	13.00687	0	13.92116	13.29349	13.85499	13.06733	15.98577	15.25335	13.33155	15.1256
A0A669CQL0	A0A669CQL0_ORENI			"Steroid sulfatase (microsomal), isozyme S"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; sulfuric ester hydrolase activity [GO:0008484]	sulfuric ester hydrolase activity [GO:0008484]	HGIYGDAVQEVDWSVGQLMETLDR	5.559999943	2717.440614	0	15.80667	12.99314	0	0	13.91352	0	0	16.38526	0	0	11.87602	15.93452	14.1052	0	0	15.11265	0	15.14469	15.3832	0	0	0	16.55588	16.05318	16.19076	14.58625	17.77591	0	0	0	0	13.7985	13.92432	0	0	0	0	0	17.36291	0	0	14.97035	16.3196	14.04257	0	15.1375	16.75728	0	0	0	0	18.1354	0
A0A669C9F9	A0A669C9F9_ORENI	star	cholesterol metabolic process [GO:0008203]; steroid biosynthetic process [GO:0006694]	"Steroidogenic acute regulatory protein, mitochondrial (StAR) (START domain-containing protein 1)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; cholesterol binding [GO:0015485]; cholesterol transfer activity [GO:0120020]; cholesterol metabolic process [GO:0008203]; steroid biosynthetic process [GO:0006694]	cholesterol binding [GO:0015485]; cholesterol transfer activity [GO:0120020]	AYIVGIKVK	7.400000095	991.2696135	14.39297	10.27548	14.33091	10.70941	10.63268	14.43949	16.32041	0	16.87694	0	16.69532	11.69188	14.14953	11.79981	13.99762	13.20351	13.47946	10.7376	12.76708	12.24516	14.93329	12.64994	11.55154	13.16849	15.45339	15.76391	14.59546	0	13.84946	15.03636	12.0528	15.16192	15.82058	14.26896	0	0	15.31842	12.7129	13.72287	13.70189	13.83506	12.96953	19.88359	0	10.94068	13.89007	13.10065	0	10.72567	14.31368	11.9743	16.09736	0	10.57804
A0A669DVE4	A0A669DVE4_ORENI	scap	SREBP signaling pathway [GO:0032933]	Sterol regulatory element-binding protein cleavage-activating protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; ER to Golgi transport vesicle membrane [GO:0012507]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; ER to Golgi transport vesicle membrane [GO:0012507]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; sterol binding [GO:0032934]; SREBP signaling pathway [GO:0032933]	sterol binding [GO:0032934]	GPPGR	4.329999924	483.2659163	15.17578	16.37053	16.72869	16.58616	16.60983	15.57661	16.46626	16.81263	16.23293	17.90559	17.27491	17.41671	16.22433	16.03047	16.28802	14.92989	15.58366	13.83339	16.60838	17.01195	13.47349	16.40596	16.01077	15.05164	11.80405	15.42025	16.47002	15.85859	15.82807	16.2322	15.08673	16.31572	15.91111	16.39664	17.98418	17.62769	16.19499	15.73728	15.8249	15.73797	15.46008	14.53858	15.2431	15.98512	15.67863	15.50586	15.20553	14.03127	16.06739	16.50033	13.72562	15.51086	16.32763	15.14145
A0A4P8NPQ6	A0A4P8NPQ6_ORENI	sting sting1	activation of innate immune response [GO:0002218]; cytoplasmic pattern recognition receptor signaling pathway in response to virus [GO:0039528]; innate immune response [GO:0045087]; NIK/NF-kappaB signaling [GO:0038061]; positive regulation of defense response to virus by host [GO:0002230]; positive regulation of macroautophagy [GO:0016239]; positive regulation of type I interferon production [GO:0032481]	Stimulator of interferon genes protein (Transmembrane protein 173)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	autophagosome membrane [GO:0000421]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; perinuclear region of cytoplasm [GO:0048471]	autophagosome membrane [GO:0000421]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; integral component of membrane [GO:0016021]; perinuclear region of cytoplasm [GO:0048471]; cyclic-di-GMP binding [GO:0035438]; activation of innate immune response [GO:0002218]; cytoplasmic pattern recognition receptor signaling pathway in response to virus [GO:0039528]; innate immune response [GO:0045087]; NIK/NF-kappaB signaling [GO:0038061]; positive regulation of defense response to virus by host [GO:0002230]; positive regulation of macroautophagy [GO:0016239]; positive regulation of type I interferon production [GO:0032481]	cyclic-di-GMP binding [GO:0035438]	IMDENRK	11.93000031	902.4656461	0	11.9732	12.51143	12.7344	0	12.90804	14.4305	0	14.41771	13.83825	14.27167	13.51134	13.46393	13.51487	11.51017	13.25587	0	14.50908	13.44011	13.22627	12.75449	13.35749	11.8361	0	15.17699	10.96969	0	12.13285	0	0	13.66281	16.22733	0	12.98331	0	11.85643	12.25583	13.67646	0	13.72171	0	0	0	0	8.896567	0	14.54714	0	13.76267	12.20937	14.0067	15.43765	11.72038	14.04223
I3KGM8	I3KGM8_ORENI		calcium ion transport [GO:0006816]; regulation of store-operated calcium entry [GO:2001256]	Store-operated calcium entry-associated regulatory factor (Transmembrane protein 66)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of endoplasmic reticulum membrane [GO:0030176]	integral component of endoplasmic reticulum membrane [GO:0030176]; calcium ion transport [GO:0006816]; regulation of store-operated calcium entry [GO:2001256]		HQYPGGR	18.51000023	813.7882998	0	0	0	14.01558	18.50732	14.3998	9.952669	13.52053	15.71371	15.99091	15.26571	15.04582	0	14.31164	0	0	0	15.40348	0	0	0	0	0	0	0	0	0	18.53796	0	0	15.52811	0	0	0	0	0	15.7151	16.25688	16.91408	0	0	0	0	0	13.9837	16.37356	16.04353	0	0	17.16516	0	0	0	0
A0A669CR34	A0A669CR34_ORENI	STRN		Striatin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; calmodulin binding [GO:0005516]	calmodulin binding [GO:0005516]	VRALLGLAGDGAGR	2.220000029	1326.433932	14.61136	0	0	13.51012	0	0	11.20875	0	13.23089	13.99047	14.544	15.00522	14.79684	14.83356	0	15.42326	0	0	0	13.45896	13.82425	14.75462	12.47942	13.58913	0	12.60166	0	15.62943	0	9.243055	20.73458	21.06876	21.2422	14.85717	14.15	0	13.32549	0	14.12535	7.138269	0	0	15.36546	13.787	13.9568	16.36571	0	20.06908	14.02046	0	13.1894	14.01854	15.21745	0
A0A669BVN9	A0A669BVN9_ORENI			"Striatin, calmodulin binding protein 3"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; calmodulin binding [GO:0005516]	calmodulin binding [GO:0005516]	DEHPGGGGVGTSAPR	6.659999847	1393.369251	0	17.86813	13.36847	13.69832	12.45517	0	15.31373	0	0	0	14.73887	0	16.62641	16.36197	0	0	16.07064	16.57736	15.387	0	16.2198	14.26184	0	0	17.58368	13.02982	16.98356	0	0	0	0	0	17.59835	0	16.71104	0	16.3109	15.93931	16.34311	17.90212	0	16.55735	0	14.02613	17.27489	16.64949	17.27009	0	0	0	16.72874	0	12.45582	0
I3J9E8	I3J9E8_ORENI			Stromal antigen 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EAIAMLHK	6.539999962	929.1476497	14.85893	15.36742	0	0	0	14.14999	14.42645	13.90594	16.06247	13.58951	14.14178	14.32704	10.32686	8.038562	13.68997	0	0	0	17.33346	11.80424	14.17353	14.80986	0	14.83751	14.05585	12.51236	0	0	0	13.1983	0	14.95754	11.87439	0	0	10.20126	0	14.84535	11.82227	0	11.5412	16.23485	13.19407	14.6002	0	0	0	14.06037	0	13.43582	15.75173	0	13.86217	15.78837
A0A669B3P9	A0A669B3P9_ORENI			Stromal antigen 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		YRDSIAEIR	9.920000076	1122.955688	10.44586	13.44375	12.76108	0	11.35446	0	0	13.99603	14.43523	16.0264	9.085221	10.3351	17.185	0	12.44098	13.03467	17.17175	17.04596	16.03378	18.06302	13.26608	15.06673	15.93201	14.14124	13.58168	18.54459	16.32605	15.81082	15.56031	14.79249	7.896341	14.37887	11.56093	18.60645	15.4936	13.52143	14.89928	8.234493	0	13.55136	12.84557	12.00762	14.73402	12.34332	16.64511	13.64488	13.95895	17.01583	12.00086	12.52333	12.33193	0	13.45941	19.17573
A0A669C694	A0A669C694_ORENI		calcium ion transport [GO:0006816]	Stromal interaction molecule 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; calcium channel regulator activity [GO:0005246]; metal ion binding [GO:0046872]; calcium ion transport [GO:0006816]	calcium channel regulator activity [GO:0005246]; metal ion binding [GO:0046872]	LSSGSSCHFSS	7.46999979	1155.822813	12.50933	10.82841	13.36706	0	0	12.49034	18.38758	0	14.51235	14.84505	14.67221	0	10.66904	0	0	10.3554	11.15664	10.88464	0	19.04258	0	0	14.90057	0	14.6971	0	14.89018	13.04872	12.97331	13.61025	15.47033	15.07872	9.546694	13.21698	12.11793	14.32072	13.90813	0	18.02816	14.49322	0	13.50126	0	9.918486	11.87695	8.135887	12.5939	11.52658	11.76264	16.8062	12.56151	14.57795	15.22452	0
A0A669ESU1	A0A669ESU1_ORENI	smc1a	DNA repair [GO:0006281]; mitotic sister chromatid cohesion [GO:0007064]	Structural maintenance of chromosomes protein 1A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cohesin complex [GO:0008278]; nucleus [GO:0005634]	cohesin complex [GO:0008278]; nucleus [GO:0005634]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; chromatin binding [GO:0003682]; DNA repair [GO:0006281]; mitotic sister chromatid cohesion [GO:0007064]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]; chromatin binding [GO:0003682]	KMENDGK	8.479999542	835.2884414	0	0	13.56716	0	14.05617	0	18.4178	16.65504	0	0	15.36852	17.79381	15.44063	13.99299	0	0	0	15.64516	0	0	0	18.01047	0	0	16.55622	14.90856	16.14393	0	0	0	0	0	0	0	0	0	0	0	0	0	15.08974	18.63053	0	0	0	0	0	0	15.98205	0	0	0	14.84899	0
A0A669DFE3	A0A669DFE3_ORENI	smc5	double-strand break repair via homologous recombination [GO:0000724]; sister chromatid cohesion [GO:0007062]	Structural maintenance of chromosomes protein 5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]; Smc5-Smc6 complex [GO:0030915]	nucleus [GO:0005634]; Smc5-Smc6 complex [GO:0030915]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; double-strand break repair via homologous recombination [GO:0000724]; sister chromatid cohesion [GO:0007062]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	HLDVIELLEK	6.130000114	1209.104831	0	11.94934	13.17085	9.061461	0	12.84431	0	18.40497	12.77873	0	10.37363	11.88557	11.90617	0	12.14949	0	8.628504	0	12.44546	13.27421	0	0	0	0	10.18412	10.27493	0	18.79927	10.43503	12.14248	13.34421	13.29115	0	0	14.40066	0	12.61386	10.72339	14.53021	11.44679	11.52701	12.57633	14.20833	0	0	10.046	0	0	13.64942	18.1238	0	0	0	0
I3J6R0	I3J6R0_ORENI	smc4	cell cycle [GO:0007049]; chromosome organization [GO:0051276]	Structural maintenance of chromosomes protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]; nucleus [GO:0005634]	chromosome [GO:0005694]; nucleus [GO:0005634]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; cell cycle [GO:0007049]; chromosome organization [GO:0051276]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	WRVVTLK	5.289999962	900.5427256	9.348239	12.69939	13.34874	14.85259	0	15.18456	0	0	12.49983	0	14.35265	15.19411	12.28051	15.1306	14.30774	12.63809	13.12244	0	14.78323	14.47906	15.25449	14.11926	13.4698	0	13.88257	13.48176	14.2561	13.37566	0	9.693328	0	0	0	15.43482	11.94933	0	15.52721	13.62227	0	0	0	14.59804	0	0	15.32639	14.83821	14.13198	0	0	0	14.52647	0	14.50843	14.94095
A0A669BYJ4	A0A669BYJ4_ORENI		mitochondrial respiratory chain complex II assembly [GO:0034553]	"Succinate dehydrogenase assembly factor 3, mitochondrial"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; mitochondrial respiratory chain complex II assembly [GO:0034553]		QSTSLLTKR	15.27000046	1028.866516	0	0	14.98316	15.41644	14.92401	0	11.45442	14.77956	0	15.66006	16.31247	14.89788	15.18993	13.38322	14.68264	13.37101	11.06425	17.00396	0	15.23108	13.09024	14.85235	14.1949	0	14.48344	13.94981	0	15.06194	14.70759	11.0427	16.04079	15.41345	0	13.70121	13.26074	14.0063	14.31613	15.66105	8.099431	16.22464	15.51105	15.37443	12.7586	13.78198	13.01889	15.40686	14.98528	0	15.50779	14.14615	13.91385	15.24062	13.8149	14.16481
A0A669B0V0	A0A669B0V0_ORENI	suclg1 SUCLG1	tricarboxylic acid cycle [GO:0006099]	"Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial (EC 6.2.1.4) (EC 6.2.1.5) (Succinyl-CoA synthetase subunit alpha) (SCS-alpha)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; nucleotide binding [GO:0000166]; succinate-CoA ligase (ADP-forming) activity [GO:0004775]; succinate-CoA ligase (GDP-forming) activity [GO:0004776]; tricarboxylic acid cycle [GO:0006099]	nucleotide binding [GO:0000166]; succinate-CoA ligase (ADP-forming) activity [GO:0004775]; succinate-CoA ligase (GDP-forming) activity [GO:0004776]	RMGHAGAIIAGGK	8.069999695	1237.598373	6.306911	10.10765	12.25213	11.26753	16.58611	16.359	13.34066	0	0	16.64426	0	17.62509	12.30062	0	0	13.62751	0	0	0	0	0	0	10.96939	13.23056	13.41046	13.05165	0	12.69184	7.50362	14.24293	0	13.51789	0	0	11.11094	11.59618	11.31915	8.900531	12.34364	13.3672	12.34162	9.894607	12.87218	0	0	10.73671	11.19654	12.45462	0	13.38164	0	0	0	13.28263
A0A669DM52	A0A669DM52_ORENI	oxct1	ketone body catabolic process [GO:0046952]	Succinyl-CoA:3-ketoacid-coenzyme A transferase (EC 2.8.3.5)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; 3-oxoacid CoA-transferase activity [GO:0008260]; ketone body catabolic process [GO:0046952]	3-oxoacid CoA-transferase activity [GO:0008260]	VVVTMEHSAK	10.52999973	1115.744327	12.08762	14.56431	13.60039	14.31057	12.85803	15.18948	0	0	12.83692	0	0	0	0	4.353629	15.67278	14.82675	0	0	12.13272	13.79727	0	0	0	13.64532	0	14.06426	13.33664	0	0	12.88104	0	15.69579	17.38881	0	13.49113	13.85366	0	14.57206	0	14.15343	17.72305	0	12.99254	14.04161	14.28314	15.81542	17.23146	15.04707	15.45803	0	14.53605	14.29367	13.98974	14.63389
I3KKV6	I3KKV6_ORENI	LOC100690431		Sulfotransferase (EC 2.8.2.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		sulfotransferase activity [GO:0008146]	sulfotransferase activity [GO:0008146]	MTNYTTAPVMNHK	6.679999828	1522.666288	12.21385	14.31401	12.91557	13.60997	0	15.242	10.78743	11.78915	13.9021	15.25807	12.69295	14.32518	13.72168	13.72047	14.87649	14.77853	15.25771	12.07228	13.7981	0	12.16032	9.61492	0	10.55213	14.77293	12.32627	12.77531	14.79864	0	12.30169	16.18032	17.59552	17.59576	14.19708	11.66013	13.77546	14.17499	12.82135	15.65361	14.3617	0	0	10.10698	14.6784	12.26552	13.7584	10.75458	14.28429	14.05018	0	14.93864	12.9995	0	12.44235
A0A669CYN2	A0A669CYN2_ORENI		cytoskeleton organization [GO:0007010]	Supervillin a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin filament binding [GO:0051015]; cytoskeleton organization [GO:0007010]	actin filament binding [GO:0051015]	TRLIWEGGR	2.980000019	1089.06891	9.1441	0	10.37278	14.31193	14.44549	13.4318	12.88664	12.54955	13.44801	14.99748	12.46439	12.54746	0	0	0	13.45597	14.72291	0	15.64359	12.9324	15.8872	0	0	0	0	0	0	0	0	0	17.96508	18.05762	18.87563	13.92105	13.58119	14.00541	14.98712	0	0	13.41263	0	14.18283	0	0	0	0	17.06093	0	0	0	0	0	0	16.10088
A0A669BD70	A0A669BD70_ORENI		"transcription, DNA-templated [GO:0006351]"	Suppressor of cancer cell invasion	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"transcription corepressor activity [GO:0003714]; transcription, DNA-templated [GO:0006351]"	transcription corepressor activity [GO:0003714]	FVFCSAALR	6.070000172	1068.976377	9.889324	0	11.27257	15.08402	0	14.53408	0	0	0	12.65626	14.2714	13.91022	14.29405	13.91194	12.80053	13.98207	12.83162	0	16.00925	12.25074	0	13.76647	8.862309	11.26479	12.78544	14.14469	9.657489	14.15076	0	14.58028	0	16.33278	0	15.51019	14.73424	14.93415	0	0	13.94351	0	14.42478	13.36446	0	0	14.76406	14.50895	0	0	0	0	13.82243	0	14.97349	0
A0A669BXU5	A0A669BXU5_ORENI	srpx2	angiogenesis [GO:0001525]	Sushi repeat-containing protein SRPX2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cell surface [GO:0009986]; cytoplasm [GO:0005737]; extracellular region [GO:0005576]; synapse [GO:0045202]	cell surface [GO:0009986]; cytoplasm [GO:0005737]; extracellular region [GO:0005576]; synapse [GO:0045202]; angiogenesis [GO:0001525]		CQMSCDR	4.019999981	969.8959489	14.05846	14.17744	11.45861	0	11.24771	0	10.19356	14.06621	13.73886	0	14.12633	14.58692	13.50774	16.01752	13.73452	11.98071	0	0	14.28181	11.64032	8.369125	14.65907	0	11.57191	8.169129	0	0	15.75586	11.95173	0	15.89418	14.67808	0	14.3908	14.14037	0	14.06877	13.2307	14.42457	0	13.48227	0	11.85954	15.60123	0	0	16.70495	0	0	13.04621	11.18436	14.79777	13.82698	17.09939
A0A669B6Z7	A0A669B6Z7_ORENI		signal transduction [GO:0007165]	Synaptic Ras GTPase activating protein 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; GTPase activator activity [GO:0005096]; signal transduction [GO:0007165]	GTPase activator activity [GO:0005096]	VMQNLASFSKFGPK	5.070000172	1554.421657	13.26961	11.94969	13.63919	15.32296	11.63399	13.08297	13.79512	0	13.12722	14.3471	0	12.80251	14.67022	13.05354	14.79777	12.01652	14.353	12.97542	0	12.30888	13.52199	0	0	0	0	10.19701	14.66047	13.49971	14.59824	13.26469	17.56883	16.76219	16.20257	15.03005	0	14.13313	14.00974	0	12.7638	14.06798	0	12.54232	0	0	14.97375	0	13.31016	0	0	0	13.03559	14.99178	14.25401	0
I3KFM3	I3KFM3_ORENI	fmr1	mRNA processing [GO:0006397]; nervous system development [GO:0007399]; regulation of translation [GO:0006417]; RNA splicing [GO:0008380]	Synaptic functional regulator FMR1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"chromosome, centromeric region [GO:0000775]; cytoplasmic stress granule [GO:0010494]; dendritic spine [GO:0043197]; filopodium tip [GO:0032433]; growth cone [GO:0030426]; nucleolus [GO:0005730]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]"	"chromosome, centromeric region [GO:0000775]; cytoplasmic stress granule [GO:0010494]; dendritic spine [GO:0043197]; filopodium tip [GO:0032433]; growth cone [GO:0030426]; nucleolus [GO:0005730]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; mRNA binding [GO:0003729]; mRNA processing [GO:0006397]; nervous system development [GO:0007399]; regulation of translation [GO:0006417]; RNA splicing [GO:0008380]"	mRNA binding [GO:0003729]	GRGGGGYK	4.940000057	750.513594	16.92015	15.9783	15.31992	13.66251	14.8395	16.73417	17.23085	16.62294	17.13758	16.1895	16.10907	16.03833	0	0	15.78477	0	16.94255	14.4404	14.79614	16.28848	0	16.18211	0	0	16.00101	16.45473	16.84956	0	16.40891	16.58946	16.83251	15.48187	17.24487	15.8011	15.34144	16.17768	16.97427	17.9572	16.86004	15.97139	14.80317	17.13823	16.9673	0	15.9266	0	18.48072	16.62959	0	15.88739	15.90043	18.18974	19.02258	16.85286
A0A669BLQ9	A0A669BLQ9_ORENI			Synaptopodin 2-like a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EALMLGSR	7.739999771	874.093993	15.76003	16.89824	0	16.74742	0	0	0	15.97595	0	17.59644	0	0	15.5497	17.04755	0	0	0	16.73975	17.38595	0	0	0	19.19286	0	16.25962	0	16.5418	14.76428	16.4093	0	0	16.66722	18.65544	0	0	17.55005	16.66041	16.43756	15.43375	16.95392	0	0	16.46472	16.15255	0	0	0	0	17.1167	0	18.50573	16.95031	16.58768	16.55956
A0A669AVC8	A0A669AVC8_ORENI		clathrin coat assembly [GO:0048268]	Synaptosome associated protein 91b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	clathrin-coated vesicle [GO:0030136]	clathrin-coated vesicle [GO:0030136]; 1-phosphatidylinositol binding [GO:0005545]; clathrin binding [GO:0030276]; clathrin coat assembly [GO:0048268]	1-phosphatidylinositol binding [GO:0005545]; clathrin binding [GO:0030276]	GADGVMRTMTTEK	6.349999905	1412.748207	0	13.20216	14.33902	13.06375	13.76492	11.99809	13.98833	12.13452	0	0	14.33001	0	14.2778	11.90578	14.623	0	14.90983	0	0	14.497	12.69436	12.46373	14.11876	14.98348	9.419767	10.36646	0	0	0	0	17.49319	16.99174	15.98705	0	14.43418	11.21975	0	14.12372	10.69196	13.14859	0	0	14.31359	11.72993	10.90056	0	15.67432	15.29703	13.78399	13.29478	13.85663	0	15.21935	12.34436
A0A669AXS0	A0A669AXS0_ORENI	LOC100699505	neurotransmitter secretion [GO:0007269]	Synaptotagmin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromaffin granule membrane [GO:0042584]; integral component of membrane [GO:0016021]; synaptic vesicle membrane [GO:0030672]	chromaffin granule membrane [GO:0042584]; integral component of membrane [GO:0016021]; synaptic vesicle membrane [GO:0030672]; calcium ion binding [GO:0005509]; calcium-dependent phospholipid binding [GO:0005544]; neurotransmitter secretion [GO:0007269]	calcium-dependent phospholipid binding [GO:0005544]; calcium ion binding [GO:0005509]	HDVIGEVKLPMNTIDLGRPIEEWR	14.10999966	2833.542221	13.76123	0	0	13.80401	0	14.16179	13.67492	12.94055	13.25536	17.0063	0	0	12.47187	14.94739	0	14.26423	13.95938	12.30854	0	13.23078	0	0	12.93016	13.8915	11.82129	13.81554	0	15.46819	15.78895	6.657514	0	0	15.29866	0	0	13.82185	13.61635	14.26241	0	17.24731	11.91121	12.7714	0	9.08392	14.97781	14.75588	14.12165	15.09079	15.14313	14.53151	14.07796	0	11.96848	12.2431
I3J1F0	I3J1F0_ORENI			Synaptotagmin XIb	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MTILPEK	3.890000105	832.0089511	0	0	16.70041	15.86474	0	16.70591	17.82869	15.44532	17.18407	0	16.87431	16.32967	17.58487	17.09133	0	17.02909	0	0	17.57653	17.90065	15.83104	18.13361	0	16.54852	18.48984	20.0129	20.05275	18.26379	18.93276	16.8021	19.40548	19.63017	0	16.03485	15.70683	0	0	16.48123	16.82746	18.07511	17.33878	0	16.97512	0	18.94884	17.83764	15.40906	0	17.55142	16.78864	17.41063	20.51031	0	20.26918
I3IZL9	I3IZL9_ORENI		epiboly involved in gastrulation with mouth forming second [GO:0055113]; response to hypoxia [GO:0001666]; synapse assembly [GO:0007416]; tissue regeneration [GO:0042246]	Syndecan binding protein (syntenin) 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"phosphatidylinositol-3,4-bisphosphate binding [GO:0043325]; syndecan binding [GO:0045545]; epiboly involved in gastrulation with mouth forming second [GO:0055113]; response to hypoxia [GO:0001666]; synapse assembly [GO:0007416]; tissue regeneration [GO:0042246]"	"phosphatidylinositol-3,4-bisphosphate binding [GO:0043325]; syndecan binding [GO:0045545]"	MSSGLMR	5.400000095	796.9183191	12.55167	15.56018	0	13.02021	14.03205	12.70613	0	0	10.74279	0	11.61002	0	0	0	0	0	0	0	16.05201	14.67438	0	0	14.87972	0	0	0	0	0	0	0	0	0	14.88322	0	0	0	0	0	0	0	0	16.05343	0	15.25852	16.07505	0	0	0	0	0	13.79805	0	16.35423	14.18879
A0A669ERI8	A0A669ERI8_ORENI		Golgi vesicle transport [GO:0048193]	Syntaxin 10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; Golgi vesicle transport [GO:0048193]		VSHMTSSRR	2.730000019	1075.833559	13.67757	0	6.453098	0	0	14.54769	0	14.61236	14.01367	0	0	14.33949	18.33396	11.92775	0	0	0	13.62841	0	14.11164	12.93051	0	0	0	0	0	15.23164	13.05654	0	0	0	0	14.38603	14.33274	0	0	0	0	13.91586	0	0	16.43272	0	0	12.19743	10.54108	0	0	0	0	16.17025	13.2883	16.90864	0
I3KYK0	I3KYK0_ORENI		vesicle-mediated transport [GO:0016192]	"Syntaxin 11b, tandem duplicate 1"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]; vesicle-mediated transport [GO:0016192]		MFQATTTMSTIKK	30.54000092	1502.702954	19.91795	17.29576	20.48072	19.7148	19.99267	20.36761	14.17241	16.00304	16.73966	18.58125	19.44508	19.43918	20.3035	19.01633	16.90767	17.69458	21.54531	20.50753	20.79806	18.61771	17.07887	18.62633	18.71568	18.01137	19.90765	19.61062	19.66713	20.71504	15.66958	18.97865	19.82747	19.39606	20.09199	19.10876	17.966	16.05344	20.28916	20.53201	15.94665	20.4441	18.45719	20.64031	18.02929	14.91239	20.10911	20.16523	16.79118	18.94879	18.30083	18.62525	20.12612	19.74125	20.50848	19.70503
A0A669B3K1	A0A669B3K1_ORENI		intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	Syntaxin 12	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; SNAP receptor activity [GO:0005484]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	SNAP receptor activity [GO:0005484]	MTTQTEEAAITEEDLELIK	12.72000027	2180.899596	12.49371	12.69055	12.64315	17.80028	0	13.31608	14.26993	13.8387	12.38778	0	14.74475	13.66774	12.61455	0	0	0	0	10.67646	0	0	0	0	0	0	0	14.5728	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669FC21	A0A669FC21_ORENI		intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	Syntaxin 5A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; SNAP receptor activity [GO:0005484]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	SNAP receptor activity [GO:0005484]	LASMSNDFKSVLEVR	10.72999954	1711.938335	13.16676	13.73457	0	16.42354	14.59081	16.52111	16.2449	18.11682	16.29826	14.85607	17.27344	16.12779	15.70423	0	13.82485	14.77194	0	15.92898	0	0	0	17.20786	14.6312	16.28802	16.92448	0	17.22595	0	16.82189	15.84984	16.56904	0	17.16801	15.05134	0	0	17.5463	17.93393	13.08091	14.09666	0	0	0	14.92731	16.57972	0	0	16.69048	14.92032	17.60774	15.45804	0	0	0
A0A669CWJ1	A0A669CWJ1_ORENI		exocytosis [GO:0006887]	Syntaxin binding protein 5b (tomosyn)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]; exocytosis [GO:0006887]		ELPNVSFSFEMSLSYR	2.160000086	1923.275573	10.33098	10.4455	13.15631	14.31639	12.14651	14.00281	14.60801	0	14.08679	0	14.03145	10.74733	12.82341	0	14.09572	0	0	13.0552	0	12.71606	15.44798	14.43318	0	13.19852	0	13.31862	13.47689	0	14.35202	12.09157	14.91242	0	12.13598	0	0	0	0	0	0	0	12.40182	14.90917	13.11334	0	0	12.68218	13.16007	0	0	0	0	13.99347	0	15.02315
I3JYD2	I3JYD2_ORENI		angiogenesis [GO:0001525]; convergent extension involved in axis elongation [GO:0060028]; convergent extension involved in nephron morphogenesis [GO:0072045]; digestive tract development [GO:0048565]; erythrocyte development [GO:0048821]; heart looping [GO:0001947]; hematopoietic stem cell differentiation [GO:0060218]; intermediate mesoderm development [GO:0048389]; Kupffer's vesicle development [GO:0070121]; liver development [GO:0001889]; mesodermal to mesenchymal transition involved in gastrulation [GO:0060809]; pancreas development [GO:0031016]; paraxial mesoderm formation [GO:0048341]; pronephric duct morphogenesis [GO:0039023]; pronephric glomerulus morphogenesis [GO:0035775]; regulation of BMP signaling pathway involved in heart jogging [GO:2000223]; regulation of endodermal cell fate specification [GO:0042663]; somatic muscle development [GO:0007525]; somitogenesis [GO:0001756]; vasculogenesis [GO:0001570]	T-box transcription factor 16	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; transcription regulatory region sequence-specific DNA binding [GO:0000976]; angiogenesis [GO:0001525]; convergent extension involved in axis elongation [GO:0060028]; convergent extension involved in nephron morphogenesis [GO:0072045]; digestive tract development [GO:0048565]; erythrocyte development [GO:0048821]; heart looping [GO:0001947]; hematopoietic stem cell differentiation [GO:0060218]; intermediate mesoderm development [GO:0048389]; Kupffer's vesicle development [GO:0070121]; liver development [GO:0001889]; mesodermal to mesenchymal transition involved in gastrulation [GO:0060809]; pancreas development [GO:0031016]; paraxial mesoderm formation [GO:0048341]; pronephric duct morphogenesis [GO:0039023]; pronephric glomerulus morphogenesis [GO:0035775]; regulation of BMP signaling pathway involved in heart jogging [GO:2000223]; regulation of endodermal cell fate specification [GO:0042663]; somatic muscle development [GO:0007525]; somitogenesis [GO:0001756]; vasculogenesis [GO:0001570]	DNA-binding transcription factor activity [GO:0003700]; transcription regulatory region sequence-specific DNA binding [GO:0000976]	SPSPSSSIGSSNSRSGR	5.260000229	1650.231456	16.71706	15.27549	15.56952	0	13.04132	14.95514	14.65783	14.3665	15.17912	15.70101	13.98175	13.5001	16.44536	16.91735	14.6559	0	17.39953	0	0	17.45959	0	16.17804	0	13.00795	14.84173	17.68118	0	0	0	13.95777	0	0	0	0	16.61936	12.84108	0	14.04225	15.4724	15.64192	15.97307	0	0	0	0	0	16.19035	0	16.61406	0	16.99423	0	17.64487	0
I3J0L4	I3J0L4_ORENI		cardiac chamber development [GO:0003205]; embryonic heart tube development [GO:0035050]; late distal convoluted tubule development [GO:0072068]; pharyngeal system development [GO:0060037]; pronephros development [GO:0048793]; proximal convoluted tubule development [GO:0072019]	T-box transcription factor 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]; cardiac chamber development [GO:0003205]; embryonic heart tube development [GO:0035050]; late distal convoluted tubule development [GO:0072068]; pharyngeal system development [GO:0060037]; pronephros development [GO:0048793]; proximal convoluted tubule development [GO:0072019]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	YSIGMGSEEHMSEIK	5.039999962	1713.631401	15.63943	11.06135	14.75388	15.78671	13.98207	0	13.21073	0	0	13.53695	12.93403	14.97365	12.90941	0	0	0	0	0	0	13.57494	0	0	17.15815	0	0	0	0	0	0	0	13.45465	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.83017	0	14.86457	0	0	0	14.02623	0	0
