MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100527_011PAK6.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100527_011PAK6.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	228-UNIMOD:510	0.09	43.0	6	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	204-UNIMOD:510,222-UNIMOD:510,213-UNIMOD:35,223-UNIMOD:510,121-UNIMOD:510,131-UNIMOD:510	0.18	42.0	6	3	2
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	8-UNIMOD:510,23-UNIMOD:510,234-UNIMOD:510,244-UNIMOD:510	0.09	41.0	2	2	2
PRT	sp|Q9NQU5|PAK6_HUMAN	Serine/threonine-protein kinase PAK 6 OS=Homo sapiens OX=9606 GN=PAK6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null	111-UNIMOD:510,113-UNIMOD:21,128-UNIMOD:35,132-UNIMOD:21,135-UNIMOD:21,335-UNIMOD:510,347-UNIMOD:21,351-UNIMOD:21,110-UNIMOD:510,129-UNIMOD:21,138-UNIMOD:510,146-UNIMOD:21,147-UNIMOD:4,151-UNIMOD:21,156-UNIMOD:510,177-UNIMOD:510,189-UNIMOD:21,179-UNIMOD:21,157-UNIMOD:510,158-UNIMOD:35,165-UNIMOD:21	0.14	41.0	11	7	1
PRT	sp|Q9NQU5-2|PAK6_HUMAN	Isoform 2 of Serine/threonine-protein kinase PAK 6 OS=Homo sapiens OX=9606 GN=PAK6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	192-UNIMOD:510,192-UNIMOD:4,198-UNIMOD:4,202-UNIMOD:21,207-UNIMOD:21,177-UNIMOD:510,179-UNIMOD:21,189-UNIMOD:21,110-UNIMOD:510,113-UNIMOD:21,128-UNIMOD:35,132-UNIMOD:21,335-UNIMOD:510,346-UNIMOD:21,138-UNIMOD:510,147-UNIMOD:4,151-UNIMOD:21,156-UNIMOD:510,222-UNIMOD:510,224-UNIMOD:21,231-UNIMOD:21,232-UNIMOD:4,157-UNIMOD:510,158-UNIMOD:35,165-UNIMOD:21,375-UNIMOD:510,382-UNIMOD:21,391-UNIMOD:510,332-UNIMOD:510,332-UNIMOD:21,335-UNIMOD:21,351-UNIMOD:21,146-UNIMOD:21,339-UNIMOD:21,347-UNIMOD:21	0.25	40.0	17	10	3
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	75-UNIMOD:510	0.13	40.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	203-UNIMOD:510,221-UNIMOD:510,93-UNIMOD:510,103-UNIMOD:510,97-UNIMOD:35	0.07	40.0	3	2	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	40.0	null	225-UNIMOD:510	0.09	40.0	2	1	0
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	221-UNIMOD:510	0.03	38.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	28-UNIMOD:510,223-UNIMOD:510,28-UNIMOD:21,30-UNIMOD:21	0.16	36.0	7	2	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510,593-UNIMOD:21,728-UNIMOD:510,728-UNIMOD:4,732-UNIMOD:21,639-UNIMOD:510,668-UNIMOD:510,676-UNIMOD:510	0.06	34.0	5	4	3
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,331-UNIMOD:510,336-UNIMOD:21,339-UNIMOD:4,342-UNIMOD:510	0.08	34.0	2	2	2
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	292-UNIMOD:510,306-UNIMOD:510,379-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510,492-UNIMOD:510,457-UNIMOD:510,457-UNIMOD:21,466-UNIMOD:35	0.10	34.0	5	5	5
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	253-UNIMOD:510,265-UNIMOD:510,435-UNIMOD:510,103-UNIMOD:510,114-UNIMOD:510	0.05	33.0	3	3	3
PRT	sp|Q6IBS0|TWF2_HUMAN	Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	137-UNIMOD:510,139-UNIMOD:21,141-UNIMOD:4	0.05	33.0	1	1	1
PRT	sp|P13807-2|GYS1_HUMAN	Isoform 2 of Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	644-UNIMOD:510,646-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	43-UNIMOD:510,57-UNIMOD:510,175-UNIMOD:510,185-UNIMOD:510,100-UNIMOD:510,105-UNIMOD:4	0.15	32.0	3	3	2
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	288-UNIMOD:510,290-UNIMOD:21	0.03	32.0	2	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	325-UNIMOD:510,336-UNIMOD:510,330-UNIMOD:35	0.03	32.0	2	1	0
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	721-UNIMOD:510,726-UNIMOD:4,727-UNIMOD:21,731-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|Q969S3|ZN622_HUMAN	Zinc finger protein 622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	36-UNIMOD:510,38-UNIMOD:21,39-UNIMOD:35	0.03	32.0	2	1	0
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	418-UNIMOD:510,435-UNIMOD:21,441-UNIMOD:510,420-UNIMOD:35	0.05	31.0	2	1	0
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	143-UNIMOD:510,145-UNIMOD:21,155-UNIMOD:510,228-UNIMOD:510	0.14	31.0	2	2	2
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	300-UNIMOD:510,314-UNIMOD:510,59-UNIMOD:510,63-UNIMOD:21,69-UNIMOD:510,547-UNIMOD:510,558-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510,192-UNIMOD:510,490-UNIMOD:510,499-UNIMOD:510,559-UNIMOD:510	0.10	31.0	7	7	7
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	31.0	2	1	0
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	60-UNIMOD:510	0.27	31.0	1	1	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	1369-UNIMOD:510,1375-UNIMOD:21,1376-UNIMOD:4,1381-UNIMOD:510	0.01	30.0	1	1	1
PRT	sp|O00562-2|PITM1_HUMAN	Isoform 2 of Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	662-UNIMOD:510,664-UNIMOD:21,668-UNIMOD:4	0.02	30.0	1	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	207-UNIMOD:510,218-UNIMOD:35	0.14	30.0	2	1	0
