MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100630_016PKCi_PRKCI.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100630_016PKCi_PRKCI.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	44.0	1	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	43.0	null	228-UNIMOD:510	0.09	43.0	3	1	0
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	57-UNIMOD:510,63-UNIMOD:21,73-UNIMOD:510,60-UNIMOD:21	0.10	43.0	3	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	180-UNIMOD:510,182-UNIMOD:21,131-UNIMOD:510,133-UNIMOD:35,137-UNIMOD:21,145-UNIMOD:510,134-UNIMOD:21,206-UNIMOD:510,207-UNIMOD:510,222-UNIMOD:21,224-UNIMOD:510	0.05	41.0	5	3	2
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	22-UNIMOD:510,37-UNIMOD:21	0.09	41.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	41.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	41.0	1	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	167-UNIMOD:510,168-UNIMOD:510,181-UNIMOD:21,182-UNIMOD:510,147-UNIMOD:510,151-UNIMOD:510,153-UNIMOD:21,166-UNIMOD:510	0.12	40.0	2	2	2
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,466-UNIMOD:35,446-UNIMOD:510	0.03	38.0	3	2	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	203-UNIMOD:510,221-UNIMOD:510,16-UNIMOD:510,27-UNIMOD:21,28-UNIMOD:510	0.08	37.0	2	2	2
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	228-UNIMOD:510	0.08	37.0	1	1	1
PRT	sp|Q15185-4|TEBP_HUMAN	Isoform 4 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	108-UNIMOD:510,117-UNIMOD:35	0.12	37.0	1	1	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	120-UNIMOD:510,123-UNIMOD:21,145-UNIMOD:510	0.11	37.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	431-UNIMOD:510,439-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	119-UNIMOD:510,136-UNIMOD:21,137-UNIMOD:510,126-UNIMOD:21	0.06	36.0	2	1	0
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	73-UNIMOD:510,83-UNIMOD:35,79-UNIMOD:21	0.20	36.0	4	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510,728-UNIMOD:510,728-UNIMOD:4,732-UNIMOD:21	0.03	35.0	2	2	2
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	354-UNIMOD:510,365-UNIMOD:21,366-UNIMOD:21,353-UNIMOD:510	0.02	35.0	3	2	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	269-UNIMOD:510,295-UNIMOD:21,298-UNIMOD:510	0.06	34.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	300-UNIMOD:510,314-UNIMOD:510,251-UNIMOD:510,255-UNIMOD:510,263-UNIMOD:21,269-UNIMOD:510,192-UNIMOD:510	0.06	33.0	4	3	2
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	329-UNIMOD:510,340-UNIMOD:21,221-UNIMOD:510,37-UNIMOD:510	0.09	33.0	3	3	2
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	81-UNIMOD:510,83-UNIMOD:21,86-UNIMOD:21,93-UNIMOD:510,91-UNIMOD:35	0.09	32.0	2	1	0
PRT	sp|P41743|KPCI_HUMAN	Protein kinase C iota type OS=Homo sapiens OX=9606 GN=PRKCI PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	402-UNIMOD:510,412-UNIMOD:21,414-UNIMOD:4,135-UNIMOD:510,137-UNIMOD:4,142-UNIMOD:21,146-UNIMOD:510	0.07	32.0	2	2	2
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	126-UNIMOD:510,139-UNIMOD:21,129-UNIMOD:510,137-UNIMOD:21	0.11	32.0	2	2	2
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	28-UNIMOD:510,28-UNIMOD:21,223-UNIMOD:510	0.16	32.0	3	2	1
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	50-UNIMOD:510,56-UNIMOD:21	0.09	32.0	1	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	44-UNIMOD:510,64-UNIMOD:21,253-UNIMOD:510,265-UNIMOD:510	0.05	32.0	2	2	2
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	31.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510	0.04	31.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	14-UNIMOD:510	0.06	31.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	31.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	292-UNIMOD:510,306-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510	0.06	31.0	3	3	3
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	30.0	1	1	0
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	114-UNIMOD:510	0.13	30.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	null	329-UNIMOD:510,341-UNIMOD:21	0.02	30.0	1	1	0