A0A669B177	A0A669B177_ORENI	eomes		T-box_assoc domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	YYIPSAISK	5.289999962	1042.556697	0	15.8659	15.84936	14.25543	0	15.50749	0	0	15.61415	13.85295	0	0	15.53313	13.75727	0	15.56519	13.81157	12.4707	0	15.19067	13.54866	0	0	13.12069	0	0	14.24279	0	13.72043	11.56585	17.39091	17.53487	18.32329	0	13.1424	0	0	14.05025	0	14.80143	0	0	0	0	0	15.78691	15.88001	15.63602	0	0	0	0	0	0
A0A669ES21	A0A669ES21_ORENI	cct7	protein folding [GO:0006457]	T-complex protein 1 subunit eta (TCP-1-eta) (CCT-eta)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; unfolded protein binding [GO:0051082]; protein folding [GO:0006457]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]; unfolded protein binding [GO:0051082]	GMDKLMVDSR	3.569999933	1183.918802	0	0	0	12.29235	12.13049	11.97194	13.75985	13.28496	14.05875	13.06377	12.93414	14.32108	18.86143	0	0	15.74929	14.92919	11.2366	13.59923	11.04884	12.84539	0	12.61235	0	12.88293	10.01477	0	13.19374	9.476267	12.54879	13.76942	3.883407	11.09753	11.34289	0	0	14.44387	0	14.8923	0	0	0	13.8748	12.78535	12.4429	14.21297	0	16.01953	14.6303	18.93422	0	0	12.51609	0
I3KAA9	I3KAA9_ORENI	plat	plasminogen activation [GO:0031639]; smooth muscle cell migration [GO:0014909]	T-plasminogen activator (EC 3.4.21.68)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]	extracellular space [GO:0005615]; serine-type endopeptidase activity [GO:0004252]; plasminogen activation [GO:0031639]; smooth muscle cell migration [GO:0014909]	serine-type endopeptidase activity [GO:0004252]	GTLLIIHVQK	9.25	1121.247108	13.5653	12.22429	13.34299	13.93125	16.88011	0	0	14.65436	0	13.97959	13.28846	14.4899	14.85132	12.51149	13.62175	13.42324	14.71648	13.72538	11.10801	17.16471	14.46442	0	17.7847	15.08283	13.49516	15.31702	14.49078	12.53224	17.50465	11.89201	13.94514	13.44599	13.72893	8.698317	14.88996	14.35459	14.21637	13.68854	13.51481	14.19338	18.17053	15.47731	14.97919	13.29536	11.90736	12.57866	13.75961	13.37746	15.84348	17.10598	11.26767	0	16.58302	0
A0A669E8D8	A0A669E8D8_ORENI	LOC100705479	mitotic spindle organization [GO:0007052]	TACC_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; mitotic spindle organization [GO:0007052]		VESLERAVLQK	12.55000019	1271.497499	9.665412	0	11.48776	0	10.38949	0	18.3935	0	0	0	11.33058	0	7.187637	12.77871	13.35376	0	0	0	12.96186	0	6.818779	0	17.88598	13.10552	18.85889	12.91112	14.58478	12.64908	12.63065	0	0	0	11.83669	17.5541	13.43308	14.24569	10.97851	13.95085	11.52123	11.82131	0	9.190093	14.5622	0	0	12.29241	10.6838	11.59843	0	0	0	0	0	0
A0A669DWS8	A0A669DWS8_ORENI	LOC109202667	"DNA-templated transcription, initiation [GO:0006352]"	TAFH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	transcription factor TFIID complex [GO:0005669]	"transcription factor TFIID complex [GO:0005669]; protein heterodimerization activity [GO:0046982]; DNA-templated transcription, initiation [GO:0006352]"	protein heterodimerization activity [GO:0046982]	IGPVTSSASPGNQTK	8.460000038	1445.219937	12.27191	12.85297	14.94197	11.21193	13.87233	0	13.5168	14.42883	13.38159	10.60675	0	9.914968	14.76452	13.48336	0	13.64211	12.22126	12.16908	13.15865	0	0	15.14065	0	0	0	0	0	14.3058	15.99094	11.46476	0	19.49971	18.40417	8.535283	0	15.86595	13.62223	13.31654	0	0	15.85026	12.01259	0	0	0	0	13.68934	0	0	0	15.08967	0	0	0
A0A669D8A0	A0A669D8A0_ORENI	TAOK2		TAO kinase 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	TASGGLVAGER	7.320000172	1017.123768	0	14.20824	14.42261	10.68139	14.17962	0	12.42268	14.87844	14.86405	15.05736	0	12.69786	13.1423	12.95503	6.528447	14.09759	13.33795	12.21235	14.18379	15.17151	13.58765	0	0	0	12.19648	12.92888	8.397777	0	13.18843	15.56106	14.1476	0	13.83855	13.77703	0	0	14.49977	11.80775	0	13.66293	13.48349	0	11.75903	14.12634	11.86242	17.06993	13.65576	0	0	15.73969	15.27273	0	12.99949	15.63443
A0A669ELV5	A0A669ELV5_ORENI			TAO kinase 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	LGFSNMALTGIPSEAYPK	4.659999847	1895.092984	14.47728	0	14.00877	0	0	0	14.89105	13.18116	11.93004	13.18535	0	0	0	15.30867	13.75034	0	0	0	14.8527	17.2068	0	0	13.29158	0	0	18.38051	14.87754	12.13657	0	0	13.76141	15.33483	0	15.88605	14.20488	15.59742	11.69465	0	0	0	14.5377	13.9513	0	16.7743	0	0	13.57853	17.93429	17.34676	16.2046	17.704	15.91068	0	0
I3IVC7	I3IVC7_ORENI	tbpl1	"DNA-templated transcription, initiation [GO:0006352]; embryo development ending in birth or egg hatching [GO:0009792]; transcription by RNA polymerase II [GO:0006366]"	TATA box-binding protein-like 1 (TBP-like factor)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"DNA binding [GO:0003677]; DNA-templated transcription, initiation [GO:0006352]; embryo development ending in birth or egg hatching [GO:0009792]; transcription by RNA polymerase II [GO:0006366]"	DNA binding [GO:0003677]	IICTGATSEDEAK	6.519999981	1395.932102	6.303754	12.77662	12.07854	11.04875	12.22086	8.713375	13.34958	10.4546	11.93171	0	0	12.01398	14.19107	12.59983	0	10.5875	13.08741	13.83312	12.70011	0	0	0	0	0	14.8333	0	0	16.89833	0	0	16.87051	0	0	0	0	0	0	0	0	0	0	0	0	0	16.42614	0	16.39762	15.72311	0	14.78317	0	0	14.19521	0
A0A669BJF8	A0A669BJF8_ORENI	tbc1d31		TBC1 domain family member 31 (WD repeat-containing protein 67)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DVAGR	5.769999981	516.6306759	15.10203	0	0	15.41145	16.9087	17.64087	16.96279	17.58429	17.24774	0	0	0	16.85292	0	16.97153	0	0	0	0	16.98279	0	0	16.4301	0	0	0	0	0	0	0	16.582	0	0	0	0	13.43315	0	0	14.29994	14.97963	15.74004	0	16.70838	16.72353	15.79747	0	16.54722	0	0	0	14.84818	0	0	0
A0A669E0N0	A0A669E0N0_ORENI			"TBC1 domain family, member 15"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				RFALLTESPSDHTCLLVSTPNK	9.68999958	2485.665486	15.86594	0	14.99774	0	21.27982	13.59898	8.753588	0	14.49488	15.03424	17.56672	15.35796	15.7169	15.84627	15.48366	0	16.16362	0	12.07297	0	17.37511	15.96313	0	0	18.58094	0	0	0	17.82254	0	0	0	0	0	0	0	18.52907	0	0	10.46035	0	0	13.78164	0	0	0	0	13.98048	0	0	0	0	0	0
I3KNI6	I3KNI6_ORENI			"TBC1 domain family, member 25"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				NFSVGYLSR	6.630000114	1043.332601	14.27378	11.32414	0	11.25152	13.54155	13.83042	0	0	14.60586	0	0	14.49391	0	13.66463	15.56709	0	0	0	15.18001	12.24176	0	11.67057	9.881713	0	0	0	0	12.87889	0	0	0	0	0	11.13666	15.45654	13.34173	12.02995	15.05453	14.94307	14.2007	0	14.05701	15.57079	15.24753	13.96386	0	5.713068	13.05513	12.34938	8.333205	15.29429	10.44173	11.45614	15.73805
A0A669CMV9	A0A669CMV9_ORENI			"TBC1 domain family, member 4"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTPase activator activity [GO:0005096]	GTPase activator activity [GO:0005096]	DISSCCQGIK	5.610000134	1168.120424	12.23881	14.38278	9.027106	0	10.0457	13.3062	0	0	10.30638	0	10.9741	13.66673	14.11095	0	0	0	12.39197	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.03972	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3IU38	I3IU38_ORENI			"TBC1 domain family, member 9 (with GRAM domain)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		calcium ion binding [GO:0005509]; GTPase activator activity [GO:0005096]	calcium ion binding [GO:0005509]; GTPase activator activity [GO:0005096]	EASFFSDQNALR	22.72999954	1384.893538	0	12.91378	0	0	18.852	16.84005	17.47882	18.43713	0	19.4001	0	17.10389	0	0	17.75226	0	17.82068	17.45986	16.73035	0	13.48061	17.00162	14.6849	0	16.51316	17.31104	0	0	0	0	15.77877	0	19.51812	18.48103	0	17.9913	0	0	15.68369	15.80376	0	15.83378	16.22268	15.7973	0	17.79075	16.79719	17.1218	0	0	13.54999	17.39778	16.69183	16.73059
A0A669B2R4	A0A669B2R4_ORENI	LOC100704346	I-kappaB kinase/NF-kappaB signaling [GO:0007249]	TBD domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		I-kappaB kinase/NF-kappaB signaling [GO:0007249]		LSATRQPSGEMK	20.71999931	1317.549611	14.10725	13.66698	14.30073	15.3128	16.30231	16.89989	0	0	0	0	17.88006	14.59481	15.73715	15.22881	0	17.10507	17.1418	0	15.43308	14.94941	13.42116	0	0	0	0	0	0	0	15.04097	15.62934	14.35723	16.90033	15.07259	12.40341	15.85515	15.79637	14.69207	15.15364	15.16212	15.23656	0	12.49399	14.3677	0	17.18394	15.52814	17.10436	0	13.12364	16.2084	0	0	0	0
A0A669E2C1	A0A669E2C1_ORENI	tbx3		TBX domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	CTGLDK	6.510000229	693.3277518	16.6049	15.19385	0	15.13437	14.93869	14.25339	11.11077	17.33327	0	0	0	0	0	0	16.65091	0	0	0	18.08297	15.1184	0	0	16.26082	16.58642	0	0	15.7942	0	0	15.4425	0	0	0	15.28917	0	0	0	0	16.21663	0	0	0	0	0	0	0	0	0	17.23664	0	0	16.35141	0	0
I3KMM9	I3KMM9_ORENI	eloa	transcription elongation from RNA polymerase II promoter [GO:0006368]	TFIIS N-terminal domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	elongin complex [GO:0070449]	elongin complex [GO:0070449]; transcription elongation from RNA polymerase II promoter [GO:0006368]		KIAPMMAK	8.18999958	906.3337195	16.07923	16.18513	15.66044	14.76964	14.43576	15.58407	15.38541	0	14.95341	17.65005	17.74163	0	0	0	0	16.05596	0	16.61476	0	15.43171	0	0	0	0	0	16.49528	0	16.55353	18.00577	0	13.32129	0	0	0	0	0	15.02312	16.27975	0	16.50916	15.64467	14.6628	0	0	15.82946	15.49841	0	0	16.87692	16.9809	17.2094	0	0	17.19257
A0A669EYW0	A0A669EYW0_ORENI	tfap2b		TF_AP-2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]	DNA-binding transcription factor activity [GO:0003700]	MESSALLAQPR	5.400000095	1198.943884	0	0	0	14.87635	14.22781	9.412067	0	0	0	13.42913	12.97387	14.63169	0	14.37734	0	11.52307	17.13991	0	18.15569	0	14.88768	12.94201	17.34096	12.33854	13.42086	0	13.72089	14.11854	0	0	0	0	0	14.73771	15.26826	0	13.13698	14.51617	0	13.65321	9.373727	0	0	17.41504	0	0	0	13.62943	0	13.03889	0	0	14.15522	14.37625
A0A669CLH2	A0A669CLH2_ORENI	LOC100693532		TGF_BETA_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; glial cell-derived neurotrophic factor receptor binding [GO:0030116]; growth factor activity [GO:0008083]; receptor tyrosine kinase binding [GO:0030971]	glial cell-derived neurotrophic factor receptor binding [GO:0030116]; growth factor activity [GO:0008083]; receptor tyrosine kinase binding [GO:0030971]	RSTDDMK	13.25	868.0811929	0	12.83208	13.96385	12.94388	15.34761	15.09587	14.53645	0	0	0	16.71582	0	16.47279	0	0	0	0	16.08149	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3IV12	I3IV12_ORENI	LOC100709756	peptide cross-linking [GO:0018149]	TGc domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; metal ion binding [GO:0046872]; protein-glutamine gamma-glutamyltransferase activity [GO:0003810]; peptide cross-linking [GO:0018149]	metal ion binding [GO:0046872]; protein-glutamine gamma-glutamyltransferase activity [GO:0003810]	YALSRNNEK	4.239999771	1095.40491	0	0	15.19419	0	14.86658	13.55666	15.72627	0	0	0	0	0	14.68009	0	0	0	13.71633	0	0	0	0	0	0	14.4676	15.42331	15.71243	0	0	0	16.15067	0	15.22472	16.67118	13.64186	0	0	0	15.9556	0	0	15.82406	13.90191	0	15.17768	0	0	0	0	15.35494	0	0	14.7289	0	14.68538
A0A669EIP0	A0A669EIP0_ORENI	LOC109200509	cell cycle [GO:0007049]	THAP-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; metal ion binding [GO:0046872]; sequence-specific DNA binding [GO:0043565]; cell cycle [GO:0007049]	metal ion binding [GO:0046872]; sequence-specific DNA binding [GO:0043565]	LIKGAVPTLFEWNGFK	9.930000305	1820.428384	13.89449	13.18172	0	0	8.43096	0	13.18139	0	15.22123	12.64591	13.40929	13.41747	15.52889	14.82356	13.19436	12.09834	0	14.87144	15.48037	14.65423	14.65092	13.61232	12.05421	13.63424	13.16576	0	15.03352	14.07614	15.93014	16.84371	0	15.35686	0	0	11.5572	0	0	0	0	13.72785	13.84777	0	0	0	0	13.31548	11.2599	0	13.45413	0	0	0	0	13.21572
A0A669BN26	A0A669BN26_ORENI		mRNA export from nucleus [GO:0006406]; mRNA processing [GO:0006397]	THO complex subunit 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	THO complex [GO:0000347]	THO complex [GO:0000347]; mRNA export from nucleus [GO:0006406]; mRNA processing [GO:0006397]		GDRSAVAGSLK	10.61999989	1061.113109	6.737138	10.39793	12.72728	14.67699	15.17943	14.11632	0	14.38845	14.49089	0	15.41354	18.67653	12.72211	10.30868	15.25689	4.996827	12.23079	13.05344	0	13.21231	15.29625	17.3476	11.89167	14.48976	13.65116	10.81809	10.93271	11.61347	13.07559	0	11.58011	13.66282	12.96254	11.39287	0	11.86476	11.5594	13.5408	12.89087	15.14748	11.87269	0	12.62113	13.56828	13.66745	17.19951	13.16202	12.07415	9.904737	17.28154	12.40099	9.350794	15.06857	7.282831
A0A669DUQ0	A0A669DUQ0_ORENI			TIA1 cytotoxic granule-associated RNA binding protein-like 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]	RNA binding [GO:0003723]	ISNAHR	9.529999733	696.6187234	13.67009	15.12473	13.83467	14.94876	15.66981	14.92002	15.57467	14.96068	14.36571	15.2549	15.66771	15.50732	14.46224	14.29969	14.97397	13.77436	14.9144	13.79291	15.02043	0	14.53953	14.41426	0	14.87856	0	15.57274	14.47101	14.00119	0	15.11856	19.14103	18.4129	17.88155	13.7715	14.28459	14.67228	13.00679	15.30175	13.89636	15.22431	14.37935	15.35853	15.14174	15.2413	15.9993	14.78469	15.2704	14.74577	13.86373	14.9423	14.84342	15.55628	15.57101	14.97437
I3JDX5	I3JDX5_ORENI		activation of GTPase activity [GO:0090630]; small GTPase mediated signal transduction [GO:0007264]	TIAM Rac1 associated GEF 1b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		guanyl-nucleotide exchange factor activity [GO:0005085]; activation of GTPase activity [GO:0090630]; small GTPase mediated signal transduction [GO:0007264]	guanyl-nucleotide exchange factor activity [GO:0005085]	SRHASSGK	10.52999973	829.8531212	15.48911	0	0	0	13.5602	0	17.28033	0	0	17.10461	15.63104	0	0	15.71588	0	15.02416	0	0	18.05282	0	13.40113	0	16.43231	0	0	0	13.89858	17.15233	17.26912	0	0	0	0	0	14.46296	14.3226	15.54988	15.6973	0	0	0	16.34597	0	16.18017	0	17.53214	14.76358	0	16.80803	14.6028	15.4427	0	0	15.04524
A0A669DE51	A0A669DE51_ORENI	tiprl	regulation of phosphoprotein phosphatase activity [GO:0043666]	TIP41-like protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		regulation of phosphoprotein phosphatase activity [GO:0043666]		VMPTSFFLLMR	23.18000031	1353.668375	14.7706	10.78337	12.75391	13.44611	14.42547	0	15.02165	15.71799	10.39939	15.03578	10.65659	14.5396	0	17.55482	15.50788	16.15248	10.34792	0	17.59209	0	0	0	14.2736	0	13.405	14.18046	0	12.45451	0	0	16.0155	20.08214	18.53943	18.50187	0	18.01109	0	0	15.38942	13.10205	0	14.53138	13.56622	0	16.98515	0	15.76095	13.05583	17.27762	17.42345	0	0	0	0
A0A669D6X0	A0A669D6X0_ORENI	LOC100700682	inflammatory response [GO:0006954]; innate immune response [GO:0045087]; toll-like receptor signaling pathway [GO:0002224]	TIR domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; transmembrane signaling receptor activity [GO:0004888]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; toll-like receptor signaling pathway [GO:0002224]	transmembrane signaling receptor activity [GO:0004888]	LHIKVHK	1.49000001	875.7429438	14.29978	0	0	14.49038	13.88886	15.19254	0	0	0	0	0	0	11.73016	11.96699	0	0	13.41099	0	0	0	0	0	16.8595	0	13.8239	14.36543	0	13.90573	10.82076	0	0	14.71835	0	0	0	0	13.78257	0	0	14.26439	0	0	0	0	0	14.29531	13.6157	13.26054	0	0	0	0	14.72633	0
I3KP20	I3KP20_ORENI	LOC102078242		TLDc domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasmic vesicle [GO:0031410]; membrane [GO:0016020]; synapse [GO:0045202]	cytoplasmic vesicle [GO:0031410]; membrane [GO:0016020]; synapse [GO:0045202]		HKPNKQSPSR	6.699999809	1177.702105	0	14.68188	14.16342	0	0	12.99954	0	14.02791	14.19426	14.96758	11.53891	14.70312	14.64676	14.4829	10.94692	13.63786	15.81986	10.21265	14.83619	14.77468	12.52386	0	13.22562	0	12.74844	14.24939	12.24873	14.31183	13.91968	15.18533	16.76177	17.70549	18.33812	0	15.05295	14.14326	15.79607	0	14.4152	0	9.012586	0	13.41696	14.69359	0	14.40005	14.94008	15.64605	12.36285	0	0	0	14.12232	0
W8G4W8	W8G4W8_ORENI		inflammatory response [GO:0006954]; innate immune response [GO:0045087]; toll-like receptor signaling pathway [GO:0002224]	TLR21 receptor protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; transmembrane signaling receptor activity [GO:0004888]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; toll-like receptor signaling pathway [GO:0002224]	transmembrane signaling receptor activity [GO:0004888]	LAAENMGIQNFSK	2.450000048	1422.774114	8.72164	10.12032	0	7.227359	10.7658	0	14.15825	0	0	11.18639	0	0	13.16441	0	11.67735	13.18272	10.98757	12.45595	0	13.81639	0	17.21526	12.95968	10.49537	0	12.98173	0	13.3149	0	0	16.54731	0	0	0	0	0	0	13.19165	10.02509	11.86704	11.66581	0	0	0	0	0	11.10451	9.704771	0	0	0	0	0	9.52011
A0A669D3Z7	A0A669D3Z7_ORENI	tmem131l		TMEM131_like domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		DASARTHR	3.910000086	913.4591426	15.66119	14.98296	0	13.2407	14.21345	0	11.73562	13.27411	16.38203	15.70849	16.46252	12.53375	16.28168	15.28235	0	16.14622	16.48295	15.88272	14.74531	15.90576	0	0	0	0	15.56196	17.50712	14.24778	0	18.04357	16.52123	18.84029	18.76444	17.95949	0	16.20411	0	16.31375	15.737	0	13.60002	15.79721	15.79693	16.38271	0	14.77869	15.10994	14.49706	18.11259	18.06638	0	0	0	17.14667	17.18078
A0A669DV29	A0A669DV29_ORENI	LOC102078038		TMEM132 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		GGMVSR	3.220000029	622.7421483	14.97106	13.47605	15.41536	16.07463	14.46509	15.03531	16.57396	15.714	16.38195	15.13137	16.89504	15.71872	14.95633	15.0583	15.29225	14.49445	15.79903	16.4647	0	16.09727	15.88749	16.65201	15.26497	17.33511	17.43457	0	15.34903	15.01945	17.10842	0	17.0007	16.10265	17.2889	17.2836	16.02641	0	15.28798	0	0	0	0	0	0	0	0	0	0	16.67944	0	0	0	18.44674	0	0
I3KGR6	I3KGR6_ORENI	LOC100697176	apoptotic process [GO:0006915]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; regulation of apoptotic process [GO:0042981]; signal transduction [GO:0007165]	TNF receptor-associated factor (EC 2.3.2.27)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; tumor necrosis factor receptor binding [GO:0005164]; zinc ion binding [GO:0008270]; apoptotic process [GO:0006915]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; regulation of apoptotic process [GO:0042981]; signal transduction [GO:0007165]	tumor necrosis factor receptor binding [GO:0005164]; zinc ion binding [GO:0008270]	KFGCSVQGK	2.319999933	1008.683676	12.35028	11.78571	10.97843	13.4083	13.8354	12.11699	10.06686	13.91165	14.78831	14.97311	14.57481	13.55006	14.81209	15.14639	15.27593	0	0	15.28323	0	0	11.85919	0	16.06894	15.0171	12.7037	13.89487	11.85889	15.45151	14.53818	11.59545	15.20344	0	13.80826	0	14.67337	12.44504	14.40383	15.51897	0	0	13.91518	0	0	12.70576	0	13.24094	0	14.04488	15.29263	13.95447	0	0	15.285	15.55345
I3J412	I3J412_ORENI	traf2	activation of NF-kappaB-inducing kinase activity [GO:0007250]; apoptotic process [GO:0006915]; protein autoubiquitination [GO:0051865]; regulation of apoptotic process [GO:0042981]; regulation of JNK cascade [GO:0046328]; tumor necrosis factor-mediated signaling pathway [GO:0033209]	TNF receptor-associated factor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]	cytosol [GO:0005829]; tumor necrosis factor receptor binding [GO:0005164]; ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]; activation of NF-kappaB-inducing kinase activity [GO:0007250]; apoptotic process [GO:0006915]; protein autoubiquitination [GO:0051865]; regulation of apoptotic process [GO:0042981]; regulation of JNK cascade [GO:0046328]; tumor necrosis factor-mediated signaling pathway [GO:0033209]	tumor necrosis factor receptor binding [GO:0005164]; ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]	MTFNFK	3.819999933	802.6563326	12.76606	0	0	10.34161	0	10.54782	0	0	10.21143	0	0	14.43004	13.68064	13.03039	0	14.60101	14.87941	0	0	0	0	0	0	0	14.37102	17.00551	15.33934	14.56515	14.21272	14.82958	0	0	0	15.81714	16.86546	14.71971	15.76717	0	14.87477	15.50824	14.96643	15.79201	0	0	0	0	13.91685	0	14.20617	6.686935	15.47013	17.09593	0	0
I3KSR0	I3KSR0_ORENI	LOC100703972		TNFR-Cys domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MGSLKR	5.360000134	707.1726281	17.95707	17.17124	0	17.87879	17.459	16.67533	17.29118	18.05354	15.0871	18.60667	18.76834	17.24378	14.47208	18.89418	0	17.04534	15.83261	17.29954	16.42679	17.22951	17.74225	17.54698	17.58783	15.29978	18.57788	17.58603	17.41006	15.10288	16.00548	16.2066	17.34855	14.95289	15.91147	14.59253	18.04391	16.80992	15.47521	16.46518	16.43803	16.21751	17.6276	16.65419	14.70457	15.79006	17.55813	17.73954	15.51616	16.26296	17.75653	16.00036	14.8075	17.6182	17.98027	16.42429
I3J0M8	I3J0M8_ORENI	LOC100698833	immune response [GO:0006955]	TNF_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; tumor necrosis factor receptor binding [GO:0005164]; immune response [GO:0006955]	tumor necrosis factor receptor binding [GO:0005164]	ISMHTDKYPGNITLLQSR	2.779999971	2089.563531	0	0	14.12918	14.36664	14.12753	13.44708	11.77908	12.47078	0	15.41828	14.85677	15.29163	0	0	13.71724	14.86463	12.88159	13.51272	13.8686	15.72946	14.39842	14.37549	0	12.06454	14.52334	12.77532	14.18874	14.22178	14.99165	15.20349	16.57761	16.16457	13.9552	0	0	0	13.83201	14.26982	14.38588	10.37311	13.86551	14.38754	0	0	13.6464	0	14.72264	14.71295	14.85584	13.42408	0	0	15.17941	13.93281
I3JHL7	I3JHL7_ORENI	cep104	cilium assembly [GO:0060271]; cranial nerve development [GO:0021545]; heart looping [GO:0001947]	TOG domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cilium assembly [GO:0060271]; cranial nerve development [GO:0021545]; heart looping [GO:0001947]		SNFPSR	10.19999981	706.0891215	12.16595	15.41646	15.44631	15.58444	16.45755	16.61271	16.93533	0	16.91061	15.48623	0	16.71579	16.48508	16.41633	16.75633	16.52087	15.32416	15.90455	0	17.07228	17.13462	16.3834	18.12456	16.23803	0	0	0	0	0	0	16.82711	16.24133	0	0	17.08586	15.31048	15.17683	16.25929	18.83194	16.55703	18.47599	15.68109	0	16.46185	15.89336	16.47876	16.59218	16.04886	0	17.08964	16.08633	0	0	0
I3KKI6	I3KKI6_ORENI	spo11		TP6A_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]	"chromosome [GO:0005694]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; endodeoxyribonuclease activity, producing 3'-phosphomonoesters [GO:0016889]; metal ion binding [GO:0046872]"	"ATP binding [GO:0005524]; DNA binding [GO:0003677]; endodeoxyribonuclease activity, producing 3'-phosphomonoesters [GO:0016889]; metal ion binding [GO:0046872]"	FVMIIEKDATFQR	6.489999771	1614.084559	15.49419	12.48848	14.68828	12.04511	12.64446	0	14.56841	0	14.03001	14.62024	15.63148	15.16717	15.91818	15.23331	14.39335	0	13.54437	13.35969	0	0	13.16009	9.448513	14.27498	10.76891	14.15027	0	11.17481	15.31987	13.39935	14.1638	14.52138	16.0764	15.93565	0	0	15.00892	13.40326	15.05158	14.45557	0	0	14.96433	0	14.84307	13.89601	13.52021	0	13.66663	14.64816	13.57861	15.01725	15.25438	14.40487	16.51305
A0A669BPN8	A0A669BPN8_ORENI			TPH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EMEIAK	3.079999924	735.4457093	15.03923	16.67981	0	15.07287	0	0	14.91655	15.28862	0	14.46297	13.84301	0	12.40246	0	0	0	0	14.24909	16.98886	0	13.59916	15.16431	0	15.2192	0	9.662936	15.12436	0	17.71945	14.58618	16.17903	0	15.84907	0	0	0	0	0	14.02372	16.49235	13.72898	0	0	14.61418	14.97703	0	12.82084	0	0	0	15.62514	13.52706	11.64344	13.97935
I3K964	I3K964_ORENI	ttc19	mitochondrial respiratory chain complex III assembly [GO:0034551]	TPR_MalT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrion [GO:0005739]	mitochondrion [GO:0005739]; mitochondrial respiratory chain complex III assembly [GO:0034551]		QAGQDYR	12.92000008	836.6204438	0	0	14.4888	16.34336	0	0	18.77946	14.03506	14.6157	16.3168	15.50835	18.8489	0	0	17.378	16.98669	16.9184	16.55511	15.0123	0	16.32689	0	15.14925	14.30349	20.79609	18.50315	16.3588	14.51357	20.25339	0	16.9227	0	17.10423	16.98176	16.96856	16.15739	0	0	17.52899	17.23016	13.91979	13.64395	0	18.69209	0	0	16.05142	17.60196	0	16.45658	16.24096	17.85505	20.46499	20.01994
I3J4X8	I3J4X8_ORENI	LOC100691480		TPR_REGION domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SYLTNAK	20.87999916	796.6168973	15.76125	15.61604	14.70974	14.47267	15.90517	15.67658	16.69397	15.88754	14.32537	17.64515	14.77794	14.14703	16.19116	16.36513	15.83291	17.94001	18.22146	16.27431	15.40278	16.33776	18.64489	17.78727	17.70124	17.07499	15.21848	14.95347	16.221	19.05647	19.06652	19.34735	18.48862	18.35156	18.11106	16.90726	16.76551	15.25429	17.21706	16.91749	16.9871	17.87176	17.26142	18.33932	17.1841	17.483	16.37966	16.03668	17.21852	14.87568	17.62789	17.13761	16.82087	17.96729	15.67557	16.55268
A0A669ET18	A0A669ET18_ORENI	LOC100708925		TPT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		AAHVK	1.100000024	524.4423178	15.37857	13.18598	14.47578	16.11412	17.00648	0	16.32743	0	0	0	15.89359	0	0	0	17.65713	0	0	0	0	0	0	0	0	0	17.20104	0	0	15.95823	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.93697	0	0	0	0	0	0	20.51706	17.13192
I3K6K2	I3K6K2_ORENI			TRAF-type zinc finger domain containing 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	KTSNFDVSVK	1.00999999	1124.942887	13.97677	8.761887	13.64254	12.83734	12.93528	13.60227	10.05454	18.4888	13.97712	14.97454	12.95976	13.92129	0	16.9301	13.84627	14.17916	9.874001	0	13.54249	14.61111	15.45423	13.29515	12.76184	11.68646	12.78119	13.78331	14.04242	12.99939	15.48068	13.98899	0	13.79648	15.20313	12.5057	11.2951	13.67522	16.56141	13.17137	0	15.32397	0	17.09012	11.59528	13.03915	0	12.56934	15.11434	0	14.7019	14.87487	0	11.3468	0	12.59487
I3K6E6	I3K6E6_ORENI	zcchc8		TRAMP-like complex RNA-binding factor ZCCHC8 (Zinc finger CCHC domain-containing protein 8)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleoplasm [GO:0005654]	nucleoplasm [GO:0005654]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	VTAVPHR	10.03999996	778.1721254	17.11607	16.46987	21.04761	17.46814	17.05202	0	19.0388	0	16.5379	17.37893	17.95497	17.30731	17.44251	16.78183	20.27768	0	0	18.26318	18.47367	0	20.1465	20.84588	17.88838	0	16.99549	21.38399	17.50626	19.56195	0	17.65872	22.77437	22.36538	17.29397	17.42582	17.17376	17.56249	0	0	16.96222	0	0	17.96252	21.89589	17.93977	17.05822	15.75218	0	0	20.66171	17.61347	17.65586	22.27541	18.47066	20.46222
A0A669CZW0	A0A669CZW0_ORENI			TSC complex subunit 1a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LGALTLLGHMIR	4.190000057	1309.615936	14.51085	0	14.50267	13.95609	10.33286	12.08303	0	0	0	17.05639	0	14.28211	0	0	0	0	13.83907	0	0	14.7307	0	0	16.23309	13.25147	12.43694	0	0	0	14.73825	0	21.7013	24.45871	24.68404	0	16.50219	0	0	12.61767	0	12.38946	11.44801	12.1178	0	0	0	0	0	13.05363	0	0	0	0	0	0
A0A669DUH1	A0A669DUH1_ORENI	ttc5		TTC5_OB domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KHSDVAEEMAR	9.369999886	1288.156695	13.0215	0	0	15.64731	12.13161	15.95837	13.34339	15.00601	0	0	15.15381	8.253863	15.52857	16.43448	0	0	0	11.25152	14.2479	0	0	0	0	0	0	0	0	16.76903	0	0	10.59475	0	0	13.50723	0	15.57517	0	12.6084	13.21875	0	0	15.06187	11.52355	0	0	10.08814	14.77781	0	15.05527	0	0	15.47499	0	0
A0A669BDB9	A0A669BDB9_ORENI			TTF-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein dimerization activity [GO:0046983]	protein dimerization activity [GO:0046983]	LPAILCVLEEISSENNAQRAVEAK	2.210000038	2654.588775	0	0	14.50765	16.0199	16.30663	15.13682	15.30885	0	15.7033	0	0	17.38401	16.23627	0	0	0	0	0	17.43564	14.89518	16.54741	0	0	0	0	0	0	13.33404	0	15.30456	0	0	16.21448	0	0	0	14.75056	0	14.67181	0	14.47683	16.70026	15.64519	15.85023	0	0	17.46346	14.12925	15.08968	0	0	18.71867	0	0
A0A669BSW6	A0A669BSW6_ORENI		cell adhesion [GO:0007155]; endocytosis [GO:0006897]	Talin 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; focal adhesion [GO:0005925]; plasma membrane [GO:0005886]; ruffle [GO:0001726]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; focal adhesion [GO:0005925]; plasma membrane [GO:0005886]; ruffle [GO:0001726]; actin filament binding [GO:0051015]; clathrin binding [GO:0030276]; structural constituent of cytoskeleton [GO:0005200]; cell adhesion [GO:0007155]; endocytosis [GO:0006897]	actin filament binding [GO:0051015]; clathrin binding [GO:0030276]; structural constituent of cytoskeleton [GO:0005200]	TMQFEPSTMVYDACRIIR	9.449999809	2250.559059	12.98335	0	0	0	0	12.31208	0	11.23713	8.059772	0	0	13.45451	13.37415	14.34991	0	0	0	15.94202	17.32942	17.08425	15.52629	13.26045	0	16.24722	15.30581	16.73104	15.5723	14.98245	0	14.66926	10.34018	12.75607	15.9748	15.82289	17.47214	13.81409	14.13108	8.297367	0	8.062014	12.69145	9.663124	14.85812	0	0	0	17.53868	0	16.65058	14.0085	12.36292	13.72731	0	16.57817