PRT	sp|Q9Y4E1-5|WAC2C_HUMAN	Isoform 5 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	452-UNIMOD:510,454-UNIMOD:21,468-UNIMOD:510	0.01	30.0	1	1	1
PRT	sp|Q9BTC0-1|DIDO1_HUMAN	Isoform 1 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	1024-UNIMOD:510,1026-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	null	145-UNIMOD:510,146-UNIMOD:21,151-UNIMOD:4	0.01	30.0	1	1	0
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	39-UNIMOD:510,40-UNIMOD:21	0.09	29.0	1	1	0
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	396-UNIMOD:510	0.05	29.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510,82-UNIMOD:510,92-UNIMOD:510	0.15	29.0	2	2	2
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	145-UNIMOD:510,147-UNIMOD:21,151-UNIMOD:4	0.01	29.0	1	1	0
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	29.0	1	1	1
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	756-UNIMOD:510,760-UNIMOD:21,770-UNIMOD:510	0.02	29.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	29.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	86-UNIMOD:510,89-UNIMOD:21,176-UNIMOD:510,187-UNIMOD:510	0.04	29.0	2	2	2
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	39-UNIMOD:510,41-UNIMOD:21	0.06	29.0	1	1	0
PRT	sp|O00562|PITM1_HUMAN	Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNM1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	null	662-UNIMOD:510,665-UNIMOD:21,668-UNIMOD:4	0.02	29.0	1	1	0
PRT	sp|Q8NBJ7-2|SUMF2_HUMAN	Isoform 2 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	166-UNIMOD:510,168-UNIMOD:21	0.08	28.0	2	1	0
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	28.0	2	1	0
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	322-UNIMOD:510,325-UNIMOD:21,328-UNIMOD:4,334-UNIMOD:510	0.03	28.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	239-UNIMOD:510,40-UNIMOD:510,47-UNIMOD:35,50-UNIMOD:510,52-UNIMOD:21,61-UNIMOD:510,19-UNIMOD:510,360-UNIMOD:510	0.17	28.0	5	4	3
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	131-UNIMOD:510,134-UNIMOD:21,150-UNIMOD:510	0.07	28.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	81-UNIMOD:510,83-UNIMOD:21,86-UNIMOD:21,93-UNIMOD:510	0.09	27.0	1	1	1
PRT	sp|Q99832-2|TCPH_HUMAN	Isoform 2 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	141-UNIMOD:510,141-UNIMOD:4,172-UNIMOD:510	0.08	27.0	2	2	2
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	446-UNIMOD:510,446-UNIMOD:4,447-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	27.0	1	1	1
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	306-UNIMOD:510	0.03	27.0	1	1	1
PRT	sp|Q7L5Y9-3|MAEA_HUMAN	Isoform 3 of E3 ubiquitin-protein transferase MAEA OS=Homo sapiens OX=9606 GN=MAEA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	183-UNIMOD:510,185-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	44-UNIMOD:510	0.12	27.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	1731-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|Q08378-4|GOGA3_HUMAN	Isoform 3 of Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	495-UNIMOD:510,497-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	4-UNIMOD:510,187-UNIMOD:510,194-UNIMOD:4	0.03	27.0	2	2	2
PRT	sp|P16083|NQO2_HUMAN	Ribosyldihydronicotinamide dehydrogenase [quinone] OS=Homo sapiens OX=9606 GN=NQO2 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	78-UNIMOD:510,80-UNIMOD:21,90-UNIMOD:510	0.06	27.0	2	1	0
PRT	sp|P63146|UBE2B_HUMAN	Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	140-UNIMOD:510,142-UNIMOD:21	0.09	27.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	240-UNIMOD:510,250-UNIMOD:510	0.03	27.0	2	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	235-UNIMOD:510,237-UNIMOD:21,241-UNIMOD:21,247-UNIMOD:4,310-UNIMOD:510,312-UNIMOD:21	0.09	27.0	4	2	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	50-UNIMOD:510,61-UNIMOD:510,64-UNIMOD:21,563-UNIMOD:510,573-UNIMOD:510,102-UNIMOD:510,113-UNIMOD:510	0.08	27.0	4	4	4
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	null	233-UNIMOD:510,243-UNIMOD:510	0.04	27.0	1	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	329-UNIMOD:510,330-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	26.0	1	1	1
PRT	sp|P34932-2|HSP74_HUMAN	Isoform 2 of Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	20-UNIMOD:510	0.10	26.0	1	1	1
PRT	sp|Q16513-5|PKN2_HUMAN	Isoform 5 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	25-UNIMOD:510,26-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	223-UNIMOD:510,237-UNIMOD:4	0.10	26.0	2	1	0
PRT	sp|Q96K76-2|UBP47_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	916-UNIMOD:510,927-UNIMOD:21,936-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	380-UNIMOD:510,385-UNIMOD:21,192-UNIMOD:510,194-UNIMOD:21,207-UNIMOD:510,208-UNIMOD:510	0.04	26.0	2	2	2