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	196-UNIMOD:510,203-UNIMOD:21,211-UNIMOD:510,241-UNIMOD:510,252-UNIMOD:21,273-UNIMOD:510	0.13	29.0	2	2	2
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	689-UNIMOD:510,697-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510,63-UNIMOD:510,73-UNIMOD:35,75-UNIMOD:21	0.07	28.0	2	2	2
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	489-UNIMOD:510,499-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	8-UNIMOD:510,23-UNIMOD:510	0.05	28.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	70-UNIMOD:510,78-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	323-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	null	70-UNIMOD:510,77-UNIMOD:21	0.04	28.0	1	1	0
PRT	sp|P78417-2|GSTO1_HUMAN	Isoform 2 of Glutathione S-transferase omega-1 OS=Homo sapiens OX=9606 GN=GSTO1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	12-UNIMOD:510,23-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	239-UNIMOD:510,239-UNIMOD:21	0.05	27.0	2	1	0
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	3-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:21,13-UNIMOD:510,9-UNIMOD:21	0.08	26.0	2	1	0
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	100-UNIMOD:510,105-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	264-UNIMOD:510,267-UNIMOD:21,268-UNIMOD:21	0.05	26.0	2	1	0
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	225-UNIMOD:510,227-UNIMOD:21,242-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	463-UNIMOD:510,473-UNIMOD:21,482-UNIMOD:510	0.01	25.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	65-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510,72-UNIMOD:21	0.09	25.0	2	1	0
PRT	sp|O43852-12|CALU_HUMAN	Isoform 12 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	60-UNIMOD:510,65-UNIMOD:21,70-UNIMOD:510	0.16	25.0	1	1	1
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	200-UNIMOD:510,200-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	108-UNIMOD:510,113-UNIMOD:21	0.10	25.0	1	1	0
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	null	79-UNIMOD:510,87-UNIMOD:21	0.07	25.0	1	1	0
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	129-UNIMOD:510,130-UNIMOD:21,135-UNIMOD:21,144-UNIMOD:510,126-UNIMOD:510	0.08	24.0	3	2	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	618-UNIMOD:510,629-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	20-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	10-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:21	0.08	24.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	107-UNIMOD:510,120-UNIMOD:21,121-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	226-UNIMOD:510,244-UNIMOD:510	0.08	24.0	1	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	235-UNIMOD:510,241-UNIMOD:21,247-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q9NVR5-2|KTU_HUMAN	Isoform 2 of Protein kintoun OS=Homo sapiens OX=9606 GN=DNAAF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	720-UNIMOD:510,725-UNIMOD:21,731-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	204-UNIMOD:510,213-UNIMOD:35,222-UNIMOD:510	0.09	23.0	1	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	186-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	225-UNIMOD:510,232-UNIMOD:21,233-UNIMOD:21,245-UNIMOD:510	0.08	23.0	1	1	1
PRT	sp|P62312|LSM6_HUMAN	U6 snRNA-associated Sm-like protein LSm6 OS=Homo sapiens OX=9606 GN=LSM6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	67-UNIMOD:510,74-UNIMOD:21,77-UNIMOD:510	0.15	23.0	1	1	1