A0A669BV83	A0A669BV83_ORENI		cell adhesion [GO:0007155]	Talin 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; focal adhesion [GO:0005925]; membrane [GO:0016020]; ruffle [GO:0001726]	cytoplasm [GO:0005737]; focal adhesion [GO:0005925]; membrane [GO:0016020]; ruffle [GO:0001726]; actin filament binding [GO:0051015]; structural constituent of cytoskeleton [GO:0005200]; cell adhesion [GO:0007155]	actin filament binding [GO:0051015]; structural constituent of cytoskeleton [GO:0005200]	GVAASTTDPK	10.77000046	945.0037383	11.9535	12.07583	13.9557	13.4776	12.35965	14.50933	10.95814	14.1751	13.16448	13.85236	13.35618	13.3069	12.14937	12.23302	0	14.26422	15.43993	0	0	0	14.74985	14.67351	14.96564	15.01035	15.8021	13.38869	0	13.75318	0	15.39094	16.77757	0	20.18559	15.16649	13.43496	12.94165	0	14.74159	0	13.866	14.4363	0	14.24541	14.346	0	13.05589	14.73565	14.16886	0	15.27724	0	0	9.181272	14.46188
I3KU98	I3KU98_ORENI	TC2N		"Tandem C2 domains, nuclear"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		SFGPQSPGTK	8.789999962	1005.305486	13.40015	13.69505	12.46608	10.89848	15.37233	13.4078	12.5281	11.23224	13.56693	13.61619	0	12.35647	13.85502	14.37064	13.39355	0	0	0	15.44323	0	15.22379	0	0	0	0	0	0	0	16.76487	14.82164	0	15.78899	0	0	0	0	13.4353	14.31627	15.60371	17.74815	0	0	14.66484	14.96947	0	14.64639	16.12715	0	14.15749	0	0	15.34172	15.69755	14.90557
A0A669C4V3	A0A669C4V3_ORENI			Tankyrase_bdg_C domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				EEEMER	4.079999924	837.1998496	14.51899	14.62181	15.56908	15.49104	12.67792	15.8167	14.19356	14.24312	15.33118	11.40365	0	0	0	18.1363	17.0861	17.48133	0	0	16.17423	0	15.53304	0	15.93131	14.38676	0	0	0	15.92317	14.47315	0	0	17.66009	0	0	16.63663	16.53322	16.22937	14.74004	0	0	17.39909	0	16.90425	0	0	0	0	0	0	0	0	0	0	0
A0A669B262	A0A669B262_ORENI			Tau tubulin kinase 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	LGLESKPSPER	7.369999886	1212.657807	10.96193	10.60977	9.746686	12.29401	14.96642	14.48814	13.72257	18.18253	10.90198	10.98473	12.62135	12.61158	0	0	0	18.96009	0	11.85897	0	17.80559	12.29968	11.95793	12.59089	0	8.404702	17.71577	0	14.78629	14.61721	0	11.11995	14.71066	14.19003	14.23546	14.08355	11.63756	13.74217	12.96737	10.64503	0	6.733592	13.25179	16.45164	17.04866	13.23423	9.183382	12.33025	12.92261	14.66871	11.95715	14.97507	14.50147	0	10.8368
A0A669EJV9	A0A669EJV9_ORENI	tecpr1		Tectonin beta-propeller repeat-containing protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	autophagosome membrane [GO:0000421]; integral component of membrane [GO:0016021]; lysosomal membrane [GO:0005765]	autophagosome membrane [GO:0000421]; integral component of membrane [GO:0016021]; lysosomal membrane [GO:0005765]		APSVASDAESDLEK	9.760000229	1418.403828	9.888118	0	9.062799	0	0	0	13.52099	10.03581	0	0	0	0	0	10.92109	0	0	13.06938	0	0	15.00165	17.34386	12.26181	0	0	0	0	8.679183	0	0	12.52121	0	11.78322	0	0	0	0	0	0	0	8.616351	0	12.83036	0	13.69307	0	9.961272	0	0	12.77653	0	0	0	11.91436	0
I3KMD3	I3KMD3_ORENI	tekt4	cilium assembly [GO:0060271]; cilium movement involved in cell motility [GO:0060294]	Tektin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	microtubule cytoskeleton [GO:0015630]; motile cilium [GO:0031514]	microtubule cytoskeleton [GO:0015630]; motile cilium [GO:0031514]; cilium assembly [GO:0060271]; cilium movement involved in cell motility [GO:0060294]		SLRPNMELCR	5.539999962	1276.441913	12.95497	12.9198	12.67057	11.55567	12.95903	12.9849	14.80369	16.36562	0	0	0	13.43958	17.71162	14.3862	11.01288	0	10.28377	14.62632	13.78329	9.690639	13.6945	11.47454	15.19491	0	11.21673	13.33299	13.14932	0	11.71319	0	15.00725	0	15.09807	0	13.92107	0	13.32404	0	10.77387	0	0	14.30911	0	0	0	10.12151	7.135965	14.66639	0	10.7849	0	0	13.46889	12.61094
I3KA17	I3KA17_ORENI	terf1	cell cycle [GO:0007049]; telomere maintenance [GO:0000723]	Telomeric repeat-binding factor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]"	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]; double-stranded telomeric DNA binding [GO:0003691]; protein homodimerization activity [GO:0042803]; cell cycle [GO:0007049]; telomere maintenance [GO:0000723]"	double-stranded telomeric DNA binding [GO:0003691]; protein homodimerization activity [GO:0042803]	AASKMVQSSHK	5.539999962	1188.330819	13.04189	0	0	0	12.4601	10.37806	13.65275	0	12.08464	16.49024	13.18975	0	0	13.08079	0	16.92452	0	0	11.15943	12.91089	0	10.53483	0	16.36863	9.80929	0	10.21962	13.53422	0	11.94962	16.84534	16.66964	17.32031	17.97413	0	0	0	0	12.82076	0	10.36441	15.23267	0	0	0	0	0	0	0	0	0	0	17.24432	0
A0A669C423	A0A669C423_ORENI	LOC100690152	triterpenoid biosynthetic process [GO:0016104]	Terpene cyclase/mutase family member (EC 5.4.99.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	lipid droplet [GO:0005811]	lipid droplet [GO:0005811]; beta-amyrin synthase activity [GO:0042300]; lanosterol synthase activity [GO:0000250]; triterpenoid biosynthetic process [GO:0016104]	beta-amyrin synthase activity [GO:0042300]; lanosterol synthase activity [GO:0000250]	ELYDHIK	6.409999847	917.0620577	15.91501	16.01588	0	16.40542	0	16.67708	0	0	0	0	16.91257	0	0	16.65571	0	0	0	0	17.00153	0	0	0	0	0	0	0	0	0	0	0	0	17.08519	0	16.18435	0	15.86659	0	0	16.80022	16.72207	16.34367	17.28697	0	0	17.63253	16.65489	0	16.33779	0	0	16.54609	0	0	0
A0A669BHK4	A0A669BHK4_ORENI	LOC100693258		Tetraspanin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MGKVEGGMK	8.789999962	953.3701492	15.74141	0	0	14.58897	13.34711	15.30853	17.38834	15.13668	14.69877	14.28105	16.8209	16.3928	0	15.89294	14.46864	15.56195	14.09236	15.67455	15.22671	16.75511	13.90359	16.92083	0	15.19776	16.32546	13.63518	15.58917	16.3448	0	16.16376	16.58826	16.42717	17.10577	0	17.11612	0	15.1593	15.70076	15.28908	14.92096	16.11119	15.11178	16.52193	0	14.23826	15.87086	18.01169	18.13512	17.01503	16.97675	18.09984	15.99661	0	16.50603
A0A669CYL0	A0A669CYL0_ORENI			Tetratricopeptide repeat domain 22	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	membrane [GO:0016020]		LNNCSNMSGPPSFMLCR	11.40999985	2000.784908	0	0	0	0	19.98952	0	0	0	0	0	15.93221	0	0	0	0	0	0	0	0	0	0	0	0	20.70964	0	19.41857	0	20.89907	0	0	17.34453	0	0	0	0	0	12.77282	16.12052	0	0	19.23628	16.21055	0	0	21.38856	0	0	14.46782	0	0	0	0	0	22.12013
A0A669B809	A0A669B809_ORENI	TTC28		Tetratricopeptide repeat domain 28	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				FSLIAVPSIHGLGTSAK	4.070000172	1697.953614	0	0	11.85198	0	0	13.70336	11.82548	0	13.91045	14.61655	15.43385	0	0	13.25112	14.06301	0	13.90397	14.23176	12.81168	0	0	0	0	0	0	0	0	0	0	0	12.63913	17.27838	13.47937	15.03553	16.03473	15.87369	12.93231	0	14.08493	0	0	13.72648	0	0	0	0	13.80407	11.80081	0	0	0	0	0	12.63626
A0A669CPW5	A0A669CPW5_ORENI			Tetratricopeptide repeat domain 7B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LSMIAESYATK	9.5	1230.013338	12.7429	13.78683	13.00637	11.74817	14.52088	0	0	0	14.35506	11.55568	15.61863	12.80672	13.90876	6.298439	18.58468	11.36111	19.71027	12.5725	14.29609	0	14.60808	15.28867	0	0	18.33112	0	0	17.36017	0	18.59733	13.44585	0	0	0	0	9.48466	0	0	0	0	6.709511	15.07084	0	12.61575	0	0	14.27407	10.71022	0	13.46887	0	0	15.53324	14.26358
A0A669F740	A0A669F740_ORENI			Tetratricopeptide repeat domain 9B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LTEEQRR	11.39000034	930.3460965	14.35917	15.70958	16.06744	0	0	15.77532	15.39329	15.77977	15.93166	0	0	0	0	15.75403	0	0	15.26036	14.77295	0	16.49482	16.04671	14.33382	14.15847	16.05408	16.07459	12.9609	14.97989	14.2695	15.82827	0	20.22732	19.79357	17.98875	11.39014	15.23577	15.48282	14.26401	14.50323	15.0119	15.77737	14.17686	14.69571	12.81306	0	14.73597	0	16.7508	0	19.54103	19.43762	17.96308	0	0	0
I3JCN6	I3JCN6_ORENI		cilium assembly [GO:0060271]; determination of heart left/right asymmetry [GO:0061371]; otolith morphogenesis [GO:0032474]	Tetratricopeptide repeat domain 9C	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cilium assembly [GO:0060271]; determination of heart left/right asymmetry [GO:0061371]; otolith morphogenesis [GO:0032474]		EQPNDANVRK	4.630000114	1170.36282	11.87723	12.42957	14.5748	14.73473	0	11.11344	0	14.30158	13.01285	9.1905	0	10.05251	0	0	0	0	12.8524	13.67479	0	13.92749	0	13.65529	14.35659	14.04478	14.35965	18.08603	17.30958	13.73137	0	18.62237	0	16.91643	16.94142	0	0	0	0	13.70369	0	14.0618	0	14.64682	10.66716	0	14.10101	0	0	10.28441	13.28722	12.69701	16.86375	0	0	12.34927
A0A669EXP4	A0A669EXP4_ORENI		thiamine metabolic process [GO:0006772]	Thiamine-triphosphatase (EC 3.6.1.28)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; metal ion binding [GO:0046872]; thiamin-triphosphatase activity [GO:0050333]; thiamine metabolic process [GO:0006772]	metal ion binding [GO:0046872]; thiamin-triphosphatase activity [GO:0050333]	LLSEHIL	8.260000229	824.6659186	15.38732	15.43072	15.36747	16.43214	15.47439	16.1476	15.8478	15.79883	15.92706	15.9159	15.15155	16.02116	17.06492	16.08663	0	15.01757	16.47401	0	0	0	0	0	15.53232	0	0	0	0	0	0	0	17.16405	19.11116	15.59293	16.05093	15.73229	15.99894	0	0	16.83026	17.09908	15.70192	15.52527	16.45773	15.6508	16.71269	17.18816	15.74279	17.73501	13.33051	16.64677	15.22799	16.35386	17.82604	0
A0A669BFS6	A0A669BFS6_ORENI			Thimet oligopeptidase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	MTYAIMGGVK	5.690000057	1085.557817	0	13.51648	14.74114	0	0	0	12.93467	14.66831	0	0	13.8472	14.80267	0	9.454705	0	0	15.395	14.01524	0	15.37817	0	0	0	0	0	0	15.57249	0	0	14.16867	19.19694	13.20505	14.8941	11.6585	14.27417	17.37785	15.09592	12.88269	14.03953	0	14.97724	12.23683	0	11.61294	13.5392	0	0	0	7.407662	15.54048	13.91774	0	0	0
A0A669CBP2	A0A669CBP2_ORENI	spata20	carbohydrate metabolic process [GO:0005975]	Thioredox_DsbH domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		carbohydrate metabolic process [GO:0005975]		QVLMLADGNTESFLCQR	7.409999847	1998.945237	13.4915	14.29709	11.9748	9.817726	13.27941	14.36708	12.00125	13.84049	14.66289	16.03288	0	14.78537	0	13.3527	0	12.62919	14.67086	15.18663	13.8558	0	14.84875	14.88995	7.712772	0	0	12.62869	0	9.313751	11.47699	13.04525	16.04774	15.8388	16.02304	13.85724	12.69944	14.1227	13.95181	0	12.13379	14.30117	12.93038	13.9074	14.4409	13.2477	11.27181	14.82613	12.76193	13.36315	0	14.81571	0	0	12.80867	16.4584
A0A669EA08	A0A669EA08_ORENI	LOC100703953		Thioredoxin domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		peroxidase activity [GO:0004601]; peroxiredoxin activity [GO:0051920]	peroxidase activity [GO:0004601]; peroxiredoxin activity [GO:0051920]	ELSVQLGMLDPDEK	16.45000076	1574.933117	0	0	0	0	15.44983	15.827	13.92906	14.82627	0	15.64174	15.62383	15.01899	16.64898	17.17683	17.67142	15.20459	16.09833	0	14.60163	16.29219	16.81709	17.2437	17.63997	19.56966	0	16.65129	0	16.89784	16.25574	0	0	0	0	0	0	0	0	17.69353	0	0	16.63038	0	16.07598	0	0	0	16.47367	15.86231	0	0	17.99271	0	0	0
I3JVY5	I3JVY5_ORENI	txnip		Thioredoxin-interacting protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MVAMTKK	4.829999924	839.7314041	14.83423	0	17.52817	16.8352	15.04539	15.70191	0	16.43745	15.80681	15.10135	14.85239	0	14.88644	15.64005	15.45467	17.83729	15.94226	15.21701	14.80937	15.64796	16.37005	17.14054	15.3453	16.3374	15.16049	14.09226	15.77858	15.86125	18.03539	15.17595	15.63702	15.83769	15.70047	15.06602	15.62341	13.64742	14.02969	0	0	12.03847	9.681888	13.337	14.09936	17.61139	15.88783	16.05752	15.62945	0	17.48712	16.08242	0	16.31395	16.23847	16.83504
A0A669DIT5	A0A669DIT5_ORENI			Thioredoxin_11 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LVKVFDDR	1.299999952	991.9447969	10.24932	12.00773	12.29465	0	13.53233	0	0	7.820552	0	13.43336	0	0	12.25192	14.6502	13.93266	9.137719	11.3005	10.38028	0	0	12.68893	14.1719	13.57055	9.725065	0	14.59461	13.97849	15.11299	15.21926	13.37698	0	14.30933	0	14.00367	0	0	0	14.93241	14.93827	0	0	0	0	0	0	0	0	13.76635	0	13.67372	0	13.09828	0	0
A0A669EHI8	A0A669EHI8_ORENI	LOC100693747	threonyl-tRNA aminoacylation [GO:0006435]	Threonyl-tRNA synthetase (EC 6.1.1.3)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; ATP binding [GO:0005524]; threonine-tRNA ligase activity [GO:0004829]; threonyl-tRNA aminoacylation [GO:0006435]	ATP binding [GO:0005524]; threonine-tRNA ligase activity [GO:0004829]	VAAVSTK	7.489999771	672.3343489	0	15.69508	16.63808	16.17278	16.46351	16.87816	0	17.13401	16.48926	18.89069	17.19	18.07919	16.1492	17.11061	17.88052	17.16061	17.79408	15.67368	17.70747	16.34142	17.91167	18.78149	18.14959	16.87898	18.11199	17.24255	17.14736	17.14356	20.42946	17.00279	18.30071	16.77472	19.33654	17.8672	15.85627	15.92213	16.5308	17.79796	15.88255	17.17348	18.66521	17.0911	19.09376	16.9507	16.82913	17.42268	17.36124	16.95783	16.14174	18.20975	17.79354	17.39631	17.67359	15.88875
A0A669CSA5	A0A669CSA5_ORENI		cell adhesion [GO:0007155]; negative regulation of angiogenesis [GO:0016525]	Thrombospondin 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; calcium ion binding [GO:0005509]; heparin binding [GO:0008201]; cell adhesion [GO:0007155]; negative regulation of angiogenesis [GO:0016525]	calcium ion binding [GO:0005509]; heparin binding [GO:0008201]	GTLIGLEGPDGRR	7.550000191	1341.064158	14.09493	0	0	13.3416	12.37308	0	0	0	0	0	0	0	0	0	0	0	0	16.70606	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.91694	0	0	0	0	0	0
I3KMS3	I3KMS3_ORENI			Thromboxane A synthase 1 (platelet)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	"integral component of membrane [GO:0016021]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	EMVPLINTATDALMK	1.950000048	1662.194619	15.45818	13.95852	15.04702	0	14.23643	10.52329	16.36203	15.41513	14.60113	15.73152	0	14.85981	0	0	12.18373	14.43425	0	14.26875	15.5391	13.20918	0	15.11169	15.80296	15.4137	0	14.81435	0	14.58415	12.18721	12.95818	18.86255	17.82286	19.06644	16.03884	14.87145	10.94601	14.86177	12.5144	8.673162	14.3888	0	0	12.67249	0	12.41071	0	15.32213	9.551762	14.46179	13.80728	0	13.116	15.55628	12.75872
I3IX63	I3IX63_ORENI	LOC100706178	antigen processing and presentation [GO:0019882]; immune response [GO:0006955]; intracellular protein transport [GO:0006886]	Thyroglobulin type-1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; macrophage migration inhibitory factor binding [GO:0035718]; MHC class II protein binding [GO:0042289]; antigen processing and presentation [GO:0019882]; immune response [GO:0006955]; intracellular protein transport [GO:0006886]	macrophage migration inhibitory factor binding [GO:0035718]; MHC class II protein binding [GO:0042289]	MLSLPSEDN	4.699999809	1004.935491	0	12.24345	14.2214	10.84317	13.02315	13.49766	13.87521	14.71297	12.5383	9.184507	12.93797	0	15.39367	12.85247	0	10.93454	11.22071	11.63768	14.47103	13.64578	13.54647	15.15552	13.67811	13.37556	14.14264	14.03957	14.58005	18.05759	13.34411	15.89129	14.95744	14.56246	13.80242	0	12.92361	0	12.6965	0	13.88122	0	10.75329	14.19059	14.06063	0	13.50473	0	0	8.513373	0	0	0	0	13.34135	0
A0A669BVL1	A0A669BVL1_ORENI			Thyroid hormone receptor interactor 11	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ARSMDASALQTEHER	5.590000153	1698.76586	0	14.87952	15.29416	13.8351	0	0	0	0	0	15.78041	0	0	0	0	15.66557	12.12079	13.95499	16.33909	13.51049	14.50654	15.49649	17.32348	13.19849	13.91777	14.58865	0	14.33857	16.68618	0	15.78473	16.34775	0	13.9509	15.32749	0	15.59943	14.24428	15.43653	0	0	15.13265	14.75312	15.10114	0	15.8825	0	14.86744	0	0	0	15.82229	14.71066	0	0
A0A669CPH1	A0A669CPH1_ORENI	gth-rii TSHR		Thyrotropin receptor	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	basolateral plasma membrane [GO:0016323]; integral component of membrane [GO:0016021]	basolateral plasma membrane [GO:0016323]; integral component of membrane [GO:0016021]; thyroid-stimulating hormone receptor activity [GO:0004996]	thyroid-stimulating hormone receptor activity [GO:0004996]	SLPPNGLR	7.590000153	853.8856193	15.71278	0	0	15.28104	11.76508	0	0	16.17846	0	0	0	16.21406	17.56237	17.28122	15.64317	15.01199	0	0	0	15.57469	13.30471	13.41853	0	14.35717	15.81296	14.65979	13.36558	0	0	0	16.99554	0	0	15.73935	14.88203	0	16.75306	14.19831	0	14.06122	0	13.56332	0	0	0	16.48551	0	0	15.13263	0	0	0	17.76459	0
A0A669BP37	A0A669BP37_ORENI	TLR5	defense response to bacterium [GO:0042742]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; MyD88-dependent toll-like receptor signaling pathway [GO:0002755]; positive regulation of cytokine production [GO:0001819]; toll-like receptor 5 signaling pathway [GO:0034146]	Toll like receptor 5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; transmembrane signaling receptor activity [GO:0004888]; defense response to bacterium [GO:0042742]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; MyD88-dependent toll-like receptor signaling pathway [GO:0002755]; positive regulation of cytokine production [GO:0001819]; toll-like receptor 5 signaling pathway [GO:0034146]	transmembrane signaling receptor activity [GO:0004888]	LMPLVDEMR	11.42000008	1135.33682	14.34262	12.85708	12.29474	0	13.03767	10.01709	13.77172	12.99634	0	12.87206	0	15.40173	0	12.54039	14.03293	12.29125	13.68764	14.31281	14.08732	0	14.32015	13.91787	11.7994	14.96371	12.69971	14.19611	0	13.10438	15.24146	0	0	10.99523	0	14.5819	0	12.17838	15.28428	11.39912	0	14.25917	17.80233	0	0	0	0	0	0	12.28173	13.85968	15.21793	14.04029	0	18.29279	12.78932
A0A669EPM3	A0A669EPM3_ORENI	TLR8	inflammatory response [GO:0006954]; innate immune response [GO:0045087]; toll-like receptor signaling pathway [GO:0002224]	Toll like receptor 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; transmembrane signaling receptor activity [GO:0004888]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; toll-like receptor signaling pathway [GO:0002224]	transmembrane signaling receptor activity [GO:0004888]	SVAINENTFALLKK	5.639999866	1548.104541	0	16.05535	17.58675	15.99076	0	0	17.27057	0	0	14.34454	16.58498	16.29012	0	16.12852	17.04037	0	0	0	0	0	0	0	0	14.92997	10.19842	0	0	0	16.60334	16.66229	0	0	0	15.09077	12.80107	0	16.74479	17.22563	0	0	0	16.7121	0	15.93111	13.8372	17.6948	14.22665	13.03312	16.57448	14.67024	0	0	17.00028	0
A0A669DJ26	A0A669DJ26_ORENI			"Topoisomerase I binding, arginine/serine-rich a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	EGGAVASVR	14.46000004	844.3877029	16.27897	0	0	16.35019	17.03345	17.13703	16.89103	0	17.06362	17.30355	0	17.43231	0	0	0	0	0	12.35354	0	15.57431	0	0	8.543553	14.69518	0	0	0	13.27214	14.25947	0	15.41503	0	0	16.03516	0	0	0	0	0	13.03003	11.12802	14.24456	0	0	13.27531	0	13.98618	12.81663	0	0	0	14.2649	0	0
I3KID9	I3KID9_ORENI	LOC100693568	chaperone cofactor-dependent protein refolding [GO:0051085]; endoplasmic reticulum organization [GO:0007029]	Torsin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum lumen [GO:0005788]	endoplasmic reticulum lumen [GO:0005788]; ATP binding [GO:0005524]; chaperone cofactor-dependent protein refolding [GO:0051085]; endoplasmic reticulum organization [GO:0007029]	ATP binding [GO:0005524]	GRQPDENVADR	13.23999977	1256.720702	15.48087	9.701114	12.39921	11.89155	0	16.77094	11.26819	3.614077	16.62402	14.76421	17.18162	0	12.4077	10.98611	10.61001	18.81253	17.21051	13.51423	13.98951	0	0	0	0	0	14.52337	10.74442	0	0	7.282521	14.83995	0	0	0	9.16971	0	9.605615	0	15.33827	13.24922	0	0	0	0	11.53806	0	0	0	0	0	0	0	0	14.4475	0
I3KC69	I3KC69_ORENI			Tpd52 like 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				KLGLNPLNELR	13.05000019	1265.04651	16.28464	0	13.90359	16.64897	13.49404	14.28326	17.19183	17.06404	15.87145	12.96262	17.99966	0	16.66948	16.98913	13.90514	16.87359	14.90635	0	0	0	0	0	0	16.11368	0	0	0	0	0	17.34744	0	0	17.83875	0	0	0	0	0	0	0	0	17.00356	0	0	0	0	18.23742	0	0	0	0	0	0	0
A0A669BB58	A0A669BB58_ORENI	GTPBP2		Tr-type G domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]	GIGLVTK	10.89000034	684.289843	16.58563	15.29429	15.34984	15.9359	0	14.90544	16.79917	15.31986	17.96389	13.56388	0	15.69255	0	0	16.40821	16.91254	18.38534	0	0	16.43467	0	0	0	16.71616	0	18.13832	16.31676	0	0	0	0	16.09826	16.22071	0	0	0	0	0	0	0	0	17.37625	16.33862	0	0	16.43534	17.2238	15.73627	0	17.02101	15.65953	0	0	0
A0A669B4Y6	A0A669B4Y6_ORENI			Trafficking protein particle complex subunit 11	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi apparatus [GO:0005794]	Golgi apparatus [GO:0005794]		IEMTGIEVMLGGDSGR	1.730000019	1681.833733	16.84935	15.11376	14.14361	15.34179	14.29667	0	14.43358	0	0	0	0	0	0	0	0	15.12014	0	15.47025	0	0	0	0	16.4658	14.88902	14.28205	0	15.02841	17.43929	0	15.5132	0	15.72137	0	15.29737	14.3336	15.25942	16.5282	14.61344	0	0	16.27023	16.85826	0	0	16.9382	0	16.26927	16.10118	0	0	15.59059	0	0	0
A0A669CZ45	A0A669CZ45_ORENI	ENY2	histone deubiquitination [GO:0016578]; mRNA export from nucleus [GO:0006406]; transcription elongation from RNA polymerase II promoter [GO:0006368]	Transcription and mRNA export factor ENY2 (Enhancer of yellow 2 transcription factor homolog)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	DUBm complex [GO:0071819]; nuclear pore [GO:0005643]; SAGA complex [GO:0000124]; transcription export complex 2 [GO:0070390]	DUBm complex [GO:0071819]; nuclear pore [GO:0005643]; SAGA complex [GO:0000124]; transcription export complex 2 [GO:0070390]; transcription coactivator activity [GO:0003713]; histone deubiquitination [GO:0016578]; mRNA export from nucleus [GO:0006406]; transcription elongation from RNA polymerase II promoter [GO:0006368]	transcription coactivator activity [GO:0003713]	AHCKDVIR	1.299999952	997.7213027	13.31645	12.93021	6.018472	15.62625	14.53931	14.41175	13.80205	0	6.69504	15.16839	12.04531	13.01128	14.01617	0	0	14.67642	0	14.1633	0	14.85299	14.07808	0	13.02056	14.06335	13.49762	14.33797	12.85186	0	11.4885	0	14.25125	0	16.04292	15.72133	17.45669	0	14.0633	11.6292	13.52898	0	15.47058	0	14.94498	13.82284	15.32469	0	0	13.28228	0	13.88129	13.95549	0	0	0
A0A669CL15	A0A669CL15_ORENI	ELOF1		Transcription elongation factor 1 homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	SCDVKMER	2.059999943	1037.172349	12.76093	13.18294	14.55431	0	0	14.00374	0	0	0	0	0	15.04538	0	0	14.39362	14.33861	0	13.84264	0	14.28169	0	0	0	0	0	15.30815	14.49341	13.0447	0	13.13418	0	0	14.78469	0	0	0	0	0	0	12.82372	14.85876	0	14.36001	14.25751	0	12.77215	0	11.73913	16.05978	11.55119	0	8.823893	0	13.31019
A0A669D848	A0A669D848_ORENI	tefm	transcription elongation from mitochondrial promoter [GO:0006392]	"Transcription elongation factor, mitochondrial"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial nucleoid [GO:0042645]	mitochondrial nucleoid [GO:0042645]; transcription elongation from mitochondrial promoter [GO:0006392]		YRNSFQMGSR	8.300000191	1261.01095	7.791491	0	12.99275	0	13.36541	11.26312	0	0	12.39194	0	14.34996	13.0719	11.52038	9.697155	0	13.12539	10.91088	13.34977	5.509299	18.16909	10.88825	18.06304	13.64892	10.44748	0	0	11.35719	13.80564	12.42747	15.49295	16.96976	17.44966	17.73952	14.74436	0	0	11.98446	0	11.77397	8.216056	0	14.43706	0	0	0	11.24424	12.44189	0	0	0	11.39099	0	13.93565	14.46293
A0A669DBL8	A0A669DBL8_ORENI			Transcription factor 25 (basic helix-loop-helix)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SLLPNFNIQGRCLF	12.56999969	1679.037625	0	0	11.60933	0	11.82213	0	12.42769	0	13.71663	13.01128	15.50678	13.09689	0	0	13.88642	12.9557	0	0	0	11.88247	13.86258	11.84233	14.1501	15.15532	10.31944	0	13.35321	14.22748	13.17076	13.96548	0	0	0	0	14.08533	0	12.78201	0	14.34369	13.36331	0	0	16.84631	12.55452	0	13.48762	0	14.13419	15.23138	12.00776	0	12.4285	0	0
A0A669BJL6	A0A669BJL6_ORENI	tfec	"regulation of transcription, DNA-templated [GO:0006355]"	Transcription factor EC	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	"nucleus [GO:0005634]; protein dimerization activity [GO:0046983]; regulation of transcription, DNA-templated [GO:0006355]"	protein dimerization activity [GO:0046983]	AHGLPNMATALGTVEISSHLLK	11.18000031	2261.239563	16.3275	0	0	16.54522	0	16.0509	0	14.33639	14.88343	15.37475	15.0808	15.4332	0	14.15246	15.14683	16.29772	0	15.9253	16.84335	15.36491	13.98309	0	16.9309	17.35104	18.48678	18.1115	15.96531	15.11325	15.09529	14.62559	16.17817	14.94413	13.2199	13.88285	0	0	15.00074	15.35435	13.98431	0	0	0	16.89838	0	18.51731	16.12467	16.02578	15.91812	14.61619	15.35805	15.72094	15.91095	0	14.86807
Q307E2	Q307E2_ORENI	sox10		Transcription factor sox10 (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TEPQSAKAGDGK	6.559999943	1185.388389	11.99087	13.22468	7.530847	0	13.2528	10.41691	12.7169	0	16.2002	12.94916	12.19908	12.86058	12.17571	0	14.09149	14.0065	10.04269	12.56194	0	10.4433	0	0	0	13.88971	0	0	16.56293	13.36872	11.90844	0	12.51731	0	9.140895	0	0	17.65614	12.75535	17.03462	13.20006	0	13.04821	6.76821	0	13.24846	0	10.84538	9.745906	0	12.76244	13.42628	13.4941	12.42533	15.17291	13.7086
A0A669BK04	A0A669BK04_ORENI		positive regulation of transcription elongation from RNA polymerase II promoter [GO:0032968]; transcription initiation from RNA polymerase II promoter [GO:0006367]	Transcription initiation factor IIF subunit alpha	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; positive regulation of transcription elongation from RNA polymerase II promoter [GO:0032968]; transcription initiation from RNA polymerase II promoter [GO:0006367]	DNA binding [GO:0003677]	FGIVTR	3.049999952	692.6597303	0	0	0	0	11.83503	12.186	13.54953	0	0	15.29028	0	0	0	0	0	0	0	15.22681	9.800358	0	11.55879	0	0	0	0	14.97183	12.72489	0	12.00975	12.76092	16.59095	17.06725	0	0	0	0	0	0	0	12.5365	0	0	0	0	0	14.70181	0	0	0	0	0	0	0	0
I3J985	I3J985_ORENI	taf1	"cell cycle [GO:0007049]; DNA-templated transcription, initiation [GO:0006352]"	Transcription initiation factor TFIID subunit	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; transcription factor TFIID complex [GO:0005669]	"integral component of membrane [GO:0016021]; transcription factor TFIID complex [GO:0005669]; DNA binding [GO:0003677]; protein serine/threonine kinase activity [GO:0004674]; cell cycle [GO:0007049]; DNA-templated transcription, initiation [GO:0006352]"	DNA binding [GO:0003677]; protein serine/threonine kinase activity [GO:0004674]	QQLPPK	4.860000134	710.809092	0	15.29977	0	0	0	16.3267	0	16.66545	0	14.38415	16.31321	17.14349	17.26901	15.58038	16.36751	15.22448	0	16.98129	17.03515	17.20553	16.66153	0	17.04951	14.73198	16.41425	14.90097	0	16.62803	16.55748	17.73982	16.82116	18.22194	17.08625	15.12218	0	15.89965	0	17.76313	16.27596	16.70877	15.97431	15.51263	17.29144	0	0	0	0	0	0	0	0	0	0	0
I3K9M0	I3K9M0_ORENI			Transgelin 3b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VLSSDVDVILR	9.789999962	1216.269252	10.67345	10.87305	13.16674	13.40301	13.16486	0	12.89703	14.32349	0	13.27647	8.423972	13.46134	0	0	13.71922	14.03744	14.62406	11.09042	0	14.53279	13.75378	12.52995	14.13307	11.7421	13.60483	0	0	0	12.95043	11.46142	16.57997	0	0	18.42948	0	12.47203	13.75313	9.511874	12.04376	11.47396	13.3673	13.11826	10.91755	6.719004	0	11.23021	0	11.29137	0	13.90077	12.0186	13.74937	10.59702	12.15744
A0A669EZ23	A0A669EZ23_ORENI			Transgelin	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TIKSSGMAFK	4.559999943	1065.893065	15.16947	0	0	0	12.75101	0	13.7586	15.62922	15.08043	12.28273	14.55221	12.99478	14.12186	10.62694	12.65459	13.14831	13.74114	14.63664	13.23152	13.61433	13.97511	14.75211	0	15.49802	13.55064	17.74902	0	13.30567	14.30932	0	0	0	11.04812	14.1544	0	16.70756	0	13.95516	13.66782	14.93619	14.16902	15.14566	0	14.94512	13.42453	0	0	0	14.93548	11.16527	0	13.35064	15.715	0