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	482-UNIMOD:510,493-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	461-UNIMOD:510,462-UNIMOD:21,480-UNIMOD:510	0.01	26.0	1	1	0
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	19-UNIMOD:510,19-UNIMOD:21,50-UNIMOD:510,21-UNIMOD:21	0.07	26.0	2	1	0
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	48-UNIMOD:510,51-UNIMOD:21,62-UNIMOD:510	0.09	26.0	1	1	1
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	null	536-UNIMOD:510,539-UNIMOD:21,555-UNIMOD:510	0.01	26.0	1	1	0
PRT	sp|Q9HCN4-3|GPN1_HUMAN	Isoform 3 of GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	203-UNIMOD:510,206-UNIMOD:21,215-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	82-UNIMOD:510	0.09	25.0	1	1	1
PRT	sp|P61158|ARP3_HUMAN	Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	229-UNIMOD:510,232-UNIMOD:21,235-UNIMOD:4,240-UNIMOD:510,231-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	186-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	237-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	129-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	93-UNIMOD:510,95-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	74-UNIMOD:510,76-UNIMOD:35	0.11	24.0	2	1	0
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	115-UNIMOD:510	0.09	24.0	1	1	1
PRT	sp|Q13625-2|ASPP2_HUMAN	Isoform 2 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	611-UNIMOD:510,613-UNIMOD:21,628-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	853-UNIMOD:510,855-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	22-UNIMOD:510,24-UNIMOD:21,26-UNIMOD:4,27-UNIMOD:4,44-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|Q86X27-3|RGPS2_HUMAN	Isoform 3 of Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Homo sapiens OX=9606 GN=RALGPS2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	315-UNIMOD:510,315-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	107-UNIMOD:510,110-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	78-UNIMOD:510,88-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|P22492|H1T_HUMAN	Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	69-UNIMOD:510,79-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	152-UNIMOD:510,152-UNIMOD:4,162-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	519-UNIMOD:510,521-UNIMOD:21,532-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	411-UNIMOD:510,578-UNIMOD:510,589-UNIMOD:510,334-UNIMOD:510	0.05	23.0	3	3	3
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	132-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	237-UNIMOD:510,246-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	18-UNIMOD:510,19-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	650-UNIMOD:510,652-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	182-UNIMOD:510,192-UNIMOD:510,204-UNIMOD:510,206-UNIMOD:21,210-UNIMOD:35,215-UNIMOD:35	0.12	23.0	2	2	2
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	478-UNIMOD:510,480-UNIMOD:21,494-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	378-UNIMOD:510,380-UNIMOD:21,390-UNIMOD:510	0.04	23.0	2	1	0
PRT	sp|O00469-3|PLOD2_HUMAN	Isoform 3 of Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	101-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	134-UNIMOD:510,142-UNIMOD:510,145-UNIMOD:21,154-UNIMOD:510	0.07	23.0	1	1	1
PRT	sp|Q8N163|CCAR2_HUMAN	Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	910-UNIMOD:510,912-UNIMOD:21,916-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	8-UNIMOD:510	0.07	22.0	1	1	1
PRT	sp|P15328|FOLR1_HUMAN	Folate receptor alpha OS=Homo sapiens OX=9606 GN=FOLR1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	137-UNIMOD:510,139-UNIMOD:4,146-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	330-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	7-UNIMOD:510,8-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	480-UNIMOD:510,483-UNIMOD:21,491-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	58-UNIMOD:510,63-UNIMOD:21	0.09	22.0	1	1	1
PRT	sp|P24752-2|THIL_HUMAN	Isoform 2 of Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	67-UNIMOD:510,69-UNIMOD:21,78-UNIMOD:510	0.08	22.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	240-UNIMOD:510,242-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	168-UNIMOD:510,175-UNIMOD:35,123-UNIMOD:510,126-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	97-UNIMOD:510,100-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	264-UNIMOD:510,267-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	37-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	67-UNIMOD:510,75-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	190-UNIMOD:510,202-UNIMOD:510,85-UNIMOD:510,94-UNIMOD:510	0.08	21.0	2	2	2