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	244-UNIMOD:510,249-UNIMOD:21,255-UNIMOD:4,256-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	392-UNIMOD:510,401-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	161-UNIMOD:510,163-UNIMOD:21,171-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|Q8IXH6|T53I2_HUMAN	Tumor protein p53-inducible nuclear protein 2 OS=Homo sapiens OX=9606 GN=TP53INP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	205-UNIMOD:510,208-UNIMOD:21,214-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	44-UNIMOD:510,45-UNIMOD:21,49-UNIMOD:4,50-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	23.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DSSTSPGDYVLSVSENSR	1	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4160	46.092	2	2012.8788	2012.8788	R	V	39	57
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=4415	48.785	2	2226.9361	2226.9361	R	-	228	248
PSM	SLDSDESEDEEDDYQQK	3	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,7-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1835	26.116	2	2178.8638	2178.8638	K	R	57	74
PSM	DNLTLWTSDQQDDDGGEGNN	4	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:510	ms_run[1]:scan=4316	47.757056666666664	2	2226.9327	2226.9356	R	-	228	248
PSM	INSSGESGDESDEFLQSR	5	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3001	35.32	2	2069.8639	2069.8639	R	K	180	198
PSM	VWLDPNETNEIANANSR	6	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3922	43.589	2	2055.9475	2055.9475	K	Q	22	39
PSM	DSSTSPGDYVLSVSENSR	7	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4160	46.09153666666666	2	2012.8754	2012.8783	R	V	39	57
PSM	YKLDEDEDEDDADLSK	8	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,2-UNIMOD:510,15-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2365	30.161	2	2080.9462	2080.9462	K	Y	167	183
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	9	sp|Q9UPR0-2|PLCL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2224	29.042	3	2847.2212	2847.2212	K	M	445	470
PSM	DATNVGDEGGFAPNILENK	10	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4134	45.783	2	2028.0436	2028.0436	K	E	203	222
PSM	DNLTLWTSDQQDEEAGEGN	11	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=4382	48.425	2	2154.9402	2154.9402	R	-	228	247
PSM	DWEDDSDEDMSNFDR	12	sp|Q15185-4|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2856	34.098	2	1924.7117	1924.7117	K	F	108	123
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	13	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3804	42.459	3	3090.3451	3090.3451	K	E	120	146
PSM	VEMYSGSDDDDDFNK	14	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,3-UNIMOD:35,7-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2032	27.613	2	1899.7394	1899.7394	K	L	131	146
PSM	DYEEVGADSADGEDEGEEY	15	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3631	40.856	2	2191.7691	2191.7691	K	-	431	450
PSM	GAEAANVTGPGGVPVQGSK	16	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,18-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2031	27.605	2	1842.9513	1842.9513	K	Y	119	138
PSM	KEESEESDDDMGFGLFD	17	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4105	45.403	2	2032.8732	2032.8732	K	-	73	90
PSM	ETVSEESNVLCLSK	18	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3131	36.37	2	1661.8818	1661.8818	R	S	581	595
PSM	SDIDEIVLVGGSTR	19	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4282	47.363	2	1573.7813	1573.7813	K	I	354	368
PSM	TPEELDDSDFETEDFDVR	20	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4498	49.703	2	2271.9157	2271.9157	R	S	264	282
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	21	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	ms_run[2]:scan=1388	22.745	3	3241.4532	3241.4532	K	E	269	299
PSM	NPDDITNEEYGEFYK	22	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3591	40.484	2	1900.9003	1900.9003	R	S	300	315
PSM	SQIHDIVLVGGSTR	23	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2990	35.239	2	1594.8292	1594.8292	K	I	329	343
PSM	AITGASLADIMAK	24	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4831	54.092	2	1488.7337	1488.7337	R	R	81	94
PSM	EGLRPGDTTSTFCGTPNYIAPEILR	25	sp|P41743|KPCI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4551	50.346	3	2878.3785	2878.3785	K	G	402	427
PSM	IGRIEDVTPIPSDSTR	26	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=3142	36.448	2	1868.9457	1868.9457	K	R	126	142