A0A669CFB2	A0A669CFB2_ORENI		peptide cross-linking [GO:0018149]	Transglutaminase 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein-glutamine gamma-glutamyltransferase activity [GO:0003810]; peptide cross-linking [GO:0018149]	protein-glutamine gamma-glutamyltransferase activity [GO:0003810]	WMISPDGSKK	8.090000153	1164.165647	10.66404	12.85271	11.27626	13.09715	11.2717	0	12.52933	12.53597	13.08353	14.10559	13.87743	13.04566	13.27601	0	13.63527	12.66366	0	0	0	12.62768	12.03176	18.54865	12.30478	11.75459	17.34344	9.776917	11.08195	9.851791	0	12.83548	13.77772	13.42238	0	11.87129	17.82445	0	0	12.58233	0	0	0	12.54074	11.82037	0	0	14.51202	0	0	10.68216	17.94761	13.95895	0	0	13.9215
A0A669DKV9	A0A669DKV9_ORENI			Transient receptor potential cation channel subfamily C member 2b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium channel activity [GO:0005262]	calcium channel activity [GO:0005262]	DIGNRMTELNK	2.910000086	1307.562648	12.51591	0	0	14.34775	0	0	0	7.757264	0	0	0	10.5237	8.911889	10.94241	11.01047	13.93129	8.777925	13.75028	0	14.30363	0	0	0	0	0	0	14.54357	10.71958	13.08102	0	0	0	0	0	0	0	0	0	0	0	0	0	15.87888	0	0	0	11.53708	13.22	0	0	0	0	0	0
I3JDR1	I3JDR1_ORENI			"Transient receptor potential cation channel, subfamily C, member 4b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium channel activity [GO:0005262]	calcium channel activity [GO:0005262]	SVYYLIGWIK	5.150000095	1240.885363	12.24742	0	0	0	0	14.6466	0	11.96311	0	11.10283	12.50149	8.208638	13.35222	12.48434	0	14.98742	0	14.06281	11.10484	0	13.31297	14.03683	12.89805	0	16.88577	12.33121	0	0	0	0	0	18.43839	0	0	0	14.10255	9.682416	14.2879	0	0	13.42927	0	12.34847	0	0	13.34422	13.23181	14.04105	0	0	0	0	0	0
I3JGF2	I3JGF2_ORENI			"Transient receptor potential cation channel, subfamily C, member 5a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; calcium channel activity [GO:0005262]	calcium channel activity [GO:0005262]	DDGAMASEDDSESGEGTGGGLGVQRSK	8.829999924	2627.950319	0	0	0	11.88969	0	0	9.93317	0	0	0	12.64174	15.4736	13.21162	11.45183	0	12.61658	0	15.66381	13.20132	12.17666	13.78211	14.86134	0	12.6551	0	13.91737	0	0	9.072524	0	0	0	0	11.94315	0	0	16.02053	13.55513	10.4822	0	13.8315	0	0	0	13.67078	11.9337	0	12.01338	0	0	0	13.87947	13.73672	0
A0A669F8Y8	A0A669F8Y8_ORENI		cellular response to light stimulus [GO:0071482]; G protein-coupled glutamate receptor signaling pathway [GO:0007216]; protein tetramerization [GO:0051262]	"Transient receptor potential cation channel, subfamily M, member 1a"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; cation channel activity [GO:0005261]; cellular response to light stimulus [GO:0071482]; G protein-coupled glutamate receptor signaling pathway [GO:0007216]; protein tetramerization [GO:0051262]	cation channel activity [GO:0005261]	YCEEDGSSHR	12.10000038	1239.009172	13.64589	11.84143	10.03334	12.14462	12.23945	9.875101	13.53083	0	0	0	0	0	13.26464	13.5898	8.777185	11.92359	14.35781	13.39483	11.92634	12.69183	0	0	0	14.66875	11.93486	0	0	7.52904	15.22511	0	0	15.16589	14.18031	13.2856	0	17.19952	11.89929	12.37825	13.71117	13.10041	9.653479	14.41835	0	9.088498	0	12.99741	0	11.2194	13.19286	0	0	0	0	0
A0A669D105	A0A669D105_ORENI	LOC100702196	autophagy [GO:0006914]; cell cycle [GO:0007049]	Transitional endoplasmic reticulum ATPase (EC 3.6.4.6) (Valosin-containing protein)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATPase activity [GO:0016887]; lipid binding [GO:0008289]; autophagy [GO:0006914]; cell cycle [GO:0007049]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]; lipid binding [GO:0008289]	EAIEAEIKAER	9.779999733	1259.628771	14.52304	0	15.48532	11.68898	0	17.21248	0	0	0	11.57225	0	0	10.44839	13.24081	0	12.60441	14.26339	0	14.13514	14.09772	13.34005	17.00721	11.9439	13.43037	13.86623	0	0	12.85964	0	16.193	16.89702	0	0	0	13.22888	16.28012	0	0	14.2354	11.71507	11.93766	0	13.58737	0	0	13.56226	13.67462	0	14.26692	16.90828	0	0	0	13.67903
A0A669BL91	A0A669BL91_ORENI	TKT		Transketolase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; transferase activity [GO:0016740]	metal ion binding [GO:0046872]; transferase activity [GO:0016740]	SSVSVMEDYHKPDQQTVQALRNIATR	3.579999924	2990.219373	0	0	0	15.16122	0	0	14.62065	0	0	0	14.17152	13.48692	14.27986	0	17.06051	0	15.95692	0	18.24263	0	12.17447	15.29733	17.18901	0	13.07586	0	0	0	0	0	9.082527	0	12.92274	0	0	15.81302	0	9.477331	0	19.52828	20.086	14.7449	10.81081	14.57858	0	13.40367	14.21144	0	0	0	0	0	0	0
A0A669CA60	A0A669CA60_ORENI			Transketolase a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; transferase activity [GO:0016740]	metal ion binding [GO:0046872]; transferase activity [GO:0016740]	AYGMALAK	6.380000114	824.0124541	0	14.48564	13.57171	12.83677	14.09321	11.71993	13.49238	14.98236	15.20817	13.484	14.35707	14.87286	0	15.68499	13.10626	15.90357	15.39093	13.63253	14.17509	14.70371	13.11657	15.09646	14.71493	13.70578	13.61001	13.88542	12.02005	11.42969	12.85373	14.41115	17.66694	17.57719	16.19824	15.39584	13.72093	14.52397	0	12.95496	12.15277	14.72791	18.29041	12.8595	14.80428	17.17282	11.30777	14.26902	14.32443	14.75131	14.90125	12.95274	15.51956	14.90916	15.47766	12.85778
A0A669DLX9	A0A669DLX9_ORENI			Transketolase b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; transferase activity [GO:0016740]	metal ion binding [GO:0046872]; transferase activity [GO:0016740]	VVALDGDTKNSTFSETFK	7.389999866	1960.02359	0	0	0	13.71445	13.73337	12.19744	16.15565	9.846986	11.32317	13.76803	12.36628	12.18422	15.12165	5.485837	13.28308	13.50482	12.48765	13.60111	14.78797	13.06556	13.17957	0	0	14.17644	0	10.33256	12.45937	0	13.83035	0	0	11.93934	0	10.62599	15.04861	0	9.889609	0	0	11.49011	11.70731	15.98934	16.69788	12.7833	13.13145	11.00092	14.00114	0	13.18804	13.74429	13.01906	14.44302	13.401	14.58386
I3KFH1	I3KFH1_ORENI	GUF1 guf1	positive regulation of translation [GO:0045727]; translation [GO:0006412]	"Translation factor GUF1, mitochondrial (EC 3.6.5.n1) (Elongation factor 4 homolog) (EF-4) (GTPase GUF1) (Ribosomal back-translocase)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial inner membrane [GO:0005743]; mitochondrial matrix [GO:0005759]	mitochondrial inner membrane [GO:0005743]; mitochondrial matrix [GO:0005759]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; ribosome binding [GO:0043022]; positive regulation of translation [GO:0045727]; translation [GO:0006412]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]; ribosome binding [GO:0043022]	MSFSMVKR	2.50999999	1001.064466	8.967728	13.69727	12.55637	14.88506	14.52598	0	0	15.75745	13.51728	14.06662	0	13.2066	0	15.11386	0	0	14.31765	14.4278	15.43255	12.72046	0	10.883	0	0	13.42812	12.68495	14.86912	16.82885	0	13.75547	14.83659	16.51711	16.37518	14.02144	10.71095	14.99782	13.3683	14.98694	13.43965	14.71664	17.72731	12.98337	15.69443	17.02618	16.10258	0	14.01179	15.23133	14.21986	15.08733	0	15.7725	0	14.13259
I3JV04	I3JV04_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	Translocase of outer mitochondrial membrane 20	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"DNA binding [GO:0003677]; regulation of transcription, DNA-templated [GO:0006355]"	DNA binding [GO:0003677]	KMQDNLER	5.929999828	1032.728626	0	15.60009	0	16.06784	15.60278	15.64358	0	16.46144	0	0	16.94233	16.60992	12.62448	0	0	0	18.00199	15.1938	15.87935	0	14.14598	13.85547	18.00695	0	16.09925	15.92319	16.63672	16.09383	0	16.54031	0	0	15.0551	0	0	15.48999	0	0	14.97728	0	0	0	16.64681	0	0	0	17.68911	16.10356	0	0	0	16.48524	16.8922	17.04592
I3JBH5	I3JBH5_ORENI	TOMM40L	protein import into mitochondrial matrix [GO:0030150]	Translocase of outer mitochondrial membrane 40 like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial outer membrane [GO:0005741]	mitochondrial outer membrane [GO:0005741]; protein transmembrane transporter activity [GO:0008320]; protein import into mitochondrial matrix [GO:0030150]	protein transmembrane transporter activity [GO:0008320]	TQETTTSFGYQMELPEANMVFRGMINSR	6.510000229	3270.47432	13.09659	11.59406	11.69958	13.32189	9.941958	0	0	12.89137	14.03009	11.9379	14.79385	0	14.10201	11.70566	9.30792	12.14955	12.58674	11.48635	0	0	13.80447	0	0	0	0	12.99316	0	12.5717	12.13753	14.49966	0	19.322	8.278472	0	14.11871	10.39858	11.67307	0	0	0	0	13.49293	0	0	0	10.714	12.62451	12.17395	0	0	0	0	13.18654	12.60041
A0A669BPD9	A0A669BPD9_ORENI		protein transport [GO:0015031]	Translocation protein SEC62	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of endoplasmic reticulum membrane [GO:0030176]	integral component of endoplasmic reticulum membrane [GO:0030176]; protein transport [GO:0015031]		STNMMGHR	11.22999954	964.8860247	15.9938	15.46288	16.00724	15.02308	15.05017	15.58883	16.37686	15.13048	16.46974	17.12355	0	0	16.42598	16.24471	16.66555	14.98877	0	14.21171	14.08366	15.06565	14.24215	17.2129	12.35541	0	16.0197	14.91432	12.60996	11.32807	13.71809	0	14.51319	0	15.04542	15.35283	13.0431	14.96119	0	12.00358	14.69188	13.13496	11.11997	13.51284	14.02541	0	14.46063	0	15.46571	15.9092	11.62431	13.23966	12.90645	13.7028	0	14.7089
A0A669BDD5	A0A669BDD5_ORENI	tm9sf1		Transmembrane 9 superfamily member	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		QGDNVTLYVNK	7.659999847	1251.018741	14.15717	0	13.30841	14.14773	13.52652	14.51317	12.40245	14.07936	11.97161	17.71251	13.84956	13.28786	0	0	0	13.3058	11.8943	9.062285	13.883	14.54321	14.16366	12.69351	13.75241	14.14262	10.73809	13.11563	14.11529	11.41296	0	12.66146	14.34383	0	0	0	0	14.58694	13.96101	0	0	14.10454	13.71969	13.56935	12.65028	14.33852	0	0	0	0	12.8563	18.55518	13.5318	0	0	0
A0A669CQM3	A0A669CQM3_ORENI	TMCC3		Transmembrane and coiled-coil domain family 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		HPTMDKIK	4.869999886	985.4276935	11.5855	13.91353	15.38582	14.14612	0	11.27704	0	13.56199	12.59297	0	12.64018	11.36549	13.02369	10.58725	14.95464	13.87742	0	12.89657	0	10.83606	12.37777	11.80649	0	0	0	15.00174	12.358	13.738	11.63602	0	0	0	14.29473	13.20732	13.28315	0	13.29199	13.65972	13.05405	14.84266	0	7.425388	13.01157	13.54886	0	13.67884	14.40186	13.91567	0	0	12.90028	11.83255	7.907334	0
A0A669DPP1	A0A669DPP1_ORENI	TMC1		Transmembrane channel-like protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of plasma membrane [GO:0005887]	integral component of plasma membrane [GO:0005887]		EAVDERK	15.89000034	846.3177884	17.44594	17.84957	13.9639	17.94857	18.18333	18.47839	15.55107	18.77725	17.83148	18.47054	0	18.76402	18.89614	16.38823	18.35453	0	0	15.04422	0	14.24219	15.16392	14.76205	0	0	0	15.16418	15.18544	0	18.9191	0	19.23005	18.5554	17.9545	19.22584	19.22615	18.71903	19.05759	19.30236	18.89185	18.23696	18.71498	18.78935	19.63353	18.81352	19.40216	17.97879	17.82792	18.32107	16.64629	16.64568	14.98564	0	16.81853	16.19172
A0A669DT95	A0A669DT95_ORENI			Transmembrane protein 131	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		KQVTTK	2.920000076	703.6749078	13.77752	13.67616	15.19799	14.52845	15.37597	16.10072	17.05394	14.19543	15.97433	15.22295	0	14.11131	0	15.605	10.64348	0	0	0	0	17.18254	0	0	0	0	0	0	0	0	16.21346	16.83231	0	0	0	0	17.36366	0	0	0	0	0	0	0	0	0	0	0	0	0	16.47834	16.67769	16.01936	0	0	0
I3J9R8	I3J9R8_ORENI	LOC100697675		Transmembrane protein 163	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	early endosome membrane [GO:0031901]; integral component of membrane [GO:0016021]; synaptic vesicle membrane [GO:0030672]	early endosome membrane [GO:0031901]; integral component of membrane [GO:0016021]; synaptic vesicle membrane [GO:0030672]		FMLGRVLTSR	10.65999985	1196.754362	16.05695	0	0	13.71485	0	0	0	0	8.084798	12.17175	9.571426	0	14.20458	0	13.68529	0	0	18.76415	14.49633	0	12.23128	10.52501	14.92957	0	16.62262	10.10997	10.47968	19.20402	19.33834	14.50227	0	0	0	0	0	0	14.13512	0	15.00588	12.23706	0	0	14.14678	12.39139	11.01428	0	0	0	14.32762	0	0	0	0	9.649307
I3J9Q8	I3J9Q8_ORENI	tmem177		Transmembrane protein 177	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		TLRSLMGQK	8.430000305	1033.13111	12.4315	12.60312	9.267275	16.79959	13.51446	13.7036	13.78485	7.654442	12.67492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.47854	0	0	0	0	0	0	0	0	0	0	0	0	0	16.06681	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DUD3	A0A669DUD3_ORENI			Transmembrane protein 184a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		TTGVKPR	4.389999866	755.0459772	15.10578	14.66022	13.87854	13.55015	13.21618	15.19419	14.2548	14.62704	16.01792	15.01777	15.13052	13.63476	10.15811	15.29647	0	10.88422	0	14.20764	14.81726	13.85397	14.43589	13.8814	0	15.01954	15.16581	12.86235	14.27025	11.90192	11.42982	15.51367	0	17.54667	15.95366	15.97653	15.39696	0	14.76785	0	14.32669	0	15.39851	0	0	15.96837	0	15.08976	14.2778	0	0	0	0	15.64878	0	14.69658
A0A669BIV6	A0A669BIV6_ORENI			Transmembrane protein 94	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LGMNSPF	6.730000019	765.4207644	14.42781	0	15.25737	14.18558	0	13.14849	14.84903	0	15.46538	17.45369	15.66649	15.30942	15.63089	0	0	15.0295	15.59227	0	13.86908	14.63933	13.20475	16.41486	15.41885	13.60361	15.22391	14.04921	13.63944	0	14.90531	15.67962	16.62797	21.96453	19.62151	15.56238	13.73952	15.15364	13.93303	14.10942	14.39933	15.16411	11.65008	11.69032	14.48787	14.27395	12.63775	0	10.35926	15.23938	15.7532	13.80908	0	14.89509	15.28474	12.49549
A0A669F8B3	A0A669F8B3_ORENI	tmem98		Transmembrane protein 98	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum membrane [GO:0005789]; extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	endoplasmic reticulum membrane [GO:0005789]; extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]		SMYPPLDPILLDAR	4.349999905	1616.198183	0	15.06384	14.72394	15.87473	0	0	0	13.85694	14.99596	14.58614	15.70156	12.69395	0	13.71708	13.33202	15.52602	13.33776	0	10.83763	0	14.33938	0	12.37182	0	0	0	13.70564	15.02967	0	0	0	0	0	0	0	15.99344	0	14.3244	0	0	0	15.92786	14.7617	0	14.74137	0	15.47256	15.29241	0	15.10666	0	0	0	0
I3KMT7	I3KMT7_ORENI			Transmembrane serine protease 15	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; scavenger receptor activity [GO:0005044]; serine-type endopeptidase activity [GO:0004252]	scavenger receptor activity [GO:0005044]; serine-type endopeptidase activity [GO:0004252]	QVDRIVFNEQYNR	3.339999914	1680.215984	13.43493	0	10.77276	12.46357	14.58798	13.36432	14.49274	0	12.97705	13.82296	0	0	13.6752	14.77443	14.39811	17.10929	0	14.60548	0	0	0	0	0	14.78435	15.708	0	14.00898	14.74846	11.57403	12.64179	16.76	0	0	0	12.8202	0	0	16.32599	0	14.3547	14.273	0	14.00937	0	0	13.47179	0	0	0	0	0	0	0	12.45223
I3KFY0	I3KFY0_ORENI			Transmembrane serine protease 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; scavenger receptor activity [GO:0005044]; serine-type endopeptidase activity [GO:0004252]	scavenger receptor activity [GO:0005044]; serine-type endopeptidase activity [GO:0004252]	EGDRWWLAGATSWGYGCALK	6.849999905	2283.620384	14.07553	11.76486	8.877522	0	11.82843	0	12.17105	15.45436	0	15.37809	15.62416	14.67786	0	15.94682	16.14653	18.8553	14.84178	12.54975	15.27575	15.92412	14.8689	0	14.25249	14.30718	18.75552	15.98744	13.59206	0	14.6541	0	16.05486	15.43526	14.53185	14.13932	18.68333	14.61646	14.86232	0	15.1393	15.59647	17.94705	14.50858	16.85153	16.06265	15.51982	14.09066	13.30875	14.62956	17.51443	13.12169	0	0	12.69901	14.91117
I3KRW5	I3KRW5_ORENI	LOC100691608		Transporter	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of plasma membrane [GO:0005887]	integral component of plasma membrane [GO:0005887]; symporter activity [GO:0015293]	symporter activity [GO:0015293]	GLMLKGSVDGIAHMFTPK	9.739999771	1917.981049	14.69345	14.65152	13.82396	15.99803	14.05139	13.62177	14.58507	11.0746	13.91199	0	0	14.44136	15.28384	15.99145	0	0	16.23116	14.5238	16.07775	15.76154	15.73382	0	0	0	0	15.09557	0	0	0	15.74967	16.80882	0	17.17876	15.48707	15.21747	0	15.28819	14.64344	0	0	15.38249	0	14.48474	0	13.74407	16.94798	14.18586	0	16.92649	15.21641	15.19182	0	0	0
I3JL41	I3JL41_ORENI		intracellular protein transport [GO:0006886]; mRNA processing [GO:0006397]; RNA splicing [GO:0008380]; T cell differentiation [GO:0030217]	Transportin 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; small GTPase binding [GO:0031267]; intracellular protein transport [GO:0006886]; mRNA processing [GO:0006397]; RNA splicing [GO:0008380]; T cell differentiation [GO:0030217]	small GTPase binding [GO:0031267]	QVTSAEECK	7.5	1047.779577	8.435289	0	13.92898	13.84862	12.05136	14.02561	18.03814	17.83691	12.54431	15.31518	14.12364	19.70089	13.07707	13.9496	13.03253	14.71643	13.67016	0	0	13.36315	21.28055	0	15.10541	0	0	0	0	0	0	0	0	14.646	0	14.89985	0	17.19488	0	12.67879	0	15.30963	13.29586	0	13.58099	15.50909	13.79322	15.72575	14.21063	14.47618	14.06882	0	0	0	0	16.07207
I3JEG0	I3JEG0_ORENI	treh	trehalose metabolic process [GO:0005991]	Trehalase (EC 3.2.1.28) (Alpha-trehalose glucohydrolase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"alpha,alpha-trehalase activity [GO:0004555]; trehalose metabolic process [GO:0005991]"	"alpha,alpha-trehalase activity [GO:0004555]"	KEQLWMDLNAGAESGWDFTSR	6.260000229	2456.009697	12.56509	0	0	0	10.76961	17.10626	12.53937	12.08598	11.17682	11.13634	0	0	9.423602	8.234571	0	0	0	0	12.3878	10.83645	0	0	0	0	0	0	0	0	12.96943	0	0	0	0	0	0	0	0	0	0	0	10.24164	0	0	0	0	0	0	0	17.71449	15.03926	0	13.67297	0	0
I3KEU5	I3KEU5_ORENI	ticrr	DNA replication [GO:0006260]; mitotic DNA replication checkpoint [GO:0033314]; response to ionizing radiation [GO:0010212]	Treslin_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA replication [GO:0006260]; mitotic DNA replication checkpoint [GO:0033314]; response to ionizing radiation [GO:0010212]		ALIEGCTSSDLHLIHSPISR	8.720000267	2207.1226	12.97886	0	0	0	0	0	0	13.13861	13.20281	10.26846	0	14.85027	11.8496	0	9.454201	0	0	12.93546	11.12703	16.99648	13.71307	11.72133	0	11.51017	15.97216	0	12.96057	11.61438	14.5963	0	14.36439	11.63089	0	12.39571	14.18064	11.67442	9.308785	8.048146	9.088025	10.98864	0	0	15.56708	13.16778	17.2513	14.29146	5.959996	12.13696	13.11264	14.37906	14.91496	12.63857	15.48408	14.15689
I3K745	I3K745_ORENI	tchp		Trichoplein keratin filament-binding protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]		AVADAAWMKR	7.239999771	1133.428335	14.49819	0	11.91374	12.96563	0	13.14622	14.01727	14.4877	11.09001	12.44728	12.21817	13.79317	11.0464	13.69515	18.11591	13.10533	0	13.41943	12.38558	14.59756	12.94374	15.05057	12.23969	11.52229	15.31676	14.08479	14.94223	13.94721	0	0	14.61472	14.51792	0	13.64428	0	13.9312	0	14.62189	13.18002	0	14.5587	11.67839	0	11.71685	0	11.65724	11.36325	12.17831	14.42089	13.20925	14.98094	13.12062	14.73417	14.09468
A0A669ENP2	A0A669ENP2_ORENI	gart	'de novo' IMP biosynthetic process [GO:0006189]; purine nucleobase biosynthetic process [GO:0009113]	Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (Glycinamide ribonucleotide synthetase) (GARS) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART)]	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; metal ion binding [GO:0046872]; phosphoribosylamine-glycine ligase activity [GO:0004637]; phosphoribosylformylglycinamidine cyclo-ligase activity [GO:0004641]; phosphoribosylglycinamide formyltransferase activity [GO:0004644]; 'de novo' IMP biosynthetic process [GO:0006189]; purine nucleobase biosynthetic process [GO:0009113]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; phosphoribosylamine-glycine ligase activity [GO:0004637]; phosphoribosylformylglycinamidine cyclo-ligase activity [GO:0004641]; phosphoribosylglycinamide formyltransferase activity [GO:0004644]	EGGLSEEEMAR	1.710000038	1208.789055	15.4379	14.03356	0	0	16.06603	13.04435	0	16.71691	17.23955	17.29446	15.53371	17.53655	17.04011	16.94919	14.76888	16.17887	15.49114	15.97141	0	15.58894	12.22299	0	0	0	16.56039	0	0	0	17.89337	16.32897	0	0	0	14.39857	15.01371	0	0	13.80857	15.66974	0	14.60346	17.76423	18.12783	17.04141	16.25335	0	0	0	14.85984	14.97186	15.88015	0	0	0
A0A669D9R4	A0A669D9R4_ORENI		miRNA mediated inhibition of translation [GO:0035278]	Trinucleotide repeat containing adaptor 6B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		nucleic acid binding [GO:0003676]; miRNA mediated inhibition of translation [GO:0035278]	nucleic acid binding [GO:0003676]	GGSSSSGGNSR	14.5	952.8131557	0	0	15.33924	0	14.19826	11.88414	15.29143	14.9027	10.38648	12.95372	15.2606	0	0	0	14.39005	12.70228	0	0	13.74952	0	15.12673	0	0	0	13.96449	12.71451	14.20458	0	0	0	0	14.92045	0	0	15.43471	9.592654	0	0	0	0	13.91603	13.70339	12.17019	15.28248	0	13.08518	0	13.5945	11.83368	16.29534	15.2593	15.37523	15.30798	0
A0A669FC11	A0A669FC11_ORENI	tpi	gluconeogenesis [GO:0006094]; glycolytic process [GO:0006096]	Triosephosphate isomerase (EC 5.3.1.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		methylglyoxal synthase activity [GO:0008929]; triose-phosphate isomerase activity [GO:0004807]; gluconeogenesis [GO:0006094]; glycolytic process [GO:0006096]	methylglyoxal synthase activity [GO:0008929]; triose-phosphate isomerase activity [GO:0004807]	VVLAYEPVWAIGTGK	4.460000038	1602.459161	0	0	15.64242	15.11548	14.45767	11.22958	14.09649	15.2074	0	16.43987	15.18012	13.62243	14.22416	16.05479	15.63664	15.82062	13.97748	0	11.31113	0	0	14.16942	15.07658	17.69471	13.03015	0	0	14.72911	16.29683	0	15.78012	13.28845	16.54079	16.19452	15.07901	0	14.93799	11.9792	0	0	0	0	0	0	0	0	17.11858	13.93372	19.08864	17.24302	17.74578	16.51165	0	0
A0A669C4V1	A0A669C4V1_ORENI			Tripartite motif containing 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	ENPIEDDLIFR	22.75	1360.049572	0	0	17.44737	0	17.71705	17.60572	16.84467	17.53924	17.76936	0	17.05501	16.46261	18.47592	18.10062	0	0	19.30069	18.10172	17.49115	17.60284	0	0	0	17.24423	0	0	0	17.71065	17.13378	17.31012	16.15402	17.34416	17.81274	0	0	0	17.8623	0	17.2208	17.14728	17.79879	17.50913	17.12524	0	16.60222	0	17.09719	0	16.9673	0	17.44079	0	0	0
A0A669BGV8	A0A669BGV8_ORENI		protein ubiquitination [GO:0016567]	Tripartite motif containing 37	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		zinc ion binding [GO:0008270]; protein ubiquitination [GO:0016567]	zinc ion binding [GO:0008270]	DQQHAKL	3.809999943	839.6816296	0	0	15.3141	18.85181	12.72322	13.74659	13.51296	0	13.9189	17.41799	15.85042	18.3028	15.83966	17.47296	15.53456	0	0	0	15.43603	0	15.50032	17.09713	17.6926	14.10972	0	13.56929	0	15.30678	0	17.50358	0	16.33389	0	15.57751	14.31838	10.87615	12.5029	0	0	16.57012	0	14.44381	0	13.69874	16.89378	13.29517	15.54587	0	16.99652	15.04311	0	0	0	0
A0A669B3H1	A0A669B3H1_ORENI			Tripartite motif containing 3b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	LGPNINK	4.5	753.5315678	14.61432	15.00391	15.47084	15.75848	14.03372	15.67582	16.92454	16.9181	14.82357	16.39523	17.46836	16.38277	17.51236	15.66844	16.75611	16.83903	17.92768	16.68632	17.23677	15.11713	15.9202	16.33121	15.56625	13.99679	18.81455	16.40262	16.1353	15.96926	0	0	16.81582	0	0	0	0	18.15515	16.07512	16.04246	0	17.3922	0	16.75235	0	0	0	17.04674	16.35487	0	18.06207	0	0	16.92163	18.38878	0
I3KSL9	I3KSL9_ORENI			Tripartite motif containing 63a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	CLVEESVELHR	9.229999542	1369.134235	15.99301	15.11837	14.35754	10.16563	14.01009	14.29706	0	14.44397	0	13.81706	9.884682	0	14.36454	0	0	14.80322	0	0	0	13.93037	12.16627	13.4998	0	0	0	13.76014	0	0	11.14494	12.24752	22.33273	0	13.84744	0	11.37771	0	13.18696	0	0	12.05321	15.11964	0	0	0	12.75088	0	0	0	11.5401	15.07478	13.89863	14.51272	14.87787	11.49786
I3J4Z0	I3J4Z0_ORENI	tpp2		Tripeptidyl-peptidase 2 (EC 3.4.14.10)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		aminopeptidase activity [GO:0004177]; serine-type endopeptidase activity [GO:0004252]; tripeptidyl-peptidase activity [GO:0008240]	aminopeptidase activity [GO:0004177]; serine-type endopeptidase activity [GO:0004252]; tripeptidyl-peptidase activity [GO:0008240]	KETGAASYLTR	10.53999996	1197.647338	7.233037	0	0	11.65501	0	8.945453	7.798413	0	12.72778	0	13.32178	13.67857	13.63893	0	0	0	0	0	0	0	0	11.03868	13.14067	13.17897	15.08116	0	0	0	14.47691	0	14.73522	13.05728	12.79879	12.29666	14.01242	0	14.41794	0	12.31007	0	14.05001	11.89994	0	0	0	11.86585	18.1752	12.2873	11.35397	0	0	0	0	14.77222
A0A669BBH2	A0A669BBH2_ORENI		pointed-end actin filament capping [GO:0051694]	Tropomodulin 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		tropomyosin binding [GO:0005523]; pointed-end actin filament capping [GO:0051694]	tropomyosin binding [GO:0005523]	EHARQEWLIYFSCDMLR	7.329999924	2254.356764	0	0	0	0	0	0	13.16309	14.4241	0	0	15.50571	0	0	0	0	19.01802	0	16.42708	0	0	0	0	0	0	0	0	0	15.91347	0	14.10679	15.30791	15.59547	0	0	0	0	0	0	12.04297	15.39686	0	0	0	0	0	0	0	12.50952	0	14.08586	14.17525	13.57542	0	0
I3KY05	I3KY05_ORENI		regulation of muscle contraction [GO:0006937]; sarcomere organization [GO:0045214]	"Troponin T2c, cardiac"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	troponin complex [GO:0005861]	troponin complex [GO:0005861]; regulation of muscle contraction [GO:0006937]; sarcomere organization [GO:0045214]		YDIHVLRNR	8.75	1185.94002	0	14.5786	0	8.039819	0	13.48842	0	0	14.23854	0	16.17241	16.29506	0	11.21099	0	11.02899	15.65658	10.99448	0	0	0	13.30296	14.92886	0	13.7689	0	16.04764	0	15.31402	0	17.34483	16.63472	17.00213	15.01016	15.70895	15.43195	12.9248	14.33076	13.81922	13.18971	0	14.46172	0	13.35521	0	0	0	0	0	14.29303	14.29562	16.82366	14.39415	14.13583
A0A669BMK7	A0A669BMK7_ORENI	TUBA4A	microtubule-based process [GO:0007017]	Tubulin alpha chain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; structural constituent of cytoskeleton [GO:0005200]; microtubule-based process [GO:0007017]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]; structural constituent of cytoskeleton [GO:0005200]	GHYTIGR	5.170000076	802.7548342	0	14.39118	14.9517	15.26462	15.97155	15.03309	15.47896	14.70102	13.90935	14.72732	0	14.87106	0	15.60942	14.06293	16.66673	17.80571	13.44432	15.72261	15.14003	0	15.58389	16.40225	15.73244	16.75132	0	0	16.35084	0	15.69414	0	0	0	0	0	0	14.99849	15.09079	0	15.6786	15.6682	16.33514	0	0	0	0	15.28389	0	0	0	0	16.65885	17.16218	17.62338
I3K020	I3K020_ORENI	LOC100698256	microtubule-based process [GO:0007017]	Tubulin beta chain	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; microtubule [GO:0005874]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; structural constituent of cytoskeleton [GO:0005200]; microtubule-based process [GO:0007017]	GTPase activity [GO:0003924]; GTP binding [GO:0005525]; structural constituent of cytoskeleton [GO:0005200]	YLTVAGVFRGR	2.269999981	1239.399611	9.467834	0	12.43194	0	16.60095	10.2631	11.12858	12.73294	13.22614	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14.14032	0	0
I3JZ52	I3JZ52_ORENI		cellular protein modification process [GO:0006464]	"Tubulin tyrosine ligase-like family, member 11"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; cellular protein modification process [GO:0006464]	ATP binding [GO:0005524]	NIEEMR	12.56000042	806.2233056	10.69989	18.71177	17.08168	15.2212	16.57394	16.61965	14.7347	0	0	17.53541	18.19391	12.85851	16.68728	15.33472	15.26046	0	0	13.89926	17.23903	15.98366	15.49882	17.25402	16.73826	15.95301	16.53597	13.86616	15.10181	15.68707	0	0	0	0	17.8072	0	16.77937	16.7817	0	0	15.05031	0	12.82591	0	15.75489	15.54563	0	18.74064	18.05845	15.3647	0	17.50393	0	0	0	0
A0A669DNF4	A0A669DNF4_ORENI		cellular protein modification process [GO:0006464]	"Tubulin tyrosine ligase-like family, member 12"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; cellular protein modification process [GO:0006464]	ATP binding [GO:0005524]	FCNFEILLQSK	19.57999992	1397.969425	14.41436	15.90105	13.15972	14.93103	16.51929	13.76002	15.5788	0	14.21962	14.33166	0	13.35765	14.19185	14.88564	13.32698	12.41331	13.30699	15.09675	13.95703	15.44805	12.16381	15.36188	14.50845	0	15.76151	0	15.41215	0	15.04288	0	17.365	17.49971	17.2631	0	0	14.92686	15.98452	15.83059	14.17237	13.91136	13.57774	0	0	15.35932	16.85546	0	0	0	0	0	14.76769	0	0	0