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	27	sp|Q9UPR0-2|PLCL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=1723	25.275	3	2863.2161	2863.2161	K	M	445	470
PSM	RVSVCAETYNPDEEEEDTDPR	28	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2506	31.231	3	2624.0798	2624.0798	R	V	97	118
PSM	STAGDTHLGGEDFDNR	29	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=1632	24.608	2	1724.7814	1724.7814	K	M	221	237
PSM	SVTEQGAELSNEER	30	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=1455	23.256	2	1581.7695	1581.7695	K	N	28	42
PSM	TAVVVGTITDDVR	31	sp|Q07020-2|RL18_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3471	39.362	2	1458.7543	1458.7543	K	V	50	63
PSM	TDDEVVQREEEAIQLDGLNASQIR	32	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=4543	50.243	3	2841.3606	2841.3606	R	E	44	68
PSM	SDIDEIVLVGGSTR	33	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=4282	47.363285	2	1573.780629	1573.781286	K	I	354	368
PSM	AFLAELEQNSPK	34	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3830	42.71	2	1493.7803	1493.7803	K	I	2424	2436
PSM	GILAADESTGSIAK	35	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2655	32.421	2	1479.7858	1479.7858	K	R	29	43
PSM	IQALQQQADEAEDR	36	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=1822	26.005	2	1647.8276	1647.8276	K	A	14	28
PSM	TAFQEALDAAGDK	37	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3087	35.999	2	1403.7569	1403.7569	K	L	9	22
PSM	NPDDITQEEYGEFYK	38	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[1]:scan=3659	41.06406	2	1914.912684	1914.915974	R	S	292	307
PSM	ESEDKPEIEDVGSDEEEEK	39	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:510,13-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2078	27.957	3	2374.0685	2374.0685	K	K	251	270
PSM	TDYNASVSVPDSSGPER	40	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2481	31.044	2	1893.8206	1893.8206	R	I	70	87
PSM	YFQINQDEEEEEDED	41	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=3061	35.776	2	1964.786	1964.7860	R	-	114	129
PSM	SQIHDIVLVGGSTR	42	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=2990	35.23912166666667	2	1594.827509	1594.829239	K	I	329	343
PSM	AITGASLADIMAK	43	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,11-UNIMOD:35,13-UNIMOD:510	ms_run[2]:scan=3783	42.274	2	1504.7286	1504.7286	R	R	81	94
PSM	ESEDKPEIEDVGSDEEEEK	44	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=1904	26.656	3	2294.1022	2294.1022	K	K	251	270
PSM	HSGSDRSSFSHYSGLK	45	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,8-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1565	24.097	2	1898.8949	1898.8949	R	H	196	212
PSM	KEESEESDDDMGFGLFD	46	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4584	50.803	2	2112.8395	2112.8395	K	-	73	90
PSM	SLPTTVPESPNYR	47	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2872	34.232	2	1573.7602	1573.7602	R	N	689	702
PSM	SVTEQGAELSNEER	48	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1809	25.909	2	1661.7358	1661.7358	K	N	28	42
PSM	DNLTLWTSDQQDDDGGEGNN	49	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510	ms_run[1]:scan=4426	48.86969333333334	3	2226.935684	2226.936145	R	-	228	248
PSM	DNLTLWTSDTQGDEAEAGEGGEN	50	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=4462	49.296	3	2442.0519	2442.0519	R	-	223	246
PSM	EVDEQMLNVQNK	51	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1592	24.296	2	1529.8032	1529.8032	K	N	325	337
PSM	EVEDKESEGEEEDEDEDLSK	52	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:510,7-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=1581	24.214	3	2521.0853	2521.0853	K	Y	147	167
PSM	FADQDDIGNVSFDR	53	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3730	41.737	2	1711.7303	1711.7303	K	V	489	503
PSM	GNPTVEVDLFTSK	54	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4199	46.451	2	1553.8015	1553.8015	R	G	16	29
PSM	KEESEESDDDMGFGLFD	55	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=5078	57.944	2	2096.8446	2096.8446	K	-	73	90
PSM	LIAPVAEEEATVPNNK	56	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2793	33.574	2	1762.0149	1762.0149	K	I	8	24