A0A669DUH7	A0A669DUH7_ORENI		cellular protein modification process [GO:0006464]	"Tubulin tyrosine ligase-like family, member 5"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; cellular protein modification process [GO:0006464]	ATP binding [GO:0005524]	IKASMIADMFSLVGECIR	4.050000191	2040.768781	14.17358	12.71148	13.00288	17.18057	0	10.8207	0	15.43985	14.10129	12.98388	12.5983	13.20521	0	14.7031	12.56296	15.45792	13.8351	12.69233	13.57507	0	9.281752	18.62371	14.26443	0	0	0	14.63467	12.53485	0	13.19119	14.2677	0	11.20816	0	0	12.81443	14.2903	0	12.75241	0	0	14.35203	0	0	0	11.57073	0	0	15.36164	0	16.72683	0	0	0
A0A669DCX2	A0A669DCX2_ORENI	tbce		Tubulin-folding cofactor E (Tubulin-specific chaperone E)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoskeleton [GO:0005856]	cytoskeleton [GO:0005856]		GNKLVSGDGNPK	4.329999924	1185.899449	0	0	0	0	0	0	0	13.63789	0	13.44196	0	7.744262	0	13.32241	0	12.76898	12.40711	12.18589	7.372151	10.86061	13.3926	13.43588	12.98184	11.0054	0	0	12.09671	8.656003	16.98007	0	0	7.921864	11.07965	0	12.69386	0	13.99938	13.82663	0	16.94361	11.94144	0	14.72514	10.35239	4.888232	13.7116	0	12.93664	0	14.7072	13.85458	7.723771	7.908967	10.52486
I3JWX0	I3JWX0_ORENI		gene silencing by RNA [GO:0031047]; germ cell development [GO:0007281]; meiotic cell cycle [GO:0051321]; multicellular organism development [GO:0007275]; spermatogenesis [GO:0007283]	Tudor domain containing 12	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; nucleic acid binding [GO:0003676]; gene silencing by RNA [GO:0031047]; germ cell development [GO:0007281]; meiotic cell cycle [GO:0051321]; multicellular organism development [GO:0007275]; spermatogenesis [GO:0007283]	ATP binding [GO:0005524]; nucleic acid binding [GO:0003676]	APDLSPLEAMR	13.22000027	1216.663079	0	14.37625	9.502514	0	15.90956	13.17092	0	0	14.67606	18.37135	15.33925	14.42678	0	17.88028	19.25439	0	14.06462	14.96367	14.72845	16.90876	12.35344	18.46886	14.27253	13.32747	18.91884	11.87439	0	0	0	0	14.22626	19.36773	11.68812	0	0	12.18147	10.06802	0	0	12.13778	11.18395	18.37644	0	13.76375	0	0	14.16772	11.56539	0	0	18.5784	11.96069	0	0
A0A669FBS7	A0A669FBS7_ORENI	kit	Fc receptor signaling pathway [GO:0038093]; Kit signaling pathway [GO:0038109]	Tyrosine-protein kinase Kit (EC 2.7.10.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; ATP binding [GO:0005524]; cytokine binding [GO:0019955]; metal ion binding [GO:0046872]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]; Fc receptor signaling pathway [GO:0038093]; Kit signaling pathway [GO:0038109]	ATP binding [GO:0005524]; cytokine binding [GO:0019955]; metal ion binding [GO:0046872]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	VVEATAYGLSKADSVMTVAVK	2.329999924	2156.094656	12.97437	0	13.73504	12.57476	0	9.303464	12.44243	14.81891	13.66949	0	13.42682	0	13.58023	13.75082	15.56376	15.59645	0	14.53844	0	14.72393	14.48018	0	11.42534	14.52111	16.45554	16.31954	0	0	15.64888	14.33439	12.2597	17.57243	16.10981	0	0	14.76872	14.70788	0	13.75574	0	0	0	14.9987	14.35987	14.75266	14.7874	13.33742	0	0	16.80634	15.97187	16.09557	15.6126	0
A0A669CGS9	A0A669CGS9_ORENI	FYN		Tyrosine-protein kinase (EC 2.7.10.2)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; non-membrane spanning protein tyrosine kinase activity [GO:0004715]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	ATP binding [GO:0005524]; non-membrane spanning protein tyrosine kinase activity [GO:0004715]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	YFTHLFLYHR	9.600000381	1397.641055	14.56225	12.87777	12.39565	15.20348	14.50215	12.12191	10.25785	0	14.23049	0	0	11.42824	13.94536	14.87235	13.37231	0	0	13.78201	11.39613	0	14.00585	0	12.04	12.33501	11.33191	0	10.78008	11.92782	14.22307	0	0	0	18.18075	14.39348	15.31818	14.07868	10.24624	0	0	12.90062	12.28905	14.25435	12.81054	13.16362	12.15017	11.52289	14.02841	0	12.99491	0	15.46026	11.88022	12.08363	14.23347
A0A669CC58	A0A669CC58_ORENI	LOC100690943	transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	Tyrosine-protein kinase receptor (EC 2.7.10.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	ATP binding [GO:0005524]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	AGQTSSLTMRDLLR	6.519999981	1563.874958	15.31223	0	13.80426	15.43901	11.70433	14.95395	16.64607	13.29521	0	0	0	0	0	14.74288	16.86736	0	15.46872	16.07941	0	0	15.36859	16.50669	0	0	0	0	16.22748	0	0	15.75402	13.56351	0	0	0	0	0	0	0	16.69153	17.16816	16.42756	0	0	0	0	0	16.23276	15.22501	17.2696	15.65534	0	16.6953	0	18.70965
I3JL97	I3JL97_ORENI		gene silencing by RNA [GO:0031047]	Tyrosine-protein phosphatase non-receptor type 13 (EC 3.1.3.48)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; protein tyrosine phosphatase activity [GO:0004725]; gene silencing by RNA [GO:0031047]	protein tyrosine phosphatase activity [GO:0004725]	GNSLTSVSDIEK	30.77000046	1249.672039	20.9626	18.77837	21.64838	21.70766	20.1542	0	0	19.52734	19.5429	12.36145	19.93128	20.62891	18.12653	18.58357	16.99372	13.8344	0	0	0	0	0	0	0	0	0	15.1549	0	0	0	20.20523	20.98632	19.60149	20.15192	0	16.87291	19.07427	19.64738	0	16.87239	18.61449	20.18047	0	19.39606	20.93285	18.59653	20.9907	19.62062	19.89156	0	14.65017	0	0	17.4444	16.65706
I3J3E1	I3J3E1_ORENI	LOC100711916		Tyrosine-protein phosphatase non-receptor type (EC 3.1.3.48)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum [GO:0005783]	endoplasmic reticulum [GO:0005783]; protein tyrosine phosphatase activity [GO:0004725]	protein tyrosine phosphatase activity [GO:0004725]	EDSISKSSTAK	2.24000001	1149.508727	12.77133	13.89346	12.98907	10.21675	8.980066	12.93842	13.88669	14.74138	12.5117	13.82224	0	0	0	0	0	0	16.2601	16.74922	10.79103	0	0	0	0	0	14.30004	17.41154	14.1041	0	12.38914	12.74986	0	0	0	0	0	10.64798	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.35297	0
A0A669BM85	A0A669BM85_ORENI	ube4a	ubiquitin-dependent protein catabolic process [GO:0006511]	U-box domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ubiquitin ligase complex [GO:0000151]	ubiquitin ligase complex [GO:0000151]; ubiquitin-ubiquitin ligase activity [GO:0034450]; ubiquitin-dependent protein catabolic process [GO:0006511]	ubiquitin-ubiquitin ligase activity [GO:0034450]	SSAQETK	4.670000076	751.293084	17.17023	15.78945	16.05767	14.08803	15.87515	14.45838	16.60655	16.70125	15.41743	17.67076	17.97925	15.1115	0	16.81131	15.96032	16.44476	0	17.27517	0	16.58871	16.2495	15.83026	18.91554	20.63193	16.87597	0	17.28677	15.62787	16.52444	14.62939	12.98125	16.62404	12.84111	14.40773	15.39625	0	15.77419	15.633	16.04892	0	14.39551	17.31249	16.68404	15.63995	17.04867	0	16.50376	0	17.59885	0	19.77005	0	0	17.71843
A0A669B7D7	A0A669B7D7_ORENI			U2AF homology motif (UHM) kinase 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]; RNA binding [GO:0003723]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]; RNA binding [GO:0003723]	LGQGVSASVYR	1.539999962	1134.946394	0	11.47576	0	13.5583	16.99218	0	14.00683	0	0	0	0	14.33463	12.27008	14.71098	0	14.61608	10.17382	8.289644	0	0	0	0	0	0	0	12.86129	0	15.40555	14.34221	14.77959	15.25638	13.88729	0	0	15.4146	0	13.13786	14.76589	0	0	10.70679	14.97093	0	0	12.31535	14.61228	0	13.00398	0	0	14.8149	10.61253	0	0
A0A669EWJ8	A0A669EWJ8_ORENI	utp15	rRNA processing [GO:0006364]	U3 small nucleolar RNA-associated protein 15 homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleolus [GO:0005730]	nucleolus [GO:0005730]; rRNA processing [GO:0006364]		EVPCSGIGKLE	4.789999962	1188.649294	13.28621	13.92606	17.03817	0	0	14.63832	11.80331	0	9.101935	10.13284	8.149226	14.03473	14.56959	13.04987	13.23765	0	0	0	0	0	14.4269	0	15.54376	0	0	14.41051	0	10.8985	13.09345	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.74229	0	14.40764	0	0	0	0	12.23217	0	15.12998	0
A0A669F4G8	A0A669F4G8_ORENI		rRNA processing [GO:0006364]	U3 small nucleolar ribonucleoprotein protein MPP10	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Mpp10 complex [GO:0034457]; sno(s)RNA-containing ribonucleoprotein complex [GO:0005732]	Mpp10 complex [GO:0034457]; sno(s)RNA-containing ribonucleoprotein complex [GO:0005732]; rRNA processing [GO:0006364]		LMDTLFLK	11.55000019	996.8475777	12.29663	11.1316	14.5668	14.03755	16.82386	10.00824	17.15244	14.96536	0	20.18154	15.25876	14.53372	17.27927	11.06811	13.70677	16.35388	12.35546	15.81997	14.62287	14.6029	0	15.59396	12.2174	0	15.13056	8.945508	15.07748	15.19821	0	0	15.04568	14.23161	0	11.8261	10.34798	0	12.90201	14.84202	0	0	0	19.10288	11.50938	14.14875	0	12.2008	15.76513	14.61461	14.60993	15.58671	15.27192	16.75748	0	14.26399
I3K693	I3K693_ORENI	LOC100696291		UBA domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				FSSQGMGTFNPADYSANAGAR	6.300000191	2149.057563	9.429184	12.0177	14.16918	7.432048	12.68789	0	0	14.35377	12.15761	11.43073	18.58163	13.88923	12.8452	11.35453	13.66422	17.40088	13.74249	13.77451	0	14.13624	18.08736	16.04148	0	13.4335	0	10.88973	14.38306	0	11.09565	13.45092	11.95743	0	0	0	0	14.79065	11.59567	0	12.87623	0	11.96764	13.64762	16.05482	0	0	0	12.3283	0	9.872558	6.88244	9.838456	0	13.48801	14.32831
I3KPE0	I3KPE0_ORENI	UBE2O		UBC core domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AEPVASDAATK	10.15999985	1060.786671	14.63043	13.68772	14.54621	13.30318	14.8657	14.23077	13.58715	0	15.83428	0	0	0	0	0	13.05584	0	14.82096	0	14.30867	9.095142	14.44739	0	14.60701	0	0	14.59403	13.07498	0	14.46029	0	0	0	0	14.76045	15.18044	12.53782	13.98013	0	0	11.68897	0	14.43775	15.06142	0	11.41377	0	0	0	0	14.09928	14.79663	15.60149	14.69943	14.29003
I3IWS1	I3IWS1_ORENI	hdac6	angiogenesis [GO:0001525]; definitive hemopoiesis [GO:0060216]; hematopoietic progenitor cell differentiation [GO:0002244]	UBP-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; potassium ion binding [GO:0030955]; tubulin deacetylase activity [GO:0042903]; zinc ion binding [GO:0008270]; angiogenesis [GO:0001525]; definitive hemopoiesis [GO:0060216]; hematopoietic progenitor cell differentiation [GO:0002244]	potassium ion binding [GO:0030955]; tubulin deacetylase activity [GO:0042903]; zinc ion binding [GO:0008270]	GGNSLQELKR	6.989999771	1103.159685	11.67859	0	14.74151	0	0	0	12.73766	0	0	0	0	14.29635	0	0	17.57996	0	13.31765	13.66182	16.89663	14.24344	0	0	0	12.41407	15.61735	0	14.7762	14.88713	17.386	0	0	0	0	0	0	0	0	0	0	0	0	14.65132	8.044175	0	0	0	0	10.76453	0	0	0	0	14.97899	0
I3KMG7	I3KMG7_ORENI	faf2		UBX domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GLLGWSYYLIMLPFR	8.289999962	1846.22393	15.38847	14.60331	15.6106	13.93159	14.44602	0	15.50733	15.91074	15.10006	10.56647	14.77064	16.77498	16.44339	17.80524	0	0	17.90146	16.57909	16.88022	17.34673	17.86189	15.29897	15.67489	0	0	0	0	0	16.08256	0	0	16.30625	0	0	0	16.32421	15.81079	0	0	0	15.75556	0	0	15.62248	0	17.15647	0	16.55798	17.97942	17.66509	17.83434	15.98938	18.15514	0
A0A669CPB3	A0A669CPB3_ORENI	LOC100692725		UDENN domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasmic vesicle [GO:0031410]	cytoplasmic vesicle [GO:0031410]; guanyl-nucleotide exchange factor activity [GO:0005085]	guanyl-nucleotide exchange factor activity [GO:0005085]	GQTSEMK	4	796.1896364	17.97844	14.92772	16.66268	0	15.89358	15.31794	0	0	0	16.94777	0	18.55127	15.84505	16.37415	14.14414	0	0	0	16.07906	18.01455	17.58069	0	0	0	0	15.74855	0	19.10629	0	0	16.17644	0	0	0	0	0	0	14.91851	0	0	0	0	16.88125	14.82262	0	16.16771	16.78502	0	16.76529	16.85455	0	18.20953	16.41518	0
A0A669BS95	A0A669BS95_ORENI		protein glycosylation [GO:0006486]	UDP-glucose glycoprotein glucosyltransferase 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endoplasmic reticulum lumen [GO:0005788]	endoplasmic reticulum lumen [GO:0005788]; UDP-glucose:glycoprotein glucosyltransferase activity [GO:0003980]; protein glycosylation [GO:0006486]	UDP-glucose:glycoprotein glucosyltransferase activity [GO:0003980]	QIPAGSQHKK	4.010000229	1093.83113	13.7213	13.25986	14.33566	13.30375	15.29939	14.45471	0	15.13009	16.89367	16.25856	14.07583	15.54363	14.00624	0	13.4897	15.61361	15.32783	13.93563	15.98134	16.96209	15.67995	14.9885	0	15.12128	20.46363	15.37132	15.54429	19.55437	15.41407	15.15555	14.70991	18.46857	17.98074	13.01276	13.59301	16.3098	15.2776	15.49623	13.02122	16.40372	13.3694	15.31983	13.05053	14.66321	16.2618	16.40822	16.04776	0	15.42106	14.79957	14.08707	16.99468	19.74216	14.23808
I3J9P5	I3J9P5_ORENI	LOC100534482		UDP-glucuronosyltransferase (EC 2.4.1.17)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; glucuronosyltransferase activity [GO:0015020]	glucuronosyltransferase activity [GO:0015020]	GASHLR	10.48999977	640.8474839	13.81053	13.89776	16.59369	0	0	0	14.29422	15.68742	0	16.36189	14.82883	14.85436	15.33777	15.36868	15.78081	0	13.88682	0	0	0	15.79259	0	0	15.48278	0	13.56852	0	0	0	0	14.49743	0	0	0	15.20589	17.14322	14.33664	15.26344	0	12.4359	15.48816	17.05492	15.75025	0	15.44034	0	16.00152	0	0	0	0	0	15.53345	0
A0A669B9N9	A0A669B9N9_ORENI	LOC112841656		UDPGT domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; UDP-glycosyltransferase activity [GO:0008194]	UDP-glycosyltransferase activity [GO:0008194]	CASGPGVTDPVLSLWYIR	4.449999809	1992.037026	12.8138	0	0	0	0	14.06757	0	13.18925	0	14.17217	0	13.85383	0	11.54059	14.90004	13.55018	0	0	0	0	0	0	12.61645	12.9987	15.97356	7.402996	12.09831	0	14.5582	0	0	15.00281	13.83135	0	0	13.59702	11.19532	11.67462	10.50636	10.93184	0	0	0	15.80654	11.5319	0	16.68374	14.62198	0	0	11.41786	9.921166	0	13.37942
I3KAX9	I3KAX9_ORENI	LOC100696066	carbohydrate metabolic process [GO:0005975]; carboxylic acid metabolic process [GO:0019752]; cellular protein modification process [GO:0006464]; protein transport [GO:0015031]	UEV domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]; carbohydrate metabolic process [GO:0005975]; carboxylic acid metabolic process [GO:0019752]; cellular protein modification process [GO:0006464]; protein transport [GO:0015031]"	"oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]"	GGSTDLEIFSLPKVEVSR	4.400000095	1933.321656	11.41646	0	12.47997	0	13.19215	0	11.47759	14.33558	14.21806	11.97227	13.55562	0	0	0	15.25287	12.24021	11.50075	12.76113	0	0	0	0	11.14301	0	13.40548	0	10.36961	14.46512	0	0	0	0	13.35568	15.18111	13.30311	11.98719	14.27761	11.87365	14.5805	8.577603	12.65589	0	11.74872	14.90348	14.75049	11.70185	13.01538	13.64342	13.74115	10.40327	13.7518	0	15.51817	0
A0A669BUZ3	A0A669BUZ3_ORENI			UHRF1 binding protein 1-like	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AAKMPQSISSGR	2.74000001	1249.051689	9.810931	10.33725	10.83539	16.77575	11.25748	13.39979	0	11.80508	12.34314	10.45941	13.3841	0	10.2959	0	11.57643	0	0	9.987473	0	0	12.79676	10.70276	14.2553	14.66613	13.26254	0	14.79519	12.95649	14.41984	11.55183	14.84661	11.72791	11.61203	0	17.62213	11.41497	13.78074	12.11295	9.365507	0	10.3364	8.886149	12.85671	0	0	9.727245	15.0722	12.63284	11.1592	0	0	0	0	0
A0A669DS40	A0A669DS40_ORENI	LOC100696501	protein desumoylation [GO:0016926]	ULP_PROTEASE domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	MLL1 complex [GO:0071339]	MLL1 complex [GO:0071339]; cysteine-type peptidase activity [GO:0008234]; protein desumoylation [GO:0016926]	cysteine-type peptidase activity [GO:0008234]	YEEPPYR	1.440000057	954.110226	15.96305	14.27302	14.59547	15.93772	0	16.27711	15.2277	15.48891	0	15.17133	15.70608	13.93307	0	14.74474	16.57217	0	0	0	15.34634	16.45407	15.00475	15.57698	0	15.58497	12.22841	15.45849	0	16.07634	0	15.80903	0	17.04081	16.04281	0	15.73519	0	16.2918	17.22734	0	15.60992	16.64257	15.88733	15.80304	0	16.20857	15.97932	15.46963	0	17.05673	16.85154	16.47717	16.22163	0	0
A0A669DEY3	A0A669DEY3_ORENI	LOC100690273	protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	USP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		thiol-dependent ubiquitin-specific protease activity [GO:0004843]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	thiol-dependent ubiquitin-specific protease activity [GO:0004843]	CASLQRNGEVTIPPAHR	1.629999995	1905.004708	14.76895	13.42056	0	15.3333	13.49068	15.36082	14.79799	0	0	16.04365	13.85352	12.032	0	0	0	0	0	0	0	0	0	0	0	0	0	14.76699	15.45413	0	15.31812	0	0	0	0	0	0	12.23581	0	0	0	0	15.22694	0	0	13.75069	17.62267	0	14.91927	0	0	0	16.40914	0	15.71046	0
A0A669EIF0	A0A669EIF0_ORENI	wdr48		USP1-associated factor 1 (WD repeat-containing protein 48)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	late endosome [GO:0005770]	late endosome [GO:0005770]		KVMEHVYEK	3.039999962	1179.025507	10.9646	14.97402	12.6983	12.98457	14.0395	12.04688	11.1076	0	0	13.42289	14.57105	0	0	12.6938	0	13.61016	12.42042	11.00223	0	15.88734	13.80134	13.89662	15.7494	13.21401	0	0	0	0	0	13.20418	15.56552	19.07315	14.31703	15.44028	0	14.85707	13.85791	9.111883	14.32969	0	13.75277	14.3555	0	10.15662	14.29146	0	13.74623	0	15.28901	18.63411	13.20132	0	0	0
A0A669F0V1	A0A669F0V1_ORENI		nucleotide-excision repair [GO:0006289]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]	UV excision repair protein RAD23	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; proteasome complex [GO:0000502]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; proteasome complex [GO:0000502]; damaged DNA binding [GO:0003684]; polyubiquitin modification-dependent protein binding [GO:0031593]; ubiquitin binding [GO:0043130]; nucleotide-excision repair [GO:0006289]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]	damaged DNA binding [GO:0003684]; polyubiquitin modification-dependent protein binding [GO:0031593]; ubiquitin binding [GO:0043130]	ASYNNPDR	3.220000029	937.1707898	14.66106	14.76127	14.05973	14.10495	13.97083	0	0	12.47108	15.08553	14.82434	14.36213	12.27529	12.86411	13.22507	12.91765	13.3187	0	11.779	0	16.0153	15.28446	0	0	0	0	13.87336	14.57157	14.87822	13.74166	13.20874	12.00159	13.67173	13.65962	0	13.45365	13.7207	0	0	12.75786	14.59098	0	14.25766	14.14729	0	0	12.91296	13.34597	0	11.72378	11.47538	0	15.36606	11.45017	12.80029
I3K0F5	I3K0F5_ORENI		response to UV [GO:0009411]	UV-stimulated scaffold protein A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		response to UV [GO:0009411]		EQQPDWRDAELMR	8.880000114	1686.809987	0	0	0	0	15.85354	0	16.73506	16.81489	0	16.04558	15.22729	0	17.28278	16.80908	16.91652	19.61485	0	0	0	0	0	0	0	0	0	0	0	18.76366	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669B521	A0A669B521_ORENI		ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway [GO:0043162]	Ubiquitin associated protein 1-like a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ESCRT I complex [GO:0000813]	ESCRT I complex [GO:0000813]; ubiquitin binding [GO:0043130]; ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway [GO:0043162]	ubiquitin binding [GO:0043130]	YLVTCDR	2.309999943	926.4658451	11.95825	17.50663	15.01731	16.1372	14.40452	13.85993	15.57204	14.95877	15.66974	12.00741	17.05696	16.51399	16.52464	16.49749	15.93004	17.49302	15.8537	14.53474	16.83709	0	0	16.29064	14.82857	17.43956	0	17.49255	16.08997	15.25585	0	14.93696	16.89104	0	0	15.37598	0	14.41283	15.15805	0	0	16.77359	0	0	0	16.11359	0	0	16.68545	0	17.5635	16.03589	14.78971	17.25998	0	0
I3IZY2	I3IZY2_ORENI	mindy4		Ubiquitin carboxyl-terminal hydrolase MINDY (EC 3.4.19.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cysteine-type peptidase activity [GO:0008234]; Lys48-specific deubiquitinase activity [GO:1990380]; thiol-dependent ubiquitin-specific protease activity [GO:0004843]	cysteine-type peptidase activity [GO:0008234]; Lys48-specific deubiquitinase activity [GO:1990380]; thiol-dependent ubiquitin-specific protease activity [GO:0004843]	KLLFESTESCNVGLQR	3.849999905	1881.85906	9.11045	13.97173	14.34149	15.22283	11.55761	16.00474	15.93343	12.36518	14.25132	14.42173	14.51983	0	13.96694	15.3009	0	15.11812	14.36122	0	13.62716	14.90761	14.60934	14.26619	12.64949	0	13.30912	14.20884	16.12023	15.88343	15.52088	15.93161	16.273	15.8334	15.43199	13.51855	18.19397	13.03965	15.87321	15.26631	0	16.55826	13.73041	14.48242	0	15.12075	15.84843	14.01367	13.2953	16.9577	0	12.28691	15.66561	16.78851	15.17026	16.97302
A0A669CZ22	A0A669CZ22_ORENI	UBE2D3		Ubiquitin conjugating enzyme E2 D3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; transferase activity [GO:0016740]	ATP binding [GO:0005524]; transferase activity [GO:0016740]	SQWSPALTISK	11.80000019	1218.289026	13.53566	11.42988	11.71291	12.01531	10.57489	13.14207	18.53297	10.37817	0	0	14.47393	0	13.94275	13.52888	0	13.97959	12.38146	12.25862	17.03568	14.39252	11.60711	12.26256	0	12.27137	15.19635	0	10.27015	10.14545	10.67367	0	12.17631	11.81743	0	0	0	0	12.94127	10.65336	0	11.70676	16.53396	13.31108	0	17.0269	18.58173	12.49482	0	0	17.67449	17.88904	12.75942	13.59252	10.33541	0
A0A669CCB4	A0A669CCB4_ORENI			Ubiquitin protein ligase E3 component n-recognin 5	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]; ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]	RNA binding [GO:0003723]; ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]	LMCDSVVLRPHLRELLSAK	3.950000048	2236.635604	13.90582	13.59545	10.70255	0	0	9.905746	11.86724	13.38448	0	10.99451	11.7281	8.99777	0	13.30399	0	13.16265	14.20806	13.92706	14.56354	15.01411	15.35701	13.91031	14.41457	15.88828	14.65546	13.16279	15.13591	13.72885	12.61242	0	0	13.32489	0	16.66168	12.6741	9.986506	17.01809	0	0	11.29465	0	12.98214	12.17516	0	0	0	12.76276	0	11.66804	0	0	13.55503	14.72091	0
I3ITS7	I3ITS7_ORENI		cranial skeletal system development [GO:1904888]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	Ubiquitin specific peptidase 18	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		thiol-dependent ubiquitin-specific protease activity [GO:0004843]; cranial skeletal system development [GO:1904888]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	thiol-dependent ubiquitin-specific protease activity [GO:0004843]	TYGGRQSR	5.929999828	923.6178525	0	14.17145	13.8124	14.07557	14.71995	0	12.39778	15.67832	12.23111	15.08374	13.58893	14.07091	15.07641	13.7899	14.40729	14.43717	15.30494	17.35812	14.87637	15.41007	15.99814	17.66455	13.657	14.59283	14.28675	14.9939	13.38047	14.16608	0	17.01228	16.36188	15.94576	16.44308	14.76387	0	14.32649	15.3456	15.14335	15.68192	0	15.85213	0	15.92263	15.10238	0	15.58151	13.63979	16.12087	18.91068	16.96323	15.59423	17.41449	15.30837	15.93274
A0A669EWQ5	A0A669EWQ5_ORENI		protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	Ubiquitin specific peptidase 25	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		thiol-dependent ubiquitin-specific protease activity [GO:0004843]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	thiol-dependent ubiquitin-specific protease activity [GO:0004843]	EIEEWDIMQARK	2.519999981	1564.490353	12.54559	10.21713	0	13.73952	14.53602	13.19089	13.95492	15.06443	14.33456	0	16.66726	16.32417	0	14.46213	0	0	0	0	15.27069	0	0	0	0	0	16.93435	0	17.17476	0	0	14.46705	14.46902	0	0	0	0	0	0	0	0	0	15.50964	0	0	0	15.41066	0	0	0	0	0	16.23215	0	0	0
A0A669C505	A0A669C505_ORENI		protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	Ubiquitin specific peptidase 31	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		thiol-dependent ubiquitin-specific protease activity [GO:0004843]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	thiol-dependent ubiquitin-specific protease activity [GO:0004843]	SNSPSRFSLDSR	2.710000038	1351.441174	0	12.70022	11.0065	0	8.21225	13.30418	0	6.166879	11.4203	0	11.51463	10.72384	10.96638	12.30162	0	10.04314	12.0145	11.74607	11.72881	0	10.36788	12.95619	0	0	14.25067	14.11777	0	0	11.41519	0	12.58181	0	0	11.05011	11.79785	10.22493	0	10.0123	13.56581	13.50651	0	0	13.73864	11.29775	13.50386	0	15.96297	0	13.34728	0	0	0	0	9.57921
I3IUF0	I3IUF0_ORENI		protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	Ubiquitin specific peptidase 8	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		thiol-dependent ubiquitin-specific protease activity [GO:0004843]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	thiol-dependent ubiquitin-specific protease activity [GO:0004843]	EEKLTDNNK	4.829999924	1091.264162	14.61811	14.24995	15.15322	13.45111	12.92012	13.62576	4.95406	15.40013	0	0	0	0	0	14.18348	0	14.98443	0	0	0	0	13.34525	14.49766	12.43965	0	11.13628	11.74823	0	13.48342	14.8947	11.54091	0	0	0	0	0	0	0	0	0	0	0	15.21789	0	0	13.47795	0	11.89771	0	0	0	17.17635	0	0	0
I3J513	I3J513_ORENI			Ubiquitin-conjugating enzyme E2 variant 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		AVTKMAVAGQGVK	3.559999943	1260.7294	13.24281	12.80104	14.76384	13.06601	0	12.30363	13.51053	0	0	0	0	0	11.9841	13.0455	12.11446	12.18263	0	14.89982	13.01446	0	14.90606	0	13.97456	0	9.949913	0	0	9.412099	0	12.92986	20.78942	20.79108	20.18176	0	0	12.71438	12.137	11.53806	12.50168	9.068086	0	12.18437	9.707543	0	0	13.05764	14.06848	15.49979	0	0	15.82137	12.87669	0	0
I3J7D0	I3J7D0_ORENI			"Ubiquitin-conjugating enzyme E2G 1b (UBC7 homolog, yeast)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; transferase activity [GO:0016740]	ATP binding [GO:0005524]; transferase activity [GO:0016740]	KSQDTAFD	3.670000076	911.4044974	0	0	0	0	13.41602	14.45749	0	15.43328	14.41423	14.77229	15.0438	12.86129	0	0	0	15.21132	0	0	0	0	18.92271	15.70794	15.96775	0	0	13.75846	15.78661	13.65091	0	0	0	0	0	0	0	0	0	0	15.41022	0	16.80112	0	0	14.80984	0	0	0	0	0	16.74038	16.45686	0	0	0
A0A669FC12	A0A669FC12_ORENI		protein ufmylation [GO:0071569]	Ubiquitin-fold modifier 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein ufmylation [GO:0071569]		VGGQGD	5.889999866	531.4376929	0	0	14.91525	13.64551	14.53928	0	15.67785	0	13.64197	16.38911	15.50313	14.9888	13.12232	14.43995	0	15.7965	17.48775	16.40753	0	14.10203	14.79971	15.06136	0	15.70226	11.62689	14.968	16.80791	0	0	12.7539	0	15.76618	0	0	15.37599	14.39721	15.16664	15.49776	14.72372	15.35968	0	16.63816	15.55592	15.21011	15.65819	0	14.47579	16.43239	13.06085	0	15.5435	0	0	15.54917
A0A669C3U0	A0A669C3U0_ORENI	LOC100691436		Ubiquitin-like domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]		LALLHK	8.979999542	695.0542352	14.9958	0	13.79471	0	0	15.37838	15.41984	13.70848	14.69935	15.80902	12.51276	0	14.15917	14.51875	0	0	14.91617	14.81275	15.91328	13.72305	13.81059	14.47935	15.94743	16.04192	0	0	15.48187	14.7632	14.17132	15.00527	17.39948	18.30015	0	0	0	15.1334	14.9394	0	15.76398	15.02747	14.79094	14.64661	0	16.28584	14.17916	0	0	13.97745	0	15.6764	13.2687	0	14.34151	0
A0A669DHN9	A0A669DHN9_ORENI		protein ubiquitination [GO:0016567]	Ubiquitin-like modifier activating enzyme 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ubiquitin-like modifier activating enzyme activity [GO:0008641]; protein ubiquitination [GO:0016567]	ATP binding [GO:0005524]; ubiquitin-like modifier activating enzyme activity [GO:0008641]	QPPENAMQYLTYRTLK	9.010000229	1969.988467	14.8363	16.16562	12.5273	0	16.52221	0	16.32613	15.4959	15.65401	0	15.24569	0	0	15.14206	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.49522	0	0	0	0	0	0	0	14.70704	0	0	16.49183	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669EQW5	A0A669EQW5_ORENI		autophagosome assembly [GO:0000045]	Ubiquitin-like protein ATG12	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; autophagosome assembly [GO:0000045]		AVGDTPIMK	12.90999985	933.3020196	14.2078	0	0	14.41287	15.59892	9.686844	15.34321	15.18016	16.2692	0	0	0	16.53854	11.5808	11.63343	12.09264	0	16.11337	0	12.95988	14.59902	0	0	0	0	11.15454	17.43159	15.70062	0	0	16.5275	0	0	13.27015	0	0	13.44969	16.86551	15.19192	0	14.96988	15.5845	0	16.70128	0	0	0	0	0	0	0	0	0	0
A0A669DDE4	A0A669DDE4_ORENI	OTUD7A		Ubiquitinyl hydrolase 1 (EC 3.4.19.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; cysteine-type peptidase activity [GO:0008234]; DNA binding [GO:0003677]; thiol-dependent ubiquitin-specific protease activity [GO:0004843]; zinc ion binding [GO:0008270]	cysteine-type peptidase activity [GO:0008234]; DNA binding [GO:0003677]; thiol-dependent ubiquitin-specific protease activity [GO:0004843]; zinc ion binding [GO:0008270]	LSLNILRAAMQGER	15.02000046	1588.638362	12.75343	13.94993	14.63416	11.81575	15.94993	13.65776	13.54424	13.57947	13.19254	15.10901	16.2967	16.15008	14.15184	0	14.29649	0	0	0	11.09361	15.71119	13.51736	0	13.9813	11.24119	12.86513	0	14.0315	12.47219	15.15003	0	0	15.32853	0	16.02684	14.45432	14.81644	12.71514	15.31664	15.22749	15.46974	0	15.78416	15.96823	14.85497	14.46999	12.42995	12.93762	14.46577	13.28446	14.46795	15.18225	0	14.03401	15.3066
I3JB40	I3JB40_ORENI		"intracellular signal transduction [GO:0035556]; synaptic transmission, glutamatergic [GO:0035249]; synaptic vesicle maturation [GO:0016188]; synaptic vesicle priming [GO:0016082]"	Unc-13 homolog A (C. elegans)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	presynapse [GO:0098793]	"presynapse [GO:0098793]; calcium ion binding [GO:0005509]; diacylglycerol binding [GO:0019992]; phospholipid binding [GO:0005543]; intracellular signal transduction [GO:0035556]; synaptic transmission, glutamatergic [GO:0035249]; synaptic vesicle maturation [GO:0016188]; synaptic vesicle priming [GO:0016082]"	calcium ion binding [GO:0005509]; diacylglycerol binding [GO:0019992]; phospholipid binding [GO:0005543]	EIMEPGPAR	3.190000057	999.7345556	0	16.23453	14.17166	13.28134	0	13.75879	14.80699	16.37227	0	11.85473	0	14.22346	13.73293	15.49752	14.60872	15.8871	0	14.42671	14.97175	16.29688	12.68658	15.88	15.078	14.88607	16.41205	16.87127	15.99118	15.10654	14.91207	0	14.97211	0	15.74384	0	16.21328	0	15.36394	14.3203	0	0	14.5654	15.51727	0	19.25844	14.6528	15.18416	12.96883	0	0	16.63293	0	0	15.61258	0
A0A669EPN7	A0A669EPN7_ORENI	UNC13B	chemical synaptic transmission [GO:0007268]; exocytosis [GO:0006887]; intracellular signal transduction [GO:0035556]	Unc-13 homolog B	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	synapse [GO:0045202]	synapse [GO:0045202]; calcium ion binding [GO:0005509]; diacylglycerol binding [GO:0019992]; phospholipid binding [GO:0005543]; chemical synaptic transmission [GO:0007268]; exocytosis [GO:0006887]; intracellular signal transduction [GO:0035556]	calcium ion binding [GO:0005509]; diacylglycerol binding [GO:0019992]; phospholipid binding [GO:0005543]	ARIENFR	31.40999985	903.3926575	0	0	16.72149	0	0	0	18.32995	0	16.59044	15.9421	15.77275	15.82632	16.83287	15.93083	16.75135	0	17.24335	17.2056	16.19828	15.22662	16.31752	16.00887	16.73589	0	18.05401	16.44234	0	15.74717	0	17.72493	17.18305	18.08276	0	0	17.35786	0	0	15.67755	0	16.98653	0	0	16.18015	0	0	0	0	0	16.39829	0	0	0	16.25676	0
A0A669C6I5	A0A669C6I5_ORENI	UNC13C	chemical synaptic transmission [GO:0007268]; exocytosis [GO:0006887]; intracellular signal transduction [GO:0035556]	Unc-13 homolog C	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	synapse [GO:0045202]	synapse [GO:0045202]; calcium ion binding [GO:0005509]; diacylglycerol binding [GO:0019992]; phospholipid binding [GO:0005543]; chemical synaptic transmission [GO:0007268]; exocytosis [GO:0006887]; intracellular signal transduction [GO:0035556]	calcium ion binding [GO:0005509]; diacylglycerol binding [GO:0019992]; phospholipid binding [GO:0005543]	DPQSKSSSMYR	14.68999958	1302.267456	0	0	8.633535	8.97174	10.78819	11.95192	10.79732	16.10075	9.383659	11.71599	11.92333	0	11.13224	0	10.99966	0	0	12.17843	13.67216	8.953922	13.87791	11.54153	0	14.0753	11.02231	12.33386	0	0	0	11.51816	0	17.90246	14.46199	0	0	0	0	0	0	13.14154	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KW79	I3KW79_ORENI	UNC79		"Unc-79 homolog, NALCN channel complex subunit"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VDPVDRR	2.059999943	855.6894275	15.7101	12.26105	13.67216	13.67002	14.04988	15.03991	11.68008	11.90767	0	15.17746	0	15.32277	14.41467	15.05045	13.57037	13.71739	16.19405	14.99334	15.25053	0	15.76989	0	0	15.15198	15.26487	9.837734	0	0	15.49174	0	15.07435	0	16.99694	0	0	15.35098	0	0	15.57105	0	0	15.66906	15.4455	15.79847	0	16.4385	0	0	14.53056	0	15.31666	0	0	0
A0A669BDU3	A0A669BDU3_ORENI			Si:dkey-21e5.1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; potassium channel activity [GO:0005267]	potassium channel activity [GO:0005267]	AYGFK	2.400000095	585.1146964	14.27579	13.69495	12.7559	12.71504	14.28443	13.25817	13.71077	13.06024	0	13.97937	13.9167	15.02881	0	14.13473	15.82505	13.58437	13.38636	13.88761	0	13.7602	15.22445	15.42652	13.3233	8.613271	0	13.70074	14.7613	14.12681	16.34864	15.63595	0	17.83028	19.57855	16.5297	15.71514	14.12745	15.89854	15.26379	13.80206	14.57688	14.60422	14.19761	14.6515	15.34742	15.00672	14.21234	14.57472	0	0	14.37268	15.10951	0	0	0
I3JA70	I3JA70_ORENI	trmt13		tRNA:m(4)X modification enzyme TRM13 (EC 2.1.1.225)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; tRNA 2'-O-methyltransferase activity [GO:0106050]	metal ion binding [GO:0046872]; tRNA 2'-O-methyltransferase activity [GO:0106050]	GFSSK	1.090000033	525.2456438	15.55029	15.42541	14.86026	15.02151	16.22606	16.73419	16.48862	15.84039	16.17094	16.75877	14.43066	16.16533	15.38757	16.84285	16.00237	0	14.63885	17.86646	17.5479	17.2303	16.79698	14.03159	16.43886	0	14.86195	16.88236	0	17.15901	17.12871	16.53012	16.79656	16.70908	17.39015	16.63218	16.92166	16.9822	16.97711	17.7852	17.83333	16.37181	17.52334	15.43657	15.70898	17.22694	16.7059	16.24882	16.42817	16.33661	14.90419	17.33359	17.16006	16.49045	15.21703	17.14622
I3JBV3	I3JBV3_ORENI			WD_REPEATS_REGION domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				IGGSR	8.609999657	487.1362598	15.70441	14.59201	15.23868	15.7103	14.88447	14.81899	15.09426	13.53568	14.07673	14.83784	15.28848	14.66369	15.32613	15.04971	15.67572	0	16.42934	15.27924	14.73328	0	14.9532	15.68131	14.35455	15.43608	15.36391	15.13645	15.13129	16.88865	15.00459	15.99624	14.30771	15.88079	14.08963	17.51405	16.26432	14.69504	15.84289	14.80942	14.3615	16.7137	16.74256	15.06337	16.29914	15.46272	15.04369	14.87642	16.06022	15.36055	16.37711	14.67676	14.349	16.43368	16.49827	15.40598
I3JWQ5	I3JWQ5_ORENI			Zinc finger protein 609a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				RDSGK	6.630000114	562.9289848	15.87041	16.59948	18.85946	16.71487	19.48097	19.02999	16.64151	15.32433	18.65039	17.23214	17.81196	16.36443	17.15224	17.01124	17.19973	16.25338	17.03765	16.61488	0	0	16.62594	19.41077	15.3033	0	17.98059	19.00184	18.92092	0	0	0	19.93383	20.18664	18.79816	0	15.0799	15.93887	0	0	16.04868	16.18144	0	16.30951	16.74028	19.43685	15.63292	19.06593	0	19.30095	17.3883	0	17.1052	0	17.43763	18.90926
A0A669DEU0	A0A669DEU0_ORENI	LOC100711408	endocytosis [GO:0006897]; protein transport [GO:0015031]; sensory perception of sound [GO:0007605]	Unconventional myosin-6 (Unconventional myosin-VI)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]; cytosol [GO:0005829]; filopodium [GO:0030175]; Golgi apparatus [GO:0005794]; microvillus [GO:0005902]; myosin complex [GO:0016459]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; ruffle membrane [GO:0032587]	clathrin-coated pit [GO:0005905]; clathrin-coated vesicle [GO:0030136]; cytosol [GO:0005829]; filopodium [GO:0030175]; Golgi apparatus [GO:0005794]; microvillus [GO:0005902]; myosin complex [GO:0016459]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; ruffle membrane [GO:0032587]; actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]; endocytosis [GO:0006897]; protein transport [GO:0015031]; sensory perception of sound [GO:0007605]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; motor activity [GO:0003774]	WLLCSLWKK	8.529999733	1231.984022	10.62568	0	12.8073	0	0	0	12.14508	10.72763	0	13.98165	0	0	14.33542	10.91191	15.63144	9.547069	14.15622	9.579552	13.67965	0	11.21358	0	13.11939	0	0	13.7376	13.09844	0	14.06788	12.57844	15.14423	13.66637	12.25836	0	13.22213	12.34962	13.70027	0	0	0	0	12.03775	14.16973	14.3131	0	13.6779	0	12.23477	0	13.18093	17.22509	13.53606	0	13.94569
I3K9B5	I3K9B5_ORENI			Upstream transcription factor family member 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein dimerization activity [GO:0046983]	protein dimerization activity [GO:0046983]	VQAEEIRR	10.39000034	1000.62636	14.8183	13.02944	12.87566	13.64225	13.67268	15.76593	14.19608	9.817696	15.02885	14.43242	10.4119	15.3143	11.76204	13.03356	13.3104	0	14.45999	13.11467	0	0	0	0	13.5571	0	5.501643	9.909175	11.73641	12.87847	0	14.48455	15.37931	15.63803	13.46391	12.83217	0	14.53717	13.55011	12.48722	0	0	0	11.51162	14.51604	15.24946	14.27107	14.21806	13.06701	13.11043	13.98891	15.22555	13.92325	12.88248	0	14.0639
I3JZI0	I3JZI0_ORENI			Uromodulin-like 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; calcium ion binding [GO:0005509]; peptidase inhibitor activity [GO:0030414]	calcium ion binding [GO:0005509]; peptidase inhibitor activity [GO:0030414]	VLRAVLEHG	4.119999886	994.3303592	14.4643	13.44132	16.17821	14.42515	17.32445	14.48251	13.13804	13.0834	15.32388	15.56032	13.71454	14.30251	14.00023	14.62697	15.93239	0	15.85441	15.48046	16.80851	17.20333	14.45832	16.4802	15.23332	15.84513	14.71416	13.98528	15.34162	13.37814	15.0332	15.61344	14.65691	16.36602	16.05308	11.97066	12.18884	0	0	15.02039	16.22001	15.55805	12.92063	0	0	12.81038	14.60912	0	15.45675	0	17.56051	17.4653	17.59741	13.97481	16.82407	0
A0A2U8T076	A0A2U8T076_ORENI	Rag1	B cell differentiation [GO:0030183]; histone monoubiquitination [GO:0010390]; T cell differentiation in thymus [GO:0033077]; V(D)J recombination [GO:0033151]	V(D)J recombination-activating protein 1 (EC 2.3.2.27) (EC 3.1.-.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; endonuclease activity [GO:0004519]; histone binding [GO:0042393]; protein homodimerization activity [GO:0042803]; sequence-specific DNA binding [GO:0043565]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]; B cell differentiation [GO:0030183]; histone monoubiquitination [GO:0010390]; T cell differentiation in thymus [GO:0033077]; V(D)J recombination [GO:0033151]	endonuclease activity [GO:0004519]; histone binding [GO:0042393]; protein homodimerization activity [GO:0042803]; sequence-specific DNA binding [GO:0043565]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]	LYLQMKPVWR	2.779999971	1350.37793	14.87919	15.81559	0	15.27079	0	0	15.95892	0	0	14.628	15.89619	0	15.09556	0	14.86351	15.89215	0	15.00123	13.38354	0	0	13.92576	15.83768	0	17.38407	16.01007	13.63056	16.00935	0	0	0	0	0	16.67119	10.19801	0	14.07691	0	14.39716	0	0	0	15.0165	16.15867	13.5539	0	14.84849	0	15.44151	13.95371	13.56448	0	0	16.70644
A0A669EA81	A0A669EA81_ORENI			V-set and transmembrane domain containing 4b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		MKISSVVLAFLTR	14.67000008	1464.889131	0	14.75828	0	14.19902	15.04495	0	14.74595	0	0	10.65403	12.43777	0	15.17996	0	15.00366	17.10948	16.71307	0	12.51725	0	15.35086	15.4168	0	14.41682	0	17.0067	15.17723	12.40653	0	0	0	12.80791	15.83033	0	0	12.54854	0	0	0	0	0	0	14.89538	14.98491	13.25652	0	0	0	13.73741	0	0	0	0	0
A0A669BIP2	A0A669BIP2_ORENI			V-type proton ATPase subunit C	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"proton-transporting V-type ATPase, V1 domain [GO:0033180]"	"proton-transporting V-type ATPase, V1 domain [GO:0033180]; proton transmembrane transporter activity [GO:0015078]"	proton transmembrane transporter activity [GO:0015078]	AVDDFK	3.190000057	693.5464625	14.68982	14.96544	0	0	16.07825	13.02045	14.19917	13.39023	15.32251	15.66873	15.03528	14.7028	0	13.11681	13.95419	14.91926	14.25575	13.45674	15.23038	14.22936	13.98168	14.43802	16.21379	15.73375	14.67514	14.39032	0	12.5397	15.1316	0	16.86541	17.64959	16.49626	14.60763	0	15.52878	17.38212	13.46718	14.16109	12.91826	0	12.32695	11.94448	0	14.9023	0	13.07775	13.39497	11.76134	15.64209	12.55005	13.73636	14.22085	14.59421
A0A669BE41	A0A669BE41_ORENI	atp6v0a2		V-type proton ATPase subunit a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"integral component of membrane [GO:0016021]; vacuolar proton-transporting V-type ATPase, V0 domain [GO:0000220]"	"integral component of membrane [GO:0016021]; vacuolar proton-transporting V-type ATPase, V0 domain [GO:0000220]; proton transmembrane transporter activity [GO:0015078]"	proton transmembrane transporter activity [GO:0015078]	ILGKHMLVFDILIVR	3.670000076	1782.121676	14.21547	0	12.34315	0	15.0825	0	15.07726	15.28144	15.64655	16.5076	0	0	0	0	0	0	0	0	0	0	15.70591	0	0	16.36891	16.14225	14.74946	12.32757	15.67904	0	0	15.78602	0	0	15.93592	15.42016	14.03227	14.44003	0	0	12.08178	0	0	5.619489	0	0	14.49267	14.76738	0	15.84431	0	15.32221	0	0	15.82845
A0A669F9D6	A0A669F9D6_ORENI	virma	mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	VIR_N domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; mRNA processing [GO:0006397]; RNA splicing [GO:0008380]		GRGGTGLSWISGGGGGGGAGGGLTDDTFK	14.19999981	2552.667736	13.47813	9.560104	2.240232	12.7471	10.10926	13.16931	8.410119	0	0	0	12.56158	0	0	13.34068	0	0	0	0	0	0	0	0	0	18.85933	0	0	0	0	0	0	0	12.83857	0	0	0	0	0	10.54854	10.56803	0	0	0	0	0	0	10.12151	7.135965	0	0	0	0	0	14.60486	13.68415
I3JDK9	I3JDK9_ORENI	LOC100701731		VLIG-type G domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; GTP binding [GO:0005525]	GTP binding [GO:0005525]	QFLEMHK	4.820000172	947.5873086	16.79136	12.82915	0	0	16.99945	15.84098	0	0	14.62617	0	14.76754	0	0	15.34932	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12.42579	0	0	0	0	0	15.42131	0	12.95257	0	0	14.40988	0	16.10209	0	16.04955	0	0	0	0	0	0	0	0	16.41541
A0A669ET48	A0A669ET48_ORENI		"retrograde transport, endosome to Golgi [GO:0042147]"	VPS53 subunit of GARP complex	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]; GARP complex [GO:0000938]	"cytosol [GO:0005829]; GARP complex [GO:0000938]; retrograde transport, endosome to Golgi [GO:0042147]"		GMTRAEMILK	5.340000153	1180.086016	15.44632	14.97879	15.77448	13.85062	14.07171	14.51781	15.72369	0	12.70833	15.67025	0	16.01401	15.38231	14.26807	15.4526	13.88059	14.42496	15.9609	0	0	0	14.48338	14.73746	0	15.07551	14.798	14.81402	15.84276	0	14.99025	0	16.90077	0	0	12.27222	0	16.31104	14.72703	15.10449	0	10.77285	13.90083	13.38479	15.62806	14.21021	15.29512	15.33288	13.71107	15.15609	15.31582	0	15.0266	15.15984	15.30323
A0A669DN65	A0A669DN65_ORENI			VPS8 subunit of CORVET complex	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	QHDSLDLNCK	11.46000004	1229.553659	7.977504	10.33837	0	13.76768	11.43628	14.14535	12.54934	0	0	14.86883	15.33766	0	0	13.1267	12.1241	0	0	0	12.93945	0	10.01453	11.13479	0	18.99615	0	14.07644	0	17.28901	0	0	0	14.28158	16.36913	8.109036	0	11.92771	0	13.42974	16.36885	11.3647	16.65623	0	0	0	10.61733	11.52451	11.37939	11.85227	0	21.84518	0	0	13.7908	13.95722
I3JTM7	I3JTM7_ORENI	COL21A1		VWFA domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	collagen trimer [GO:0005581]	collagen trimer [GO:0005581]		GEHGRPGGVGSSGPMGLK	11.35999966	1678.940896	0	15.47232	14.333	13.56653	10.01677	14.6149	11.01595	0	11.04607	11.28574	12.87256	14.65947	0	0	14.88264	0	17.48716	0	16.04987	13.7776	0	11.13472	0	15.53498	17.63153	17.42587	15.40917	15.37209	15.41513	14.49849	17.32256	17.52812	13.24761	0	0	15.97595	0	0	0	13.86529	0	17.44236	0	12.08544	0	0	19.5017	9.540243	14.59811	15.13715	16.61568	0	0	0
I3J7Y5	I3J7Y5_ORENI	LOC100698493	protein targeting to vacuole [GO:0006623]; vesicle-mediated transport [GO:0016192]	Vacuolar fusion protein MON1 homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		protein targeting to vacuole [GO:0006623]; vesicle-mediated transport [GO:0016192]		SSRGGK	3.430000067	592.3552792	14.68342	14.78146	0	14.40237	15.57152	0	0	0	14.3752	13.76086	15.8998	13.53518	15.84483	14.3609	0	0	15.09933	0	15.72482	15.54947	14.94563	15.54602	15.59535	14.60893	15.36465	0	0	0	14.36984	15.57484	0	0	12.04662	0	14.84803	14.44357	15.13313	13.66774	15.18535	0	0	13.61596	0	0	14.97508	14.42377	0	12.16638	16.22813	15.35342	13.64771	0	14.63186	14.66682
A0A669B8L6	A0A669B8L6_ORENI			Vacuolar protein sorting 13 homolog A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DKNEIIR	3.200000048	886.4995438	14.43675	14.66832	15.64215	14.95065	15.40413	15.91132	14.4119	13.47836	15.11532	15.29128	0	15.00703	15.52481	14.06821	0	13.77487	14.23454	15.67108	13.80497	16.72304	0	17.07509	17.88207	0	0	16.82425	0	0	0	15.88088	19.41898	19.03536	19.93854	15.98413	0	0	0	0	0	16.42811	12.9899	0	14.74604	16.67699	0	0	0	15.74885	0	18.56972	0	16.34412	15.88393	0
A0A669DZW8	A0A669DZW8_ORENI			Vacuolar protein sorting 13 homolog D	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GASPAPK	5.840000153	627.7878869	16.4339	18.78106	16.65832	0	18.38676	18.07088	18.4833	17.72886	0	17.49053	16.3955	17.76651	15.96212	16.24729	0	16.06641	16.95256	17.25043	15.767	17.25186	15.87239	0	17.41391	17.72184	17.89554	19.02513	15.59568	18.18867	0	0	17.11354	17.55411	16.907	16.29257	0	17.47529	18.07688	17.28545	18.56829	0	0	0	0	19.23658	19.08497	18.10194	19.06174	0	17.58871	0	17.06115	19.00757	18.09066	0
A0A669CGA3	A0A669CGA3_ORENI	vps28	protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway [GO:0043328]	Vacuolar protein sorting-associated protein 28 homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ESCRT I complex [GO:0000813]	ESCRT I complex [GO:0000813]; protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway [GO:0043328]		LLVQYKAAFK	2.779999971	1182.670953	14.566	12.9375	14.92076	7.316541	13.89579	12.76632	13.32264	0	12.55193	14.00842	0	14.64011	14.65906	14.4772	14.76067	14.8872	14.90539	0	0	0	0	0	0	0	0	15.11435	15.15395	0	0	12.8399	19.22766	21.77395	21.76993	15.57321	16.24467	15.68004	15.28689	0	15.35465	15.46688	0	15.79024	0	15.42451	0	0	0	0	0	12.60807	0	0	0	0
A0A669B0S0	A0A669B0S0_ORENI		"retrograde transport, endosome to Golgi [GO:0042147]"	Vacuolar protein sorting-associated protein 53 homolog	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytosol [GO:0005829]; endosome membrane [GO:0010008]; GARP complex [GO:0000938]	"cytosol [GO:0005829]; endosome membrane [GO:0010008]; GARP complex [GO:0000938]; retrograde transport, endosome to Golgi [GO:0042147]"		EKEVSEAAK	4.210000038	990.5843031	13.09377	14.52058	0	13.13273	14.51537	0	14.64912	16.36553	12.34952	13.30258	13.99172	0	0	14.68212	13.88326	14.79224	14.45295	12.49457	14.00331	13.69533	0	15.35573	0	14.41323	13.20637	11.11749	0	14.72693	13.7894	0	0	17.70306	0	14.15953	0	14.49825	12.44086	14.42603	0	13.56391	0	0	14.8389	14.43299	7.734524	0	12.20731	0	0	0	0	13.38978	13.93487	15.38601
A0A669EE96	A0A669EE96_ORENI		ATP metabolic process [GO:0046034]; proton transmembrane transport [GO:1902600]	Vacuolar proton pump subunit B (V-ATPase subunit B) (Vacuolar proton pump subunit B)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"proton-transporting V-type ATPase, V1 domain [GO:0033180]"	"proton-transporting V-type ATPase, V1 domain [GO:0033180]; ATP binding [GO:0005524]; ATP metabolic process [GO:0046034]; proton transmembrane transport [GO:1902600]"	ATP binding [GO:0005524]	AVGNSR	12.60999966	603.3551577	14.13905	14.89719	13.63738	14.6015	13.75046	12.26669	16.39252	15.11313	14.47584	17.40142	15.61416	14.17908	13.78024	0	13.77294	15.93843	15.0729	16.19133	16.15277	15.12208	15.7421	17.79338	16.16432	16.3571	14.12735	14.7237	14.74548	18.20219	19.4876	18.97916	0	18.72999	15.2531	14.94603	12.16921	15.19248	14.87545	15.71038	14.50027	17.59776	12.79438	0	14.88476	13.99456	14.38462	15.75371	16.49647	13.38769	12.35573	14.69767	15.63226	14.83439	16.06942	14.92002
A0A669EQ00	A0A669EQ00_ORENI	vars2	valyl-tRNA aminoacylation [GO:0006438]	Valyl-tRNA synthetase (EC 6.1.1.9)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		aminoacyl-tRNA editing activity [GO:0002161]; ATP binding [GO:0005524]; valine-tRNA ligase activity [GO:0004832]; valyl-tRNA aminoacylation [GO:0006438]	aminoacyl-tRNA editing activity [GO:0002161]; ATP binding [GO:0005524]; valine-tRNA ligase activity [GO:0004832]	GDEIYHQLR	14.21000004	1130.76554	0	0	12.82885	17.00322	13.00895	0	13.06107	14.68536	0	14.59369	0	14.82832	0	0	12.98318	0	0	12.87265	0	11.68556	16.31958	0	0	13.94485	16.62514	0	16.55267	0	0	13.54747	14.33818	13.29263	11.42754	0	0	11.12722	0	13.10087	13.95129	14.03939	0	14.24692	16.14406	11.43795	0	12.04181	14.11845	12.33953	14.59826	10.91132	0	0	10.35276	0
A0A669DJQ4	A0A669DJQ4_ORENI	vangl2	multicellular organism development [GO:0007275]	Vang-like protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; multicellular organism development [GO:0007275]		EAAQAIFAPMAR	13.44999981	1276.39931	0	14.90722	12.51395	16.5768	14.75068	15.01479	0	0	16.37659	16.30967	0	15.50234	16.68138	0	0	0	0	0	16.92859	15.74251	0	0	15.14464	15.69737	0	0	0	0	0	0	0	0	0	15.8557	14.82715	0	15.72784	15.83022	16.14636	15.69609	0	0	0	0	0	17.42134	0	0	0	0	0	0	0	0
A0A669BY22	A0A669BY22_ORENI	flt4	angiogenesis [GO:0001525]; vascular endothelial growth factor receptor signaling pathway [GO:0048010]	Vascular endothelial growth factor receptor 3 (EC 2.7.10.1)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of plasma membrane [GO:0005887]; nucleus [GO:0005634]	integral component of plasma membrane [GO:0005887]; nucleus [GO:0005634]; ATP binding [GO:0005524]; vascular endothelial growth factor-activated receptor activity [GO:0005021]; angiogenesis [GO:0001525]; vascular endothelial growth factor receptor signaling pathway [GO:0048010]	ATP binding [GO:0005524]; vascular endothelial growth factor-activated receptor activity [GO:0005021]	LGKVLGHGAFGK	6.139999866	1182.684206	12.06478	8.746676	7.668186	10.32233	6.997115	11.38294	9.80017	14.38259	0	11.73771	12.35842	12.92207	11.52519	13.72296	14.69984	0	12.9512	0	18.01185	11.18342	11.45085	13.98146	12.75096	14.06864	17.03612	15.49653	11.48858	10.28292	14.37403	15.01303	0	14.9684	10.66782	15.59227	14.12098	0	12.59307	13.94557	14.1326	10.87478	14.29341	13.26021	15.29808	0	0	7.875439	0	13.76816	0	18.54012	0	0	0	10.76708
A0A669C162	A0A669C162_ORENI		intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	Vesicle transport through interaction with t-SNAREs 1A	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]		ILTGMLR	4.760000229	803.5423234	12.64748	0	14.39756	14.11212	12.5852	13.79286	11.04604	13.10507	0	14.48692	14.45754	15.33814	0	12.57292	14.15568	11.99459	11.78642	14.21293	0	0	12.54295	11.51791	0	11.69816	0	13.91087	13.16629	13.4636	10.77387	0	0	0	11.97202	0	14.0617	12.97776	14.41344	0	0	13.61796	0	10.96436	11.11395	0	14.21206	12.42697	14.32401	0	14.80632	14.22335	0	13.6571	0	14.80647
A0A669EJZ2	A0A669EJZ2_ORENI	SPATA5		Vesicle-fusing ATPase (EC 3.6.4.6)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; ATPase activity [GO:0016887]	ATPase activity [GO:0016887]; ATP binding [GO:0005524]	SCRSTLAQLSLNSMK	1.940000057	1711.430859	16.05312	0	0	0	0	0	14.98951	0	13.35425	11.5488	0	15.56136	12.69783	13.39442	0	12.92706	13.74997	0	0	0	0	0	0	0	0	0	0	0	18.13488	0	0	0	0	14.3932	0	14.3372	14.91065	0	0	15.16789	0	0	15.44501	0	14.64665	0	0	0	0	13.91672	0	0	0	0
G8XRL1	G8XRL1_ORENI	Vtg1		Vitellogenin (Fragment)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		lipid transporter activity [GO:0005319]	lipid transporter activity [GO:0005319]	SIVPIAQEYGVNYAK	62.29000092	1653.237106	15.76381	15.80139	15.41894	15.45615	15.67596	0	0	16.92049	17.68009	0	15.34092	14.3008	10.21961	14.11804	0	15.9007	14.21419	14.85399	0	16.4761	13.68912	0	16.13853	0	14.50721	0	16.73604	0	0	0	0	16.49795	15.66717	0	16.65258	0	17.12612	0	0	0	0	0	0	0	16.8304	0	0	0	0	0	0	21.24076	0	0
A0A669F627	A0A669F627_ORENI	LOC102079941		Vitellogenin domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		lipid transporter activity [GO:0005319]	lipid transporter activity [GO:0005319]	DSDLLTSLK	6.940000057	992.7780096	13.00215	0	11.7327	15.26566	0	14.56094	15.89109	15.90596	14.47751	16.08618	0	0	0	15.18067	15.19783	15.52098	15.77324	16.24513	0	15.82328	14.88984	15.59239	14.22465	15.31578	12.57068	15.52042	12.01709	14.86487	16.15545	12.59144	15.93966	14.0448	16.40939	16.47593	15.91093	14.73485	15.92668	0	0	15.39029	0	15.77522	17.29049	15.63814	16.24764	16.0167	15.90698	16.05038	15.3149	16.28837	16.77911	0	15.55716	15.28348
A0A669F6Q5	A0A669F6Q5_ORENI	CACNA1D	regulation of ion transmembrane transport [GO:0034765]	Voltage-dependent L-type calcium channel subunit alpha	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel complex [GO:0005891]; metal ion binding [GO:0046872]; voltage-gated calcium channel activity [GO:0005245]; regulation of ion transmembrane transport [GO:0034765]	metal ion binding [GO:0046872]; voltage-gated calcium channel activity [GO:0005245]	GDFQKLR	1.980000019	863.7235239	13.90606	0	14.97584	14.68017	0	11.95518	12.45353	0	0	15.36574	17.25501	13.0923	0	15.17757	0	13.88446	13.18852	13.6755	0	0	0	0	0	0	0	0	0	0	12.11385	0	0	13.77563	0	15.37919	10.28192	0	0	14.86382	13.53024	0	0	0	0	0	0	12.6239	0	14.97596	10.81339	0	0	0	0	0
A0A669D3L7	A0A669D3L7_ORENI		regulation of ion transmembrane transport [GO:0034765]	Voltage-dependent N-type calcium channel subunit alpha	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel complex [GO:0005891]; metal ion binding [GO:0046872]; voltage-gated calcium channel activity [GO:0005245]; regulation of ion transmembrane transport [GO:0034765]	metal ion binding [GO:0046872]; voltage-gated calcium channel activity [GO:0005245]	DYDLERPSQAQAHHHHHHHR	4.070000172	2509.002847	0	0	16.42352	0	12.52215	12.93634	11.09064	17.57523	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.99312	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669DTZ6	A0A669DTZ6_ORENI		calcium ion import [GO:0070509]; regulation of ion transmembrane transport [GO:0034765]	Voltage-dependent T-type calcium channel subunit alpha	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel complex [GO:0005891]; low voltage-gated calcium channel activity [GO:0008332]; calcium ion import [GO:0070509]; regulation of ion transmembrane transport [GO:0034765]	low voltage-gated calcium channel activity [GO:0008332]	AEQLGPGALR	1.049999952	1011.028902	16.05493	13.21389	12.19814	0	13.21482	14.67423	13.9354	13.03296	18.35233	17.76825	10.54804	13.35082	15.50122	15.90548	17.71661	0	14.59905	14.60128	10.66203	13.05131	14.89308	15.63776	13.13623	13.66518	14.73624	17.29458	12.76672	17.45288	0	13.80117	15.21682	15.84729	0	14.24791	14.69056	17.13317	13.14268	0	16.37077	13.08985	15.24873	12.91568	18.84438	14.3184	17.94159	13.61092	0	15.78757	14.56502	14.94701	17.17765	16.02851	14.35199	14.21946
A0A669CNJ8	A0A669CNJ8_ORENI	vdac1	apoptotic process [GO:0006915]	Voltage-dependent anion-selective channel protein 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane raft [GO:0045121]; mitochondrial outer membrane [GO:0005741]; plasma membrane [GO:0005886]; pore complex [GO:0046930]	membrane raft [GO:0045121]; mitochondrial outer membrane [GO:0005741]; plasma membrane [GO:0005886]; pore complex [GO:0046930]; porin activity [GO:0015288]; voltage-gated anion channel activity [GO:0008308]; apoptotic process [GO:0006915]	porin activity [GO:0015288]; voltage-gated anion channel activity [GO:0008308]	IMAVPPTYADLGK	13.65999985	1374.104236	0	0	13.32222	0	14.97439	13.51392	15.55515	15.55799	15.38518	15.85055	0	17.18183	14.06883	0	12.78658	0	0	0	14.60151	0	0	0	0	0	19.41008	0	0	0	0	16.17919	0	0	0	0	0	0	0	0	0	0	15.23298	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669AZ18	A0A669AZ18_ORENI	vdac2		Voltage-dependent anion-selective channel protein 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial outer membrane [GO:0005741]; pore complex [GO:0046930]	mitochondrial outer membrane [GO:0005741]; pore complex [GO:0046930]; porin activity [GO:0015288]; voltage-gated anion channel activity [GO:0008308]	porin activity [GO:0015288]; voltage-gated anion channel activity [GO:0008308]	GYGFGQVK	3.779999971	856.2407965	13.25856	0	12.15084	14.43429	14.94941	0	15.07939	15.12349	15.27011	15.38962	14.28007	0	0	0	13.77176	0	0	14.00835	15.04689	13.83318	13.62351	14.60818	0	13.78203	0	13.48277	13.0977	14.73454	14.75008	0	0	0	16.45718	11.33695	0	11.95195	11.59292	0	0	0	13.75656	0	13.35772	13.85318	0	0	0	14.66935	15.37468	12.17441	0	0	15.56509	15.07578