PSM	NVDGVNYASITR	57	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2905	34.501	2	1421.6764	1421.6764	R	N	70	82
PSM	TAENATSGETLEENEAGD	58	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=1752	25.488	2	1870.8128	1870.8128	K	-	323	341
PSM	VEMYSGSDDDDDFNK	59	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2942	34.827	2	1883.7445	1883.7445	K	L	131	146
PSM	GAEAANVTGPGGVPVQGSK	60	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,8-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=2031	27.605426666666666	2	1842.947137	1842.951328	K	Y	119	138
PSM	TDYNASVSVPDSSGPER	61	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=2481	31.044003333333333	2	1893.816896	1893.820584	R	I	70	87
PSM	AILVDLEPGTMDSVR	62	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=4261	47.114	2	1744.8531	1744.8531	R	S	63	78
PSM	ELISNASDALDK	63	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2628	32.226	2	1342.7616	1342.7616	R	I	42	54
PSM	GSAPPGPVPEGSIR	64	sp|P78417-2|GSTO1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2039	27.667	2	1433.7128	1433.7128	K	I	12	26
PSM	SYELPDGQVITIGNER	65	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4419	48.816	2	1823.9478	1823.9478	K	F	239	255
PSM	VEMYSGSDDDDDFNK	66	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,3-UNIMOD:35,4-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=2032	27.612968333333335	2	1899.7339	1899.7389	K	L	131	146
PSM	SLDSDESEDEEDDYQQK	67	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=1840	26.153808333333334	3	2178.8602	2178.8633	K	R	57	74
PSM	FNPFVTSDRSK	68	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3572	40.315	2	1524.7051	1524.7051	K	N	3	14
PSM	KEESEESDDDMGFGLFD	69	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4720	52.519	2	2016.8783	2016.8783	K	-	73	90
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	70	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2635	32.276	3	2685.0632	2685.0632	K	M	446	470
PSM	SYELPDGQVITIGNER	71	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4780	53.398	2	1903.9141	1903.9141	K	F	239	255
PSM	VIGSGCNLDSAR	72	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1345	22.396	2	1281.656	1281.6560	R	F	100	112
PSM	VTDSSVSVQLRE	73	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2812	33.714	2	1432.7023	1432.7023	R	-	264	276
PSM	LYCANGHTFQAK	74	sp|P41743|KPCI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,3-UNIMOD:4,8-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=1553	24.010606666666664	2	1556.7467	1556.7478	K	R	135	147
PSM	IEDVTPIPSDSTR	75	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=2736	33.09563166666666	2	1542.7375	1542.7386	R	R	129	142
PSM	STTPPPAEPVSLPQEPPKPR	76	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2731	33.058173333333336	3	2272.2116	2272.2136	K	V	225	245
PSM	AGEEDEGEEDSDSDYEISAK	77	sp|A2RRP1-2|NBAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2242	29.172	2	2321.9221	2321.9221	R	A	463	483
PSM	FNPFVTSDRSK	78	sp|Q9UNX3|RL26L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3713	41.595	2	1524.7051	1524.7051	K	N	3	14
PSM	KSDIDEIVLVGGSTR	79	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3608	40.64	2	1735.9394	1735.9394	K	I	353	368
PSM	RNQSFCPTVNLDK	80	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2491	31.118	2	1725.8546	1725.8546	K	L	65	78
PSM	RNQSFCPTVNLDK	81	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2797	33.604	2	1805.8209	1805.8209	K	L	65	78
PSM	TFDQLTPEESK	82	sp|O43852-12|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2393	30.364	2	1441.7014	1441.7014	K	E	60	71
PSM	TLSNAEDYLDDEDSD	83	sp|Q92882|OSTF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4229	46.787	2	1814.6831	1814.6831	R	-	200	215
PSM	TVIIEQSWGSPK	84	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3651	41.006	2	1491.8011	1491.8011	R	V	61	73
PSM	VTDSSVSVQLRE	85	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2532	31.423	2	1432.7023	1432.7023	R	-	264	276
PSM	DWEDDSDEDMSNFDR	86	sp|Q15185|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=4030	44.602306666666664	2	1989.6822	1988.6822	K	F	108	123