A0A669BXU4	A0A669BXU4_ORENI	LOC100698339	regulation of cilium assembly [GO:1902017]	Voltage-dependent anion-selective channel protein 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	mitochondrial outer membrane [GO:0005741]; pore complex [GO:0046930]	mitochondrial outer membrane [GO:0005741]; pore complex [GO:0046930]; nucleotide binding [GO:0000166]; porin activity [GO:0015288]; voltage-gated anion channel activity [GO:0008308]; regulation of cilium assembly [GO:1902017]	nucleotide binding [GO:0000166]; porin activity [GO:0015288]; voltage-gated anion channel activity [GO:0008308]	GHGTMAVPPGYSDLGK	1.350000024	1588.112987	15.76405	12.45354	0	12.30574	11.69716	17.82661	15.02766	0	15.98187	13.85654	0	13.55198	0	0	0	0	0	0	13.5115	0	0	0	0	0	8.314996	0	0	0	15.57938	0	0	0	15.38828	0	0	0	0	0	0	0	0	15.31993	14.82726	0	0	14.14602	15.85018	0	0	0	14.59887	0	0	0
I3JVQ8	I3JVQ8_ORENI	wfdc1		WAP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular region [GO:0005576]	extracellular region [GO:0005576]; peptidase inhibitor activity [GO:0030414]	peptidase inhibitor activity [GO:0030414]	HHHKHLG	5.179999828	865.4185952	14.16003	14.79755	14.56516	14.49289	15.33786	0	0	13.31981	0	0	13.96914	14.31769	15.10147	14.4771	0	12.99331	14.52149	14.13954	13.29513	14.24025	0	14.9917	0	14.60649	14.72907	13.28755	14.93019	13.03317	0	12.77162	18.41331	17.83321	0	14.99144	14.49537	14.63551	0	15.02367	13.89564	0	14.96794	0	15.06962	14.70833	14.08347	0	15.03032	15.73509	0	13.79234	0	0	0	0
A0A669CKI9	A0A669CKI9_ORENI	LOC100712474		WAPL domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				IFSAQKK	12.53999996	819.5263258	0	14.72834	17.42259	0	0	0	0	0	17.11478	0	17.55075	0	0	0	16.39699	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3JWB0	I3JWB0_ORENI			WASH complex subunit 4	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	WASH complex [GO:0071203]	WASH complex [GO:0071203]		MLVAVFAPEFR	2.029999971	1280.757038	7.007264	11.51992	11.57911	10.86887	8.603458	12.62999	12.66442	10.08127	9.808505	13.06087	17.15486	0	9.105242	0	11.05261	0	11.30029	11.47854	0	12.04463	12.53737	0	0	14.53989	14.72623	13.52174	0	0	0	14.11627	0	12.92058	13.10662	0	0	0	0	0	13.22622	13.24273	0	0	0	0	0	0	10.71935	0	0	0	0	0	0	0
I3KI64	I3KI64_ORENI			WD repeat domain 26a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MEANGGGQDR	2.099999905	1051.676598	13.01939	13.51446	13.66774	12.31668	14.32498	12.61216	11.3079	14.27705	14.54066	13.94865	0	15.63552	14.80888	16.25635	17.8128	0	13.68624	17.23243	0	10.89611	0	0	0	0	0	0	0	15.52701	0	0	0	0	0	0	0	0	0	0	13.52639	16.88073	16.37292	0	0	0	0	0	0	0	0	0	0	0	0	0
I3KMJ1	I3KMJ1_ORENI	WDR37		WD repeat domain 37	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ASHSTSQLSQK	3.529999971	1173.490371	0	16.6088	13.7313	0	13.60251	16.54232	13.44796	14.89776	13.02663	0	13.08322	0	10.67619	12.22144	14.45989	0	0	0	14.08422	14.26565	15.48142	13.03417	15.41654	0	0	15.84848	0	13.56652	0	0	0	14.63014	15.40509	0	0	0	14.34746	0	13.14256	0	0	0	0	0	13.50738	13.39152	0	0	0	11.60522	17.53033	0	0	0
A0A669D330	A0A669D330_ORENI	WDR7		WD repeat domain 7	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LLIQGDSAGRMSLWK	12.76000023	1690.372717	17.9073	0	17.26004	16.68083	14.87294	17.44067	17.60242	17.69434	18.05268	17.46624	16.32824	16.89769	18.08739	0	0	17.64385	18.019	18.12447	18.30271	0	0	0	0	0	0	0	0	19.05994	19.19225	0	17.2779	0	0	17.71617	0	0	0	0	0	0	0	0	0	0	16.60824	19.3068	19.78204	0	19.67182	0	0	18.34982	18.45928	0
A0A669ETL9	A0A669ETL9_ORENI	wdr35	intraciliary retrograde transport [GO:0035721]	WD repeat-containing protein 35	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	ciliary basal body [GO:0036064]; cytoplasm [GO:0005737]; intraciliary transport particle A [GO:0030991]	ciliary basal body [GO:0036064]; cytoplasm [GO:0005737]; intraciliary transport particle A [GO:0030991]; intraciliary retrograde transport [GO:0035721]		VYHIDSTPSGASDTSPDFTKAFTVR	10.17000008	2700.162455	12.38619	10.04408	11.03158	0	0	6.646295	0	0	0	11.90839	12.49495	10.27627	0	9.200027	15.36884	0	11.23896	0	0	9.640593	0	9.574244	0	12.07748	11.06985	0	13.13541	0	0	0	0	0	0	0	12.30521	12.26308	0	11.49651	0	0	0	10.68831	11.53787	9.975734	13.51892	0	0	0	9.972904	0	0	0	8.39066	0
A0A669BXJ4	A0A669BXJ4_ORENI	wdr76	cellular response to DNA damage stimulus [GO:0006974]	WD repeat-containing protein 76	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		cellular response to DNA damage stimulus [GO:0006974]		MSALMSLSKLLTR	2.140000105	1482.792075	14.99402	0	0	12.65016	13.56478	12.23514	0	15.55947	0	14.48955	15.48681	14.24092	11.81709	12.16206	12.41751	15.6207	13.47684	14.00722	15.92624	0	0	16.49407	11.44149	0	0	12.36415	0	0	14.39356	14.98246	21.35916	21.18173	0	0	0	0	14.84113	13.61684	12.92124	15.41757	0	14.2672	0	14.7828	0	13.48045	13.50616	0	0	0	13.61146	0	14.01467	13.11978
A0A669EK62	A0A669EK62_ORENI	homer3		WH1 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]; postsynaptic density [GO:0014069]	cytoplasm [GO:0005737]; postsynaptic density [GO:0014069]; G protein-coupled glutamate receptor binding [GO:0035256]	G protein-coupled glutamate receptor binding [GO:0035256]	MYPLHR	8.680000305	816.7973227	14.74423	15.34347	13.07789	14.97039	15.5601	0	16.84441	16.03241	14.91464	14.16414	15.7877	15.29731	15.28159	13.04564	14.96976	16.5525	15.51516	15.60229	16.78365	10.03174	15.76564	16.81379	16.21638	0	0	16.75686	0	15.92148	16.82136	17.5451	17.80784	15.64251	16.14958	14.00171	16.02818	16.40921	17.01071	14.1059	15.91836	15.99401	14.9001	15.37376	16.03999	0	0	17.41454	16.25806	16.271	16.16349	16.44469	16.37889	17.12402	15.74489	18.45026
A0A669CC73	A0A669CC73_ORENI	LOC100696870		WH2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		actin binding [GO:0003779]	actin binding [GO:0003779]	EAPPPPPYR	8.170000076	1024.705523	13.74725	15.8147	11.92926	14.16004	0	10.25025	12.82165	12.46625	14.44974	0	13.92163	13.1635	17.80749	17.70248	10.13822	14.92259	13.49489	13.46616	14.44765	13.9468	13.53283	0	14.33076	19.06101	14.94489	14.72189	15.07953	0	12.66874	0	0	16.23792	15.19665	14.05041	13.06469	0	12.60015	14.51663	13.82221	12.28788	14.4888	12.67948	17.54583	12.83206	14.93866	12.94828	10.70944	15.8064	11.99952	14.88569	11.29984	13.88104	0	13.45517
A0A669D940	A0A669D940_ORENI	ppp4r1		WRNPLPNID domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				WISYKLVVEILQK	11.34000015	1618.550082	0	0	0	0	0	0	0	0	0	0	18.89646	0	0	0	0	0	0	0	17.14931	0	0	0	0	0	18.29479	0	0	0	0	17.85916	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.60184	17.51609	0	0	18.24526	0	0
A0A669CSW0	A0A669CSW0_ORENI	wwox	apoptotic process [GO:0006915]; Wnt signaling pathway [GO:0016055]	WW domain-containing oxidoreductase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	cytoplasm [GO:0005737]	cytoplasm [GO:0005737]; oxidoreductase activity [GO:0016491]; apoptotic process [GO:0006915]; Wnt signaling pathway [GO:0016055]	oxidoreductase activity [GO:0016491]	EFAESFKAMK	2.75999999	1204.574537	12.396	13.33338	13.95218	10.7287	0	0	11.90139	12.3799	9.983948	0	10.63976	13.43125	8.682714	11.1507	0	0	12.29733	12.1871	12.31607	8.747261	0	0	0	0	0	12.98259	0	0	13.39874	13.45872	13.54463	0	0	0	14.124	0	13.56363	0	10.44074	0	13.5132	0	10.8031	0	0	0	15.09814	0	0	0	0	12.88223	0	13.83522
I3KQV7	I3KQV7_ORENI	LOC100696120	chromatin organization [GO:0006325]	WW domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		chromatin organization [GO:0006325]		NQNSYMV	7.989999771	872.3049445	18.38088	0	18.03433	19.41345	18.65956	15.82834	0	15.15899	16.83557	0	17.93165	18.61344	0	17.40222	0	19.22189	16.98454	18.75778	0	18.32966	0	0	19.01942	0	13.97268	18.62617	0	0	14.42653	12.82958	0	22.13854	15.42898	16.62391	0	17.20354	0	0	0	18.26534	15.64223	16.70061	18.04397	17.46145	17.56438	0	0	19.08442	0	0	0	0	0	0
I3JZX3	I3JZX3_ORENI			Wu:fc23c09	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				RGDGLTSQIETEMEENTER	3.349999905	2196.049371	12.02452	12.9932	13.03843	11.76774	11.66897	13.44077	13.12422	0	11.00617	10.6707	0	13.13002	11.49888	14.6114	14.17805	0	13.39566	13.65069	0	13.98218	0	0	0	13.39628	10.41734	11.92031	13.60178	13.44108	11.60971	15.43999	0	18.3832	0	15.27029	0	14.37567	0	0	14.2944	0	13.79861	0	0	0	0	9.536387	0	11.04145	0	15.49967	0	0	0	13.02213
A0A669CZT8	A0A669CZT8_ORENI			"X-prolyl aminopeptidase 3, mitochondrial"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		manganese ion binding [GO:0030145]; metalloaminopeptidase activity [GO:0070006]	manganese ion binding [GO:0030145]; metalloaminopeptidase activity [GO:0070006]	ITAQAFRR	20.64999962	961.6427306	12.97505	13.58182	14.93687	9.954148	0	14.46405	13.94255	14.70765	12.19331	13.8582	14.17676	16.01529	15.12263	11.61286	13.25288	14.08246	13.55595	16.1664	11.36209	13.07757	10.84171	14.23249	15.48099	11.37582	14.60172	14.43876	14.24416	0	12.82744	14.29268	0	14.39884	14.1312	15.22606	14.25641	17.41014	0	11.56773	14.00652	12.17953	14.5075	15.62706	13.71678	14.69588	10.88806	16.20529	13.88271	14.73234	16.93879	15.32813	15.40815	13.89003	14.22674	13.5947
A0A669B5N3	A0A669B5N3_ORENI	XKR4		XK-related protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]		LQAVQGMTAAASLVSMAWALASYQKALR	2.630000114	2953.028618	0	12.24945	0	12.00742	13.13349	11.48094	11.96744	14.72566	12.098	13.49366	14.02465	13.1126	13.03965	0	0	0	0	15.08242	14.98767	12.55631	7.744911	13.35948	0	10.70247	0	14.97511	5.149171	15.05841	0	0	13.18823	0	0	14.11799	13.95805	0	0	0	0	0	0	13.95376	14.01374	0	14.06654	0	0	0	13.85695	0	0	14.64609	0	0
I3K3W7	I3K3W7_ORENI			XPG_I_2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TEPNAVPK	8.149999619	856.1255189	15.88789	16.2491	15.17359	0	13.94791	14.98698	15.46656	15.2379	16.48985	15.49291	0	14.93251	0	14.38225	15.5342	16.77674	18.5371	16.47994	15.78377	16.25306	16.87632	17.29062	14.99746	0	0	15.98339	0	0	0	0	16.35638	16.20425	15.5861	15.61486	15.6986	16.10871	0	0	0	16.43197	15.16969	15.09688	15.73505	16.25493	14.91652	15.04276	15.0174	17.28875	0	15.76592	0	0	15.01699	15.97656
I3JR46	I3JR46_ORENI	xdh		Xanthine dehydrogenase (EC 1.17.1.4) (EC 1.17.3.2) (Xanthine dehydrogenase/oxidase) (Xanthine oxidase) (Xanthine oxidoreductase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	peroxisome [GO:0005777]	"peroxisome [GO:0005777]; 2 iron, 2 sulfur cluster binding [GO:0051537]; electron transfer activity [GO:0009055]; FAD binding [GO:0071949]; iron ion binding [GO:0005506]; molybdenum ion binding [GO:0030151]; molybdopterin cofactor binding [GO:0043546]; xanthine dehydrogenase activity [GO:0004854]; xanthine oxidase activity [GO:0004855]"	"2 iron, 2 sulfur cluster binding [GO:0051537]; electron transfer activity [GO:0009055]; FAD binding [GO:0071949]; iron ion binding [GO:0005506]; molybdenum ion binding [GO:0030151]; molybdopterin cofactor binding [GO:0043546]; xanthine dehydrogenase activity [GO:0004854]; xanthine oxidase activity [GO:0004855]"	GPGSYK	1.269999981	608.2891387	19.01741	18.63573	19.44563	19.09038	19.7247	19.03504	19.35069	15.24206	19.91589	19.75923	17.96139	16.29187	18.6371	18.87654	0	16.81591	16.03653	0	19.92443	16.07736	16.74835	19.72689	0	19.91162	16.46253	20.21201	15.69907	19.39318	19.62067	19.72799	0	0	16.37759	16.64325	15.63992	19.99698	19.43459	19.27665	19.5816	15.64737	19.77331	0	20.02951	0	18.56013	16.30192	0	15.30129	18.44276	17.35099	0	0	17.7398	14.53531
I3KL94	I3KL94_ORENI	xylb	D-xylose metabolic process [GO:0042732]; xylulose metabolic process [GO:0005997]	Xylulose kinase (EC 2.7.1.17)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; xylulokinase activity [GO:0004856]; D-xylose metabolic process [GO:0042732]; xylulose metabolic process [GO:0005997]	ATP binding [GO:0005524]; xylulokinase activity [GO:0004856]	VLATGGASSNK	1.070000052	1003.451936	0	14.15949	0	0	0	15.64402	16.35958	0	15.59696	0	14.27275	0	0	14.16271	0	0	0	14.71511	15.95577	14.31197	15.4046	15.3803	15.70388	0	11.0218	0	15.0085	14.6496	16.26099	13.67143	0	0	0	0	15.44862	0	0	13.55794	0	14.74749	14.98105	16.27481	0	17.08322	0	0	0	10.83848	0	0	0	0	15.81271	16.94283
I3JIH0	I3JIH0_ORENI	FBXO43	cell division [GO:0051301]; protein ubiquitination [GO:0016567]	ZBR-type domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; cell division [GO:0051301]; protein ubiquitination [GO:0016567]	metal ion binding [GO:0046872]	LSTLKEGGSQSEEDPMDR	10.31999969	1995.32697	13.28688	12.98627	0	13.75038	0	13.3954	15.00785	9.070185	12.12639	0	0	0	0	11.2786	0	16.53219	0	14.89667	0	0	14.33383	0	0	0	15.9132	16.27061	0	13.85026	14.37986	0	12.94665	14.51059	0	12.0513	15.4333	15.22656	0	0	0	12.09318	0	0	0	0	16.42328	15.91689	0	14.40532	15.26894	14.17111	0	0	14.42439	0
A0A669F652	A0A669F652_ORENI	LOC102082800		ZP domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ILLASAPAAPVTGGAETGRDK	9.859999657	1995.234682	17.59584	17.69323	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18.69082	0	0
I3KYR7	I3KYR7_ORENI			Zgc:112001	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SFSLLFYRAVR	24	1354.10201	16.36493	16.2835	16.58121	15.49754	15.27957	16.92214	0	16.4825	16.50897	16.5409	0	17.02353	16.68947	16.77212	13.04071	15.85526	15.9801	13.56262	15.61316	16.23266	0	16.41879	15.14442	14.95808	0	15.55381	0	14.40204	16.25361	16.70326	18.00989	18.96674	18.35428	0	0	15.81886	16.93719	14.33472	15.46308	0	16.67591	16.2586	16.68823	16.26156	15.43137	16.79226	16.07697	15.50222	15.81315	16.15445	16.86526	15.6362	15.82916	0
I3IZ53	I3IZ53_ORENI			Zgc:113232	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GREGPK	7.019999981	643.6854693	13.96533	14.52663	15.32109	0	0	0	0	0	16.15153	15.97976	16.49252	14.79351	0	0	15.43437	17.62119	0	16.80633	0	16.81461	0	10.85546	17.85123	18.20725	0	0	0	16.56542	14.8889	16.16288	15.98394	0	0	0	0	0	0	15.78586	0	15.79189	0	0	16.44351	0	0	0	0	0	17.70325	16.15342	0	0	0	0
I3JKV5	I3JKV5_ORENI		protein folding [GO:0006457]	Zgc:122979	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		unfolded protein binding [GO:0051082]; protein folding [GO:0006457]	unfolded protein binding [GO:0051082]	LRGEGLPLPK	2.079999924	1078.931079	13.4599	0	10.43443	12.24819	13.20031	0	9.739459	13.71516	14.89865	0	13.30741	14.40633	12.43043	11.83954	0	0	12.28887	13.80638	13.0867	16.67056	0	0	19.19353	11.62423	15.3901	0	0	15.69679	0	13.73961	12.47502	11.96794	0	0	0	8.380548	11.53992	10.3617	11.85607	0	14.25984	13.86333	0	12.99542	15.38263	14.07678	14.8586	13.31723	0	10.86808	0	0	0	14.35524
A0A669B747	A0A669B747_ORENI			Zgc:136892	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	bicellular tight junction [GO:0005923]; integral component of membrane [GO:0016021]	bicellular tight junction [GO:0005923]; integral component of membrane [GO:0016021]; structural molecule activity [GO:0005198]	structural molecule activity [GO:0005198]	AHDTEK	11.76000023	700.503115	18.53444	17.0903	0	16.89477	15.15982	14.26206	15.748	0	0	17.04265	16.72925	18.44134	16.60225	16.19624	14.59786	17.36443	17.42663	16.75579	17.54136	17.74116	14.97095	16.56251	17.22953	18.86212	17.10971	14.81463	17.27908	15.41966	14.23635	15.90077	17.02203	18.2722	0	16.94774	0	19.00548	15.23786	0	16.87178	16.79395	15.62883	16.78736	16.37535	18.56478	15.95535	15.65189	0	17.5063	17.56091	15.99676	17.24726	0	0	17.38073
A0A669D0L8	A0A669D0L8_ORENI		cell adhesion [GO:0007155]	Zgc:152904	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; cell adhesion [GO:0007155]		MALHTEASR	2.450000048	1028.222925	14.5393	10.96329	15.40352	13.45984	15.18311	14.0158	11.31777	14.1637	15.01163	10.47814	0	12.47654	0	0	14.85038	11.34986	14.09524	0	14.40111	13.80637	12.35925	0	0	11.10159	0	0	0	0	14.15949	0	13.8502	16.19593	14.5751	12.05993	0	12.32726	0	0	0	0	15.99057	0	13.90582	13.66378	0	0	0	0	0	0	0	0	13.87535	14.29986
A0A669D2X3	A0A669D2X3_ORENI			Zgc:153901	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		folic acid binding [GO:0005542]; transferase activity [GO:0016740]	folic acid binding [GO:0005542]; transferase activity [GO:0016740]	ADVGPQPQK	5.550000191	940.4244763	0	0	0	0	13.77933	13.65314	14.31298	17.24473	15.10394	0	0	12.46418	13.58403	13.79473	0	14.80744	0	0	0	15.23231	12.1969	0	13.28533	0	0	12.61973	0	10.8564	0	15.39991	15.09127	14.16817	12.34453	13.24317	14.39809	0	12.3069	15.72612	14.74877	14.19647	0	14.62226	0	0	0	0	13.09548	14.8628	15.75619	0	14.22615	14.56382	11.23975	16.08912
I3JLK3	I3JLK3_ORENI			Zgc:154093	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	endomembrane system [GO:0012505]	endomembrane system [GO:0012505]		MPAKTPMYLK	2.319999933	1180.260181	11.32517	12.10454	15.19501	8.731553	11.21528	12.21283	10.98745	0	6.788628	10.82003	0	8.973788	10.98898	0	11.94823	13.98266	13.55415	12.8174	0	14.28481	0	17.05648	0	0	0	14.54592	13.47396	11.8797	0	15.16866	0	0	12.94371	12.23789	0	12.81514	0	0	0	0	13.8569	0	11.97627	0	0	0	0	0	0	0	12.84126	0	0	10.08704
I3JFV9	I3JFV9_ORENI			Zgc:162608	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LAMESERLR	10.53999996	1119.683052	17.16442	15.09598	0	0	0	15.11535	17.40382	15.22058	16.16225	15.7171	0	16.82941	18.23124	15.84155	15.5264	17.78987	17.69088	16.05635	15.7429	16.16569	17.2197	18.17932	17.99611	12.88626	15.92965	17.14716	0	0	16.5917	18.01419	17.46024	17.46001	18.49729	0	16.1761	0	17.10353	16.36351	0	17.08485	15.70611	16.76247	15.79875	15.10761	17.4581	19.47074	19.58076	20.6576	17.30344	18.19715	17.49569	17.42757	17.36786	16.19018
A0A669ED30	A0A669ED30_ORENI			Zgc:162612	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	GPASVKPPYSYIALITMAILQSPK	3.440000057	2560.355822	0	13.40991	13.59451	0	14.87289	14.51703	0	13.28828	14.09993	15.95091	0	12.90521	12.89229	0	14.76799	0	0	12.47616	0	0	0	0	13.2043	15.48639	0	13.18783	12.62752	14.1354	13.68079	0	0	11.18713	13.62186	12.96528	0	14.02704	0	0	12.09017	12.81036	13.68803	13.56764	0	13.0261	10.08282	9.867597	13.16552	14.50612	15.22543	13.26968	0	12.8088	0	14.67397
A0A669EH17	A0A669EH17_ORENI		RNA processing [GO:0006396]	Zgc:163098	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]; RNA processing [GO:0006396]	RNA binding [GO:0003723]	SPHLIPK	14.47999954	791.7102431	0	13.83825	16.52911	0	0	15.53977	16.20328	12.21217	0	14.65121	0	0	12.4276	15.25536	15.11444	0	0	0	0	0	0	0	0	0	14.30455	0	0	0	0	0	0	0	0	12.45833	0	0	0	0	16.0017	0	0	0	14.32542	0	0	0	0	14.63085	0	13.94323	0	0	0	0
I3IU49	I3IU49_ORENI			Zgc:172323	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	intermediate filament [GO:0005882]	intermediate filament [GO:0005882]		RASTGCFSSR	8	1127.954644	0	0	13.36008	18.08749	0	13.29978	14.87179	0	13.53932	0	0	15.1277	0	19.34392	11.41567	0	0	14.33002	0	17.67663	0	0	18.25938	14.92617	15.10964	17.80845	14.26928	16.33291	0	14.87915	0	0	0	15.65097	15.90523	0	0	0	0	0	0	13.78723	16.0084	14.07556	12.98851	0	0	0	0	0	0	14.04055	0	14.50594
A0A669BS40	A0A669BS40_ORENI		D-amino acid metabolic process [GO:0046416]	Zgc:172341	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	peroxisome [GO:0005777]	peroxisome [GO:0005777]; D-amino-acid oxidase activity [GO:0003884]; FAD binding [GO:0071949]; D-amino acid metabolic process [GO:0046416]	D-amino-acid oxidase activity [GO:0003884]; FAD binding [GO:0071949]	ILVGDTQVYPVR	1.820000052	1360.639515	0	0	14.86963	0	15.23224	0	13.52645	11.96104	0	14.50348	0	0	0	0	0	13.66983	0	15.30347	0	14.31193	0	0	0	0	0	0	14.32088	0	0	14.8312	22.44316	23.25635	20.81401	0	0	0	0	0	0	0	0	0	15.38122	15.16719	0	0	0	0	0	0	0	14.68246	0	15.20478
I3J6U5	I3J6U5_ORENI			Zgc:194275	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ALRSEVK	3.390000105	802.8486129	14.84861	13.31968	13.92691	12.94967	12.30349	0	12.92994	15.15532	14.53846	16.33217	14.96473	0	13.63131	14.32463	14.02465	14.29424	11.65416	12.86802	13.70825	14.30891	12.4193	11.85333	14.00846	14.8883	12.62374	14.18667	0	0	15.42434	14.94446	15.63041	16.33251	16.68783	16.72172	0	14.30999	14.9308	13.41978	14.8182	12.77136	13.97497	14.16955	0	9.281464	13.58491	15.97027	16.06866	15.77881	16.73023	16.43406	14.31424	13.15057	14.47837	14.47277
I3JWX9	I3JWX9_ORENI			Zgc:77112	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LCLNQRK	8.010000229	927.5149807	14.25746	14.98869	14.2369	14.4648	11.44759	11.92919	16.24323	13.83633	0	15.76867	15.75675	17.08103	0	14.22641	16.60452	14.93922	15.58217	16.27205	13.32962	17.57114	17.11287	18.57965	16.52681	17.42871	0	16.92996	17.4505	14.15114	0	16.51964	17.05313	0	17.1474	0	16.1766	0	14.84909	0	17.04752	17.14853	15.94675	14.68098	15.66318	15.44765	15.66613	15.49696	15.50364	15.79514	20.05863	19.75985	18.0272	16.1441	0	16.07603
A0A669D352	A0A669D352_ORENI		Arp2/3 complex-mediated actin nucleation [GO:0034314]	Zgc:86896	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Arp2/3 protein complex [GO:0005885]	Arp2/3 protein complex [GO:0005885]; actin binding [GO:0003779]; Arp2/3 complex-mediated actin nucleation [GO:0034314]	actin binding [GO:0003779]	NGKDWVK	14.69999981	846.0796604	0	15.1383	14.95311	15.81934	17.83816	0	0	0	15.4299	19.1918	0	18.12521	15.03103	0	0	11.95599	0	0	0	13.27511	13.79711	0	0	12.84516	12.48491	14.85671	0	0	0	0	16.10824	16.41398	16.88534	15.28177	16.77613	19.17245	0	15.73369	15.77116	19.0949	0	15.02433	0	19.58647	15.59869	13.62979	0	12.78236	13.51766	0	0	19.09949	13.18436	16.16723
A0A669CFY4	A0A669CFY4_ORENI	ZFC3H1	RNA processing [GO:0006396]	Zinc finger C3H1-type containing	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA processing [GO:0006396]		AHLIAR	17.93000031	680.884396	16.62938	15.59849	16.06299	0	0	0	15.98133	15.9695	0	0	0	15.0747	16.43021	0	0	0	0	0	13.76324	16.70735	13.69925	14.93818	0	15.57681	0	15.0858	14.161	15.1975	15.81198	0	0	0	18.25788	0	0	0	15.98621	16.28934	15.90084	15.7438	0	0	0	0	0	15.18703	0	0	15.33305	15.81513	15.70464	0	16.24873	0
A0A669BBI6	A0A669BBI6_ORENI	zc3h15		Zinc finger CCCH domain-containing protein 15	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; transferase activity [GO:0016740]	metal ion binding [GO:0046872]; transferase activity [GO:0016740]	SVLCAFFK	5.849999905	972.1614538	0	0	12.71554	12.97711	0	16.29897	15.70096	9.938376	0	0	0	15.10857	15.31628	14.98668	13.57971	13.11322	15.65199	13.17517	13.33675	15.12496	12.69369	0	0	13.9002	17.90441	0	0	0	14.01211	0	11.56675	14.82943	0	0	0	12.30595	13.9049	10.97476	15.94104	0	12.68597	8.37136	0	11.39172	0	0	15.11868	0	11.81097	0	15.97986	14.70403	15.01123	15.67341
A0A669DZE8	A0A669DZE8_ORENI		multicellular organism development [GO:0007275]	Zinc finger E-box binding homeobox 2a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		DNA binding [GO:0003677]; multicellular organism development [GO:0007275]	DNA binding [GO:0003677]	EDGGGAMLR	10.48999977	919.7504675	14.33732	0	17.43006	18.08599	0	0	15.28052	18.49462	17.07403	15.71017	17.6655	14.56555	13.85448	15.86103	15.4862	15.74024	15.6909	16.34516	17.01383	0	14.67214	18.62973	16.72379	15.12187	16.03704	15.44477	19.91269	13.74388	17.54108	15.70154	18.90665	16.45507	17.48767	17.74029	17.66663	16.40065	17.13256	16.09546	15.44032	0	16.59649	17.47728	15.28277	16.22429	17.08454	18.50465	0	16.90611	18.36189	17.42639	19.36259	16.15321	15.29076	14.81805
I3KUA8	I3KUA8_ORENI		axonogenesis [GO:0007409]; double-strand break repair via homologous recombination [GO:0000724]; mitotic cytokinesis [GO:0000281]; oocyte development [GO:0048599]	Zinc finger FYVE domain-containing protein 26	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	midbody [GO:0030496]	midbody [GO:0030496]; metal ion binding [GO:0046872]; phosphatidylinositol-3-phosphate binding [GO:0032266]; axonogenesis [GO:0007409]; double-strand break repair via homologous recombination [GO:0000724]; mitotic cytokinesis [GO:0000281]; oocyte development [GO:0048599]	metal ion binding [GO:0046872]; phosphatidylinositol-3-phosphate binding [GO:0032266]	ILVTANYK	1.110000014	921.8446681	16.04225	14.57498	16.21918	16.12556	16.72948	18.90487	14.56797	17.49483	14.90219	16.57361	14.90526	15.9378	16.17528	16.39488	16.50803	16.81621	15.43898	15.56958	15.0244	16.12755	13.77051	17.45216	0	16.12208	15.02546	17.27434	15.72696	14.43758	16.77324	16.15303	17.22148	16.35822	15.76323	19.12652	16.09251	15.78409	16.87514	17.23697	16.49266	16.14895	17.36823	18.89801	17.99262	16.53894	16.84304	16.49042	16.62271	15.72609	17.21476	16.40347	15.12122	17.49843	20.66102	17.60267
A0A669DLG8	A0A669DLG8_ORENI			Zinc finger RNA binding protein 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	EEAASA	13.55000019	576.4465861	14.47027	16.8808	13.80908	12.55582	14.384	15.7696	15.58311	14.62018	15.23543	14.94627	14.99999	15.72372	15.70483	16.05656	13.87747	16.50646	17.42322	17.48436	12.74747	15.47521	15.29977	14.47383	15.53536	17.33045	15.05429	15.87827	15.73065	20.08025	18.62448	20.01257	18.27394	18.0112	17.31529	17.98354	0	14.96566	15.65468	16.54445	15.55385	17.55154	16.70907	17.7679	13.77841	16.66551	15.27465	17.62559	17.22297	14.19274	17.02021	16.77022	16.88278	17.8185	14.90622	16.77756
I3J393	I3J393_ORENI	zranb2	defense response to bacterium [GO:0042742]	Zinc finger Ran-binding domain-containing protein 2	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; lipid antigen binding [GO:0030882]; lipopolysaccharide binding [GO:0001530]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]; defense response to bacterium [GO:0042742]	lipid antigen binding [GO:0030882]; lipopolysaccharide binding [GO:0001530]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]	TTEAKMMK	2.890000105	972.4029963	13.82609	13.75051	11.12835	14.51631	13.86666	14.13005	15.67102	14.24977	14.97437	11.82591	14.69832	0	12.26774	14.60266	15.46437	14.87867	0	14.96603	11.72072	0	12.73154	13.1599	14.56806	12.40204	16.52162	0	0	0	15.28813	13.88608	14.79349	14.08878	15.46239	13.2636	14.5868	13.93847	0	15.53875	14.38898	0	0	0	14.35753	15.03482	15.47534	14.48909	0	15.62324	13.23063	10.03969	16.16686	14.82458	13.71226	15.68369
A0A669DTW9	A0A669DTW9_ORENI	ZSWIM6		Zinc finger SWIM-type containing 6	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	LMMLVR	6.320000172	761.9200154	14.61088	0	0	0	13.20482	14.95388	14.44027	15.65017	13.73565	16.88592	16.48536	15.59321	14.82128	14.44891	10.48572	14.88623	0	0	13.42551	16.4966	13.23923	0	13.01861	9.539872	0	0	8.706382	0	12.56608	0	13.6352	16.17191	0	0	14.9805	14.35573	13.54579	13.52186	0	14.01382	11.61313	11.47652	13.44708	14.70674	0	12.36716	12.90846	13.10404	14.78496	6.902016	0	0	13.67361	10.66861
A0A669AY04	A0A669AY04_ORENI			Zinc finger protein 292a	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				AGSRLAIEELR	3.779999971	1214.933127	14.31687	12.91088	14.78827	0	15.45052	0	14.44266	0	0	0	0	13.1519	0	0	16.1125	0	0	14.21521	13.80258	0	17.12709	13.65699	14.85345	0	0	0	15.44097	9.122117	12.44551	0	15.98728	0	0	12.19878	14.20179	0	11.8244	14.07131	0	14.38343	13.34502	0	0	10.92342	10.80355	8.47763	13.80021	0	14.23056	11.72672	0	0	0	0
A0A669BNU6	A0A669BNU6_ORENI			Zinc finger protein 366	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				LTHTER	4.559999943	757.2617565	15.98883	0	0	0	17.02965	17.56066	18.67542	17.22922	17.79278	0	17.49218	16.55574	0	14.60035	14.29549	16.48487	0	15.09503	0	0	16.44754	0	0	17.81078	0	0	17.0318	0	0	0	17.15887	0	0	0	0	0	15.66041	0	0	0	16.20895	0	0	0	0	0	14.9762	0	15.95634	0	17.95171	18.22414	17.11783	16.65688
A0A669CBH3	A0A669CBH3_ORENI			Zinc finger protein 395b	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				VYGVER	1.029999971	722.1424775	0	13.54414	0	0	15.10809	0	0	13.93859	15.18425	14.41741	15.19104	11.36213	14.46993	13.854	13.96143	0	13.13691	13.51672	12.87369	14.40641	0	14.54513	16.12512	0	0	0	13.67307	0	13.8518	13.91578	18.46475	17.92864	19.00493	12.96882	0	0	14.00028	0	13.68917	14.86075	15.19859	0	14.27723	15.97327	14.49338	12.87669	15.03109	0	0	0	16.3383	0	0	13.96838
A0A669DSX7	A0A669DSX7_ORENI	ZNF462		Zinc finger protein 462	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ETMEMVAEKR	9.529999733	1223.131315	16.11555	0	0	0	0	14.41626	15.71926	14.626	15.99321	15.63918	15.35865	15.3248	0	13.84649	14.35172	13.81657	15.01874	0	14.2657	13.72681	12.59801	14.38476	14.23042	15.19998	0	15.05211	15.12962	0	16.124	14.10206	14.3101	15.70816	0	13.05032	15.63976	15.50091	15.58143	14.40459	13.0014	16.40117	16.72258	14.19308	14.19974	0	14.41753	0	16.71416	13.49418	0	16.90353	17.03572	13.64486	15.08927	0
I3JTN8	I3JTN8_ORENI	ZNF521		Zinc finger protein 521	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SLDTGSCRICK	3.079999924	1297.472455	0	0	17.53151	13.84387	0	14.19189	14.53773	10.93388	12.34749	15.55046	15.0123	13.35571	14.92726	17.82198	13.43043	17.13236	12.33031	14.75512	15.43459	12.85662	0	15.82943	10.37898	0	0	0	0	13.2666	0	0	0	0	13.78142	14.68	0	0	14.52967	0	17.79036	14.21311	16.30113	0	13.77334	0	12.52188	0	0	15.37303	14.3345	12.642	14.2752	0	0	0
I3K8D7	I3K8D7_ORENI	ZNF608		Zinc finger protein 608	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				TALECGVK	5.380000114	876.5036165	15.50585	12.48605	14.57274	0	13.08823	0	14.22026	0	12.12753	11.90445	10.66056	15.75498	11.23287	10.9483	14.06443	14.65106	0	0	13.61771	12.13691	10.52396	14.66599	0	0	14.27649	13.34146	10.99682	0	0	15.02687	0	13.21406	0	0	12.14231	0	0	13.77261	12.12816	0	0	0	0	16.71437	0	12.72097	0	12.10403	14.40896	15.57026	15.43445	14.20451	14.72458	15.50115
I3K8L3	I3K8L3_ORENI			Zinc finger protein 839	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				DEELMDIVLPRLTK	11.38000011	1687.398477	19.39372	0	18.38579	0	19.47068	0	0	18.1718	0	0	0	16.44685	0	0	0	18.74938	13.60617	13.77304	0	12.87514	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.11207	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
I3J4V9	I3J4V9_ORENI	prdm5		Zinc finger protein (EC 2.1.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; metal ion binding [GO:0046872]; transcription regulatory region sequence-specific DNA binding [GO:0000976]	metal ion binding [GO:0046872]; transcription regulatory region sequence-specific DNA binding [GO:0000976]	GNVHTGSAR	1.470000029	899.6983956	0	13.56516	13.46665	0	14.87286	0	16.03473	0	15.11659	0	12.98691	14.72317	13.61504	14.2387	14.11965	15.74252	15.16603	15.11075	13.81819	0	14.92974	14.4134	17.48444	16.16098	12.98918	0	12.54169	0	12.83215	14.62994	16.15874	14.68366	0	13.10164	12.5014	13.89616	0	14.46341	0	17.3382	0	2.286846	14.56709	13.59539	12.57676	15.16176	14.45182	15.25819	16.32056	14.22128	16.12887	15.15213	0	13.743
A0A669EQC9	A0A669EQC9_ORENI			"Zinc finger, FYVE domain containing 16"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	TIKQECVFK	6.880000114	1152.367157	14.59792	14.7377	14.50042	14.65617	0	14.21424	14.97257	16.00169	0	17.38104	0	16.29085	11.49314	14.57034	15.15638	14.756	15.38141	13.65823	0	12.47232	13.91476	17.40187	13.96596	12.55908	13.44388	14.39837	0	0	13.36709	0	18.82586	19.30712	17.51716	14.47052	15.14427	0	17.21518	12.25044	0	13.8543	14.98127	0	15.22284	0	14.13781	12.0529	13.33051	15.10282	0	0	13.88876	0	15.64355	0
I3J168	I3J168_ORENI			"Zinc finger, FYVE domain containing 9b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	AFPLRLMLR	3.559999943	1130.206618	0	0	13.79795	12.34781	13.97381	12.8385	0	0	0	11.44761	12.74727	13.71528	9.516407	0	13.25785	0	0	12.33721	14.98116	0	14.93683	13.5151	0	13.9029	0	12.9799	0	13.9872	0	16.33362	0	0	10.53424	0	0	10.4162	0	10.76352	11.85562	14.98691	12.56473	0	18.0711	0	0	13.48244	15.12691	14.37569	14.92103	11.06633	0	0	14.96613	14.01173
A0A669B356	A0A669B356_ORENI			"Zinc finger, MYND-type containing 11"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]	metal ion binding [GO:0046872]	MEDGSPMRTDR	1.179999948	1309.692777	13.43999	12.61824	13.92362	9.982891	0	13.6887	9.550754	14.79986	15.23556	12.26933	0	0	0	0	13.83917	0	12.51734	12.44904	12.60016	13.38338	0	13.8202	14.67305	0	0	14.86998	0	0	13.39533	14.11955	17.57793	16.77813	18.00699	0	0	11.47367	13.50701	11.52982	11.06893	0	12.6508	13.69628	0	11.07466	11.28634	0	13.43138	14.10998	13.937	12.66663	13.17587	14.42719	0	0
A0A669ENJ6	A0A669ENJ6_ORENI		"regulation of transcription, DNA-templated [GO:0006355]"	"Zinc finger, MYND-type containing 8"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"metal ion binding [GO:0046872]; regulation of transcription, DNA-templated [GO:0006355]"	metal ion binding [GO:0046872]	DQPSPTGEASVTVSDAQTK	4.75	1918.082762	12.95357	13.95145	11.25159	13.38864	13.38201	16.01061	15.998	14.54	14.82497	15.95021	0	16.16479	15.06494	15.59906	16.78716	0	16.95923	16.43568	14.83187	15.29313	15.82919	16.09731	16.02788	16.66863	14.6	0	15.55027	15.33506	15.12403	14.86866	0	0	0	16.46333	15.81856	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15.41418	17.80841	17.32297	0
I3KN33	I3KN33_ORENI		"mRNA splicing, via spliceosome [GO:0000398]"	"Zinc finger, matrin-type 2"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	spliceosomal complex [GO:0005681]	"spliceosomal complex [GO:0005681]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]; mRNA splicing, via spliceosome [GO:0000398]"	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	VVSSTGSAK	1.399999976	834.4120549	17.4341	15.3318	14.82786	0	14.95201	15.1219	15.74223	0	15.21412	15.71979	15.53913	16.56829	16.36308	15.53598	14.70741	16.2368	16.06246	0	16.8942	15.03755	15.49672	14.13748	15.65996	16.4437	15.77486	16.58431	15.42983	13.59172	17.39039	15.22354	15.48365	11.50405	15.44952	15.84752	15.13026	15.92854	13.81998	16.53276	14.67716	14.94798	14.56438	0	0	16.06789	16.33956	15.74069	0	11.58222	15.10672	15.86253	16.22225	0	0	16.80052
I3KGL8	I3KGL8_ORENI			"Zinc finger, matrin-type 4b"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	SDNGSDDGDVDK	4.820000172	1224.402268	13.81142	0	0	13.74457	11.72874	10.3478	11.81945	12.57498	11.56582	12.71439	12.82995	12.984	13.48516	11.0673	13.20595	0	9.753041	0	0	0	11.95585	0	0	0	0	10.80414	10.99718	0	0	0	0	8.816674	9.655614	0	0	0	0	12.42282	13.78962	13.19852	0	0	11.90887	11.17692	5.880164	0	8.897628	12.88206	12.32	0	0	15.88176	0	15.38234
A0A669BFA9	A0A669BFA9_ORENI	ZHX1	multicellular organism development [GO:0007275]	Zinc fingers and homeoboxes 1	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; multicellular organism development [GO:0007275]	DNA binding [GO:0003677]	AGEGGGTGGMASSSPPASSSRK	6.989999771	1936.414385	13.51473	0	11.91898	11.74581	0	12.45875	12.65016	0	0	0	0	0	13.61607	0	0	0	14.52212	14.36809	0	0	0	13.95647	13.85289	0	0	12.15596	13.42786	0	14.82314	0	15.16481	0	0	12.77536	0	14.40242	0	0	0	16.50097	0	12.61585	0	0	0	0	0	0	15.56077	0	0	13.18204	0	0
A0A669D0Z4	A0A669D0Z4_ORENI			Zmp:0000000662	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; zinc ion binding [GO:0008270]	zinc ion binding [GO:0008270]	GMTHAK	4.059999943	645.4176459	0	15.01721	14.69808	14.75622	15.91308	15.24751	0	15.50101	12.86191	14.84317	17.05068	15.51077	14.78802	15.58071	15.7113	13.91204	14.8602	15.15341	15.92951	14.64722	15.66182	15.11019	0	12.97245	0	13.6332	15.3494	14.53605	0	0	16.03784	18.56542	16.7136	17.98643	16.73668	17.61883	14.3192	13.85973	0	14.65631	13.39691	12.88559	0	14.15876	0	15.7855	15.22581	15.16053	0	0	13.0081	15.07379	15.14617	14.77178
A0A669B1B2	A0A669B1B2_ORENI			Zmp:0000000735	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				QHVNTSGFYAEVEVGLGLLK	3.00999999	2161.165811	11.92214	0	10.63536	0	13.29645	0	0	0	0	18.69193	13.9379	7.706486	13.7094	13.09931	0	0	12.17691	12.2395	0	12.15545	15.45228	15.72236	11.75937	16.21079	13.87714	11.5775	0	14.79527	0	0	0	14.52457	0	0	14.68805	0	14.57725	13.99037	12.60567	12.86469	0	18.02191	0	11.31198	17.23442	0	0	0	14.36848	14.50213	20.41039	12.36626	0	17.58781
I3JTM8	I3JTM8_ORENI			Zmp:0000000760	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				GDTGIQGIKGVK	3.75	1173.07138	15.36365	10.62524	0	0	13.61927	14.24539	13.5966	14.42219	6.885598	12.28652	11.42119	13.09078	13.71593	0	11.53201	12.86318	0	16.96768	14.94504	15.03841	13.10978	0	14.9765	14.75512	14.76165	13.85912	15.46796	13.44654	16.37076	0	16.30914	13.95967	15.63699	10.75291	0	14.64298	0	0	15.57131	15.32637	0	0	10.1359	0	15.00452	16.00262	13.44519	13.67243	0	0	14.92278	0	15.89434	0
A0A669DYB2	A0A669DYB2_ORENI	LOC106097969		ZnMc domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular matrix [GO:0031012]	extracellular matrix [GO:0031012]; metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	DGFIYFFVGPQVYKYDYMQK	5.78000021	2508.988323	0	0	0	0	0	0	0	0	11.00459	0	0	0	9.904653	11.56179	6.333623	0	10.53946	11.45612	10.4402	12.48258	0	0	0	0	17.94831	12.08276	0	14.1018	12.70848	14.12576	0	11.44612	0	14.32591	10.64933	11.66763	12.58563	0	0	16.36222	17.95861	12.57987	17.41952	11.72796	10.10625	10.77882	11.29851	0	0	0	0	11.31724	11.31085	0
I3JWG1	I3JWG1_ORENI	LOC102077631	binding of sperm to zona pellucida [GO:0007339]; egg coat formation [GO:0035803]; positive regulation of acrosome reaction [GO:2000344]	Zona pellucida sperm-binding protein 3	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; structural constituent of egg coat [GO:0035804]; binding of sperm to zona pellucida [GO:0007339]; egg coat formation [GO:0035803]; positive regulation of acrosome reaction [GO:2000344]	structural constituent of egg coat [GO:0035804]	VFGRSGITR	5.429999828	992.5381335	11.54603	0	0	14.217	0	0	13.29045	0	13.71765	13.07482	11.22035	15.39078	0	14.95422	0	14.05754	0	0	13.76752	15.86611	13.79779	13.6952	0	0	14.80239	13.73523	15.10826	15.10521	0	11.67303	0	0	13.78047	14.61596	14.70503	0	12.97217	14.09502	13.20185	8.363594	0	11.74873	15.46295	14.27272	0	14.21565	0	12.93217	15.35678	0	0	12.69918	14.29414	0
A0A669B0B8	A0A669B0B8_ORENI	LOC100695867	heparin biosynthetic process [GO:0030210]	[Heparan sulfate]-glucosamine N-sulfotransferase (EC 2.8.2.8)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	Golgi membrane [GO:0000139]	Golgi membrane [GO:0000139]; [heparan sulfate]-glucosamine N-sulfotransferase activity [GO:0015016]; hydrolase activity [GO:0016787]; heparin biosynthetic process [GO:0030210]	[heparan sulfate]-glucosamine N-sulfotransferase activity [GO:0015016]; hydrolase activity [GO:0016787]	IITLLINPSDR	9.890000343	1253.643867	0	0	13.25841	10.74562	0	13.76157	15.15015	0	11.59984	0	0	0	0	12.83904	0	0	12.28656	6.576365	18.52908	13.56638	12.83782	12.63448	14.53945	14.43527	0	11.49986	13.407	0	19.00264	17.89677	0	10.09127	0	12.42125	10.18373	11.35363	16.52781	13.80475	8.510589	13.49874	0	14.49373	13.44901	12.73155	0	11.45175	10.86103	0	0	0	10.92267	0	0	0
I3KUS7	I3KUS7_ORENI	LOC100689867	chromatin organization [GO:0006325]; methylation [GO:0032259]	[Histone H3]-lysine(4) N-trimethyltransferase (EC 2.1.1.354)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; DNA binding [GO:0003677]; methyltransferase activity [GO:0008168]; zinc ion binding [GO:0008270]; chromatin organization [GO:0006325]; methylation [GO:0032259]	DNA binding [GO:0003677]; methyltransferase activity [GO:0008168]; zinc ion binding [GO:0008270]	QGAITHSPRGR	5.179999828	1180.295844	0	0	0	0	0	0	0	15.91875	0	15.47846	15.03177	0	0	0	15.51913	15.59274	14.49651	15.16552	14.63256	15.21688	11.75487	16.03918	13.47931	14.26529	0	0	0	15.03138	0	15.48084	0	16.80021	0	0	16.01904	15.3015	0	15.11559	14.81662	15.16496	14.78975	13.24616	14.57251	12.89695	15.60568	0	0	15.8566	0	0	15.02519	15.31579	0	0
A0A669EZI8	A0A669EZI8_ORENI	LOC100695530		[Histone H3]-trimethyl-L-lysine(4) demethylase (EC 1.14.11.67)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; dioxygenase activity [GO:0051213]; DNA binding [GO:0003677]; histone demethylase activity (H3-trimethyl-K4 specific) [GO:0034647]; metal ion binding [GO:0046872]	dioxygenase activity [GO:0051213]; DNA binding [GO:0003677]; histone demethylase activity (H3-trimethyl-K4 specific) [GO:0034647]; metal ion binding [GO:0046872]	AVGSHLRGHYER	11.93000031	1381.392681	17.62449	0	18.00315	0	0	0	0	0	16.73212	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18.64953	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669C4H1	A0A669C4H1_ORENI	LOC100703178		[Histone H3]-trimethyl-L-lysine(9) demethylase (EC 1.14.11.66)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; dioxygenase activity [GO:0051213]; histone demethylase activity (H3-K9 specific) [GO:0032454]; metal ion binding [GO:0046872]	dioxygenase activity [GO:0051213]; histone demethylase activity (H3-K9 specific) [GO:0032454]; metal ion binding [GO:0046872]	FIDAIER	13.47999954	863.3307341	15.35765	13.55771	0	15.90735	14.45367	13.58087	16.05292	14.60371	14.44092	0	15.7808	0	14.16369	0	13.89043	0	13.99715	0	14.71062	15.41149	0	0	0	15.54858	14.33035	0	0	0	15.54245	15.23857	14.34813	15.4834	15.23142	14.20758	15.48515	0	0	0	0	0	13.14715	0	0	0	14.95476	14.54822	0	15.36578	0	15.74957	0	14.64309	0	0
A0A669ET14	A0A669ET14_ORENI	LOC100691614	histone H4-K20 dimethylation [GO:0034772]	[histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B (EC 2.1.1.361) (EC 2.1.1.362) ([histone H4]-lysine20 N-methyltransferase KMT5B)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	chromosome [GO:0005694]; nucleus [GO:0005634]	chromosome [GO:0005694]; nucleus [GO:0005634]; histone methyltransferase activity (H4-K20 specific) [GO:0042799]; histone H4-K20 dimethylation [GO:0034772]	histone methyltransferase activity (H4-K20 specific) [GO:0042799]	AEKGDELVAFDPFK	3.619999886	1566.47383	11.98225	10.1974	0	14.67375	13.40917	15.37041	13.11236	0	11.91711	0	0	0	0	0	0	14.01327	14.44257	0	15.43236	0	0	0	0	0	0	0	7.311609	0	0	13.2243	0	17.06503	15.02835	13.51579	12.49111	11.73703	13.74036	14.60882	12.601	15.21188	0	0	0	0	12.89404	0	14.22699	11.9556	10.69119	0	0	0	0	0
I3J7M0	I3J7M0_ORENI	LOC100706542	carbohydrate metabolic process [GO:0005975]	"alpha-1,2-Mannosidase (EC 3.2.1.-)"	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	membrane [GO:0016020]	"membrane [GO:0016020]; calcium ion binding [GO:0005509]; mannosyl-oligosaccharide 1,2-alpha-mannosidase activity [GO:0004571]; carbohydrate metabolic process [GO:0005975]"	"calcium ion binding [GO:0005509]; mannosyl-oligosaccharide 1,2-alpha-mannosidase activity [GO:0004571]"	ALDVLWER	2.440000057	1001.899392	14.34797	15.65295	0	15.06627	0	14.83955	15.79141	0	15.47157	17.80464	0	12.86615	15.91332	0	0	0	0	0	15.2626	0	0	0	16.16891	14.43066	0	16.24752	16.44026	0	0	0	15.90739	0	15.88055	15.3794	0	16.20723	15.35384	15.7709	0	16.56024	16.1294	15.29937	0	0	16.52809	16.32208	15.7867	15.79526	0	0	0	0	0	0
I3J7W7	I3J7W7_ORENI	LOC100700916	cartilage development [GO:0051216]; dorsal/ventral pattern formation [GO:0009953]; heart looping [GO:0001947]	c-SKI_SMAD_bind domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; SMAD binding [GO:0046332]; cartilage development [GO:0051216]; dorsal/ventral pattern formation [GO:0009953]; heart looping [GO:0001947]	SMAD binding [GO:0046332]	QTAQPTNGS	6.360000134	904.4210218	0	15.56643	11.86961	15.40478	0	17.69913	0	15.92681	0	0	0	0	15.03924	0	0	15.69227	17.10725	0	15.54821	0	0	0	0	0	0	0	17.47573	0	0	17.30351	0	0	17.45509	0	14.35391	15.58516	14.54927	14.32783	0	0	15.04455	0	17.09355	15.12368	18.20377	16.07873	0	0	0	0	14.41307	0	0	17.0973
A0A669DJV6	A0A669DJV6_ORENI	LOC100707466		cGMP-dependent protein kinase (EC 2.7.11.12)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		ATP binding [GO:0005524]; cGMP binding [GO:0030553]; cGMP-dependent protein kinase activity [GO:0004692]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	ATP binding [GO:0005524]; cGMP binding [GO:0030553]; cGMP-dependent protein kinase activity [GO:0004692]; protein serine kinase activity [GO:0106310]; protein threonine kinase activity [GO:0106311]	LCTMGPGKVFGELAILYNCTR	3.099999905	2400.455041	8.80664	11.64935	0	0	7.589355	0	0	0	0	9.383142	10.96206	7.712517	7.527874	14.84194	0	12.4135	10.84512	13.91731	11.14546	14.19169	11.24866	0	11.49632	9.292488	13.6629	11.44409	12.28762	14.80778	0	0	0	0	0	0	13.16007	0	0	0	0	0	0	13.53707	11.9677	0	0	11.56237	8.99551	7.29676	0	14.66895	0	0	11.16459	0
A0A669F1B1	A0A669F1B1_ORENI			dCMP deaminase	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		hydrolase activity [GO:0016787]; zinc ion binding [GO:0008270]	hydrolase activity [GO:0016787]; zinc ion binding [GO:0008270]	RMLDMAGIPK	10.31000042	1148.852995	0	14.36707	0	15.08598	0	15.59004	16.24592	13.23613	14.67067	15.55825	15.32747	16.32489	0	16.30736	15.76383	11.91238	12.55213	15.11377	15.35204	14.67072	14.15693	13.16674	0	0	14.10708	0	0	0	0	0	16.843	0	0	0	0	0	0	0	0	15.9019	15.46468	0	15.11239	0	16.10509	16.53442	0	16.0746	0	16.6384	15.69294	0	14.65576	0
I3K5Y5	I3K5Y5_ORENI	tk2		dNK domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				SVCVTLVSAR	6.940000057	1090.074896	11.0577	11.16627	0	13.7888	12.19704	12.63382	11.2608	11.0814	13.34472	12.7508	13.99142	16.13607	13.70352	5.976172	0	13.27221	10.5384	0	18.48307	0	12.92931	12.49204	0	0	8.201079	15.96698	0	0	11.12306	0	13.58163	0	0	13.61848	0	13.79955	0	0	11.0779	14.0933	15.50903	12.10087	0	12.42549	0	10.0482	0	0	0	0	17.30862	14.47167	0	17.11358
A0A669BUM2	A0A669BUM2_ORENI	eif2s2		eIF2B_5 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		translation initiation factor activity [GO:0003743]	translation initiation factor activity [GO:0003743]	NPDMVAGEKR	2.400000095	1116.194922	15.21801	14.92409	15.17034	10.27438	11.85641	8.77253	15.67193	0	0	15.73709	12.86982	0	14.6327	12.12545	0	0	12.2725	8.67047	0	19.25358	13.86354	11.28826	12.26493	17.02448	15.70962	15.17817	15.5127	12.83768	0	0	0	11.72622	15.24539	12.89192	14.89333	0	0	14.89474	0	13.84214	0	12.20871	0	0	14.64743	14.73943	12.15143	12.93679	18.63863	0	0	0	15.84813	0
J7MDP5	J7MDP5_ORENI	P-gp		p-glycoprotein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]	ATPase activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; ATP binding [GO:0005524]	KGETLALVGSSGCGK	4.059999943	1465.060922	0	11.76724	15.43668	13.87664	0	0	14.07649	15.87253	0	13.41114	14.20015	0	13.7905	12.36831	13.11322	16.39575	0	13.33551	8.830054	0	16.03309	0	0	0	0	0	0	0	12.94134	12.5423	0	18.31065	0	0	9.193473	14.40652	0	0	10.2423	0	0	0	0	0	0	0	0	13.27537	0	0	0	0	0	0
A0A669E2D9	A0A669E2D9_ORENI	ftsj3 FTSJ3	enzyme-directed rRNA 2'-O-methylation [GO:0000453]	pre-rRNA processing protein FTSJ3 (EC 2.1.1.-) (2'-O-ribose RNA methyltransferase SPB1 homolog) (Protein ftsJ homolog 3) (Putative rRNA methyltransferase 3)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	"nucleolus [GO:0005730]; preribosome, small subunit precursor [GO:0030688]"	"nucleolus [GO:0005730]; preribosome, small subunit precursor [GO:0030688]; rRNA methyltransferase activity [GO:0008649]; enzyme-directed rRNA 2'-O-methylation [GO:0000453]"	rRNA methyltransferase activity [GO:0008649]	LRYSSDAPFTK	6.880000114	1283.390791	13.79799	13.8342	13.18212	13.28026	12.53722	14.0395	12.49127	14.02459	14.03293	10.7556	0	10.13622	13.00511	8.739187	13.88476	9.519606	13.03884	11.53458	14.53369	12.46457	12.45507	0	15.13014	13.38004	0	14.92124	13.96912	10.10898	14.00641	15.28433	16.99563	0	13.54884	0	12.37704	15.57674	12.91945	0	14.34071	0	0	0	0	0	0	0	11.27552	7.750235	0	0	0	0	11.7759	0
I3JMW9	I3JMW9_ORENI	tfb1m		rRNA adenine N(6)-methyltransferase (EC 2.1.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		"RNA binding [GO:0003723]; rRNA (adenine-N6,N6-)-dimethyltransferase activity [GO:0000179]"	"RNA binding [GO:0003723]; rRNA (adenine-N6,N6-)-dimethyltransferase activity [GO:0000179]"	KSNTASSPAFMDAPSGVAESPLQPR	6.710000038	2562.229889	18.09697	12.74488	0	13.8245	11.54134	12.57884	0	0	0	10.18006	8.278595	12.90968	0	0	12.44698	11.98856	11.77458	9.825377	0	11.34849	0	14.41419	0	0	0	0	11.51632	0	0	0	0	0	8.769336	12.82516	0	0	0	0	0	0	0	0	0	0	15.0441	0	0	0	0	10.89696	0	0	0	13.83931
A0A669CS48	A0A669CS48_ORENI	LOC100707847	intracellular protein transport [GO:0006886]; neurotransmitter transport [GO:0006836]; regulation of exocytosis [GO:0017157]; vesicle-mediated transport [GO:0016192]	t-SNARE coiled-coil homology domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	integral component of membrane [GO:0016021]	integral component of membrane [GO:0016021]; SNAP receptor activity [GO:0005484]; SNARE binding [GO:0000149]; intracellular protein transport [GO:0006886]; neurotransmitter transport [GO:0006836]; regulation of exocytosis [GO:0017157]; vesicle-mediated transport [GO:0016192]	SNAP receptor activity [GO:0005484]; SNARE binding [GO:0000149]	TLLVLSWSIF	7.320000172	1177.95014	13.94242	12.6772	0	17.60566	11.21528	0	9.019228	0	14.34659	8.245416	12.85719	8.973788	0	0	11.55212	13.98465	15.05209	0	0	10.45297	14.0493	0	0	0	0	17.16881	17.18596	12.50882	17.18441	3.715131	16.09917	0	13.37037	0	12.34365	14.35121	0	0	12.79102	0	0	0	13.19355	12.48062	11.341	15.98292	0	12.08042	0	0	0	10.97789	14.65776	9.091802
I3IV65	I3IV65_ORENI	trmt1		tRNA (guanine(26)-N(2))-dimethyltransferase (EC 2.1.1.216)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		metal ion binding [GO:0046872]; tRNA (guanine-N2-)-methyltransferase activity [GO:0004809]; tRNA binding [GO:0000049]	metal ion binding [GO:0046872]; tRNA (guanine-N2-)-methyltransferase activity [GO:0004809]; tRNA binding [GO:0000049]	AGGGISADLQDKR	11.19999981	1285.968367	13.7202	12.0752	10.27755	14.67487	12.79977	8.60675	14.69704	0	0	0	0	0	14.18089	0	8.233665	16.50821	12.17632	10.37925	0	13.84863	12.26607	11.8783	0	16.12892	0	13.63208	12.8087	12.20993	0	0	0	0	0	0	12.18074	12.22962	0	0	13.25154	12.66279	0	12.59264	0	0	11.88595	11.90201	0	0	11.66585	11.71944	0	0	15.05091	0
I3KLG8	I3KLG8_ORENI	WDR4 wdr4	RNA (guanine-N7)-methylation [GO:0036265]; tRNA methylation [GO:0030488]	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4 (WD repeat-containing protein 4)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	nucleus [GO:0005634]	nucleus [GO:0005634]; RNA (guanine-N7)-methylation [GO:0036265]; tRNA methylation [GO:0030488]		EPFVFDCSTAEK	4.849999905	1425.643044	13.29391	12.39228	10.70683	0	13.42157	0	13.87983	14.33142	12.20308	0	14.5187	14.9065	11.92594	15.75833	0	15.50579	16.32245	15.25036	0	12.81289	5.926047	15.02001	14.5662	0	0	12.68854	0	0	14.13978	14.77814	18.74308	19.98761	18.73679	0	0	0	12.25759	0	11.13079	0	14.00817	15.14176	8.059484	0	0	10.68726	14.93894	11.74697	11.11228	0	0	11.78016	15.321	9.015087
I3ITV5	I3ITV5_ORENI	pus10	pseudouridine synthesis [GO:0001522]; tRNA processing [GO:0008033]	tRNA pseudouridine(55) synthase (EC 5.4.99.25)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		RNA binding [GO:0003723]; tRNA pseudouridine synthase activity [GO:0106029]; pseudouridine synthesis [GO:0001522]; tRNA processing [GO:0008033]	RNA binding [GO:0003723]; tRNA pseudouridine synthase activity [GO:0106029]	KPPEVRLMLQTYK	5.300000191	1617.702657	0	14.66756	15.30437	0	14.91215	14.78069	14.70089	15.91017	0	15.77646	0	14.61755	12.77923	14.00362	0	0	0	12.84848	12.63816	0	15.44365	12.88839	14.4458	0	12.45727	11.76124	13.57812	0	14.27283	15.18238	16.67565	0	15.99794	0	0	16.745	15.97285	14.88284	15.43674	0	0	0	0	0	0	0	14.70507	0	14.74402	13.92201	14.67095	0	0	0
I3KMC8	I3KMC8_ORENI	thg1l	tRNA modification [GO:0006400]	tRNA(His) guanylyltransferase (EC 2.7.7.79) (tRNA-histidine guanylyltransferase)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		GTP binding [GO:0005525]; magnesium ion binding [GO:0000287]; tRNA guanylyltransferase activity [GO:0008193]; tRNA modification [GO:0006400]	GTP binding [GO:0005525]; magnesium ion binding [GO:0000287]; tRNA guanylyltransferase activity [GO:0008193]	LFSRSSNMAK	8.779999733	1157.676421	14.50995	0	8.052884	16.84092	15.11721	11.58252	0	14.95258	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16.11584	0	0	0	0	0	0	0	0	0	0	15.13557	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A669EHB0	A0A669EHB0_ORENI	dus4l		tRNA-dihydrouridine synthase (EC 1.3.1.-)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		flavin adenine dinucleotide binding [GO:0050660]; tRNA dihydrouridine synthase activity [GO:0017150]	flavin adenine dinucleotide binding [GO:0050660]; tRNA dihydrouridine synthase activity [GO:0017150]	ISPINQMK	6.590000153	947.1612557	13.78857	15.97996	15.26713	13.915	11.9943	13.27743	12.50884	14.42751	15.39815	14.12866	14.65996	11.42726	15.08838	13.38017	15.44878	12.53789	13.71482	13.7463	13.054	16.32211	0	13.41858	12.5641	12.09171	13.50365	0	13.86911	13.49146	11.50443	11.28733	13.94218	0	14.07503	13.06631	0	14.34986	13.02542	13.47313	13.75947	11.43065	12.67608	12.32081	14.5795	12.15876	12.0849	0	13.67568	13.42697	0	0	0	12.458	0	13.137
A0A669DHS6	A0A669DHS6_ORENI	dus3l		tRNA-dihydrouridine(47) synthase [NAD(P)(+)] (EC 1.3.1.-) (tRNA-dihydrouridine synthase 3)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		flavin adenine dinucleotide binding [GO:0050660]; metal ion binding [GO:0046872]; tRNA dihydrouridine synthase activity [GO:0017150]	flavin adenine dinucleotide binding [GO:0050660]; metal ion binding [GO:0046872]; tRNA dihydrouridine synthase activity [GO:0017150]	ELQGRLR	1.919999957	869.6831149	16.70014	17.28097	0	0	17.12471	0	15.10413	0	0	16.46029	15.29476	0	0	0	11.38356	0	15.21288	0	0	0	0	0	15.6277	0	15.71063	0	0	0	0	13.98246	20.30154	0	17.03537	0	0	16.05737	0	14.31316	0	14.65258	15.82587	14.04598	14.11224	14.41233	15.71774	10.04359	10.6508	0	0	0	17.71627	0	0	0
I3KKW5	I3KKW5_ORENI	tsen34	mRNA processing [GO:0006397]; tRNA-type intron splice site recognition and cleavage [GO:0000379]	tRNA-splicing endonuclease subunit Sen34 (EC 4.6.1.16)	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)	tRNA-intron endonuclease complex [GO:0000214]	tRNA-intron endonuclease complex [GO:0000214]; lyase activity [GO:0016829]; nucleic acid binding [GO:0003676]; tRNA-intron endonuclease activity [GO:0000213]; mRNA processing [GO:0006397]; tRNA-type intron splice site recognition and cleavage [GO:0000379]	lyase activity [GO:0016829]; nucleic acid binding [GO:0003676]; tRNA-intron endonuclease activity [GO:0000213]	GRGFYLTSAGK	4.019999981	1156.256285	10.99407	13.11221	13.95851	12.64774	12.93671	13.59787	9.632508	13.35948	17.17068	11.7309	14.76411	14.81503	8.006101	15.02275	0	0	11.75252	15.38821	14.51943	0	12.73682	0	0	0	17.99276	11.88628	13.59268	17.02523	10.51477	0	14.66189	13.46228	15.42059	14.14716	9.141037	13.36005	10.67498	13.18068	14.30596	12.85974	16.89714	12.10332	13.29601	15.0535	11.73123	13.01394	8.591493	0	11.86114	0	10.22437	12.39722	13.9065	14.83476
I3JSZ5	I3JSZ5_ORENI	tsen54	brain morphogenesis [GO:0048854]; tRNA processing [GO:0008033]	tRNA_int_end_N2 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)		brain morphogenesis [GO:0048854]; tRNA processing [GO:0008033]		VERLGNLVK	1.710000038	1027.339666	13.06514	14.20115	12.79049	0	0	0	13.22982	15.45753	14.86874	0	0	0	0	0	13.6297	0	14.84768	13.33298	0	14.77444	15.05125	0	15.72486	14.53382	12.97902	15.47568	13.98337	14.68613	0	14.64315	0	14.39512	0	8.576384	14.46879	0	0	14.29091	14.82226	0	14.06457	15.09207	0	0	14.23541	14.83413	14.03116	13.03555	14.34515	14.59059	0	13.05034	17.27572	14.85781
I3J4P9	I3J4P9_ORENI	zar1		zf-3CxxC domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				ATGGVR	1.600000024	558.1380513	15.25732	0	14.16707	0	0	15.18214	12.39218	14.56101	0	0	15.5885	15.75323	15.2399	13.5449	15.5367	14.17525	0	0	13.64558	15.67515	14.09634	0	13.99144	0	15.62845	11.71889	16.25038	15.39869	0	0	17.21591	17.07592	15.86168	15.19984	15.40833	15.36672	15.18529	12.77486	14.1607	14.17218	15.43785	14.71204	15.57365	14.08837	14.46579	15.89643	12.79811	15.53484	14.87737	15.00017	14.61908	14.1063	14.70566	14.10952
I3J839	I3J839_ORENI			zf-C2H2_12 domain-containing protein	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)				MDNVMK	14.56999969	768.5889491	14.02276	12.85199	11.86377	13.83223	0	16.91721	13.6876	14.97914	19.12623	14.34106	15.6664	14.89414	17.29216	13.97237	14.01648	14.46993	14.06497	14.72622	12.30006	0	14.9318	14.11098	15.3633	14.86918	13.2375	10.08826	15.00633	16.19822	0	16.2649	0	16.85141	15.76375	0	15.08193	12.73172	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19.24989	17.09235	15.01759