PSM	FASENDLPEWK	87	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=4049	44.80348	2	1482.7063	1482.7063	R	E	58	69
PSM	TAVVVGTITDDVR	88	sp|Q07020|RL18_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=3471	39.36245666666667	2	1458.752904	1458.754343	K	V	79	92
PSM	ASGNYATVISHNPETK	89	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2702	32.801	2	1915.8755	1915.8755	R	K	129	145
PSM	DAHNALLDIQSSGR	90	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3085	35.984	2	1609.7674	1609.7674	K	A	618	632
PSM	EDQTEYLEER	91	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1813	25.939	2	1344.6258	1344.6258	K	R	192	202
PSM	EVYELLDSPGK	92	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3585	40.439	2	1396.7163	1396.7163	K	V	20	31
PSM	GLSQSALPYRR	93	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2667	32.524	2	1440.674	1440.6740	K	S	10	21
PSM	LARASGNYATVISHNPETK	94	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2123	28.289	3	2176.1314	2176.1314	K	K	126	145
PSM	LARASGNYATVISHNPETK	95	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2487	31.088	3	2256.0977	2256.0977	K	K	126	145
PSM	NKPGPNIESGNEDDDASFK	96	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:510,17-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=1820	25.99	3	2215.0531	2215.0531	K	I	206	225
PSM	RQAVTNPNNTFYATK	97	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1644	24.697	2	1871.9567	1871.9567	K	R	107	122
PSM	SLDSDESEDEEDDYQQK	98	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1840	26.154	3	2178.8638	2178.8638	K	R	57	74
PSM	TTPSYVAFTDTER	99	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=3080	35.947	2	1520.7571	1520.7571	R	L	37	50
PSM	DNLTLWTSDMQGDGEEQNK	100	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[1]:scan=4249	46.967661666666665	3	2248.0574	2248.0585	R	E	226	245
PSM	VPTANVSVVDLTCR	101	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=3643	40.943605	2	1643.814712	1643.816626	R	L	235	249
PSM	CLYASVLTAQPR	102	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=3879	43.239	2	1491.7369	1491.7369	R	L	728	740
PSM	DNLNESVITEEK	103	sp|Q9NVR5-2|KTU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2784	33.507	2	1537.7549	1537.7549	K	E	720	732
PSM	DNLTLWTSDMQGDGEEQNK	104	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3634	40.879	3	2264.0539	2264.0539	R	E	204	223
PSM	EEASDYLELDTIK	105	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4018	44.511	2	1592.8458	1592.8458	K	N	253	266
PSM	GDRSEDFGVNEDLADSDAR	106	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2733	33.073	3	2100.9408	2100.9408	K	A	186	205
PSM	GGNFGGRSSGPYGGGGQYFAK	107	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=3272	37.616	3	2247.9776	2247.9776	K	P	225	246
PSM	GNNVLYISTQK	108	sp|P62312|LSM6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2665	32.51	2	1383.7436	1383.7436	R	R	67	78
PSM	IIYGGSVTGATCK	109	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2351	30.059	2	1473.7575	1473.7575	R	E	244	257
PSM	LLQLVEDRGSGR	110	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2529	31.401	2	1455.7659	1455.7659	K	S	392	404
PSM	NFSDNQLQEGK	111	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2128	28.326	2	1426.6766	1426.6766	R	N	161	172
PSM	NQSSFIYQPCQR	112	sp|Q8IXH6|T53I2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=2750	33.213	2	1640.7231	1640.7231	K	Q	205	217
PSM	NTGIICTIGPASR	113	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21,6-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=3294	37.831	2	1552.6934	1552.6934	R	S	44	57
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	114	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:21,33-UNIMOD:510	ms_run[2]:scan=3256	37.429	4	3922.7331	3922.7331	K	E	241	274
PSM	SIYYITGESK	115	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2634	32.269	2	1227.7023	1227.7023	K	E	482	492
PSM	GPLQSVQVFGR	116	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3718	41.631386666666664	2	1300.6745	1300.6748	K	K	5	16