PRT	sp|Q9H3K6-2|BOLA2_HUMAN	Isoform 2 of BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	15-UNIMOD:510	0.29	21.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	77-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	125-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	20-UNIMOD:510,30-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510,40-UNIMOD:510,50-UNIMOD:510	0.12	21.0	2	2	2
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	58-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1682-UNIMOD:510,1684-UNIMOD:21,1691-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	131-UNIMOD:510,135-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	225-UNIMOD:510,226-UNIMOD:21,242-UNIMOD:510,227-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	342-UNIMOD:510,342-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q16719-2|KYNU_HUMAN	Isoform 2 of Kynureninase OS=Homo sapiens OX=9606 GN=KYNU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	85-UNIMOD:510,93-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	327-UNIMOD:510,328-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	186-UNIMOD:510,188-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P31327-3|CPSM_HUMAN	Isoform 3 of Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	926-UNIMOD:510,926-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	1062-UNIMOD:510,1069-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	194-UNIMOD:510,202-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	173-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	97-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	126-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	225-UNIMOD:510,229-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	25-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	91-UNIMOD:510,94-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|P28066|PSA5_HUMAN	Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	11-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	179-UNIMOD:510,181-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	58-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|P28072|PSB6_HUMAN	Proteasome subunit beta type-6 OS=Homo sapiens OX=9606 GN=PSMB6 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	210-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	87-UNIMOD:510,154-UNIMOD:510	0.06	20.0	2	2	2
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	80-UNIMOD:510,82-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	760-UNIMOD:510,761-UNIMOD:4,762-UNIMOD:21,766-UNIMOD:4,769-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|O14579-3|COPE_HUMAN	Isoform 3 of Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	97-UNIMOD:510,99-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	43-UNIMOD:510,45-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	122-UNIMOD:510,124-UNIMOD:21,131-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	111-UNIMOD:510,120-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P23526-2|SAHH_HUMAN	Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	187-UNIMOD:510,198-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	98-UNIMOD:510,107-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|P60981-2|DEST_HUMAN	Isoform 2 of Destrin OS=Homo sapiens OX=9606 GN=DSTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	65-UNIMOD:510,75-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	85-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	762-UNIMOD:510,762-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|A0JNW5|UH1BL_HUMAN	UHRF1-binding protein 1-like OS=Homo sapiens OX=9606 GN=UHRF1BP1L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	259-UNIMOD:510,267-UNIMOD:21	0.01	20.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=4813	49.492	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	2	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4593	47.219	2	2248.059	2248.0590	R	E	204	223
PSM	LIAPVAEEEATVPNNK	3	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2846	33.048	2	1762.0149	1762.0149	K	I	8	24
PSM	AQSLGLLGDEHWATDPDMYLQSPQSER	4	sp|Q9NQU5|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=5532	58.54074	3	3253.3901	3253.3883	R	T	111	138
PSM	CLQLGACLQSSPPGASPPTGTNR	5	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=4445	45.807	2	2562.1221	2562.1221	R	H	192	215
PSM	DWEDDSDEDMSNFDR	6	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=4094	42.731	2	1908.7168	1908.7168	K	F	75	90
PSM	TPEELDDSDFETEDFDVR	7	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4882	50.108	2	2271.9157	2271.9157	R	S	264	282
PSM	DATNVGDEGGFAPNILENK	8	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[1]:scan=4417	45.55027666666667	2	2028.0454	2028.0431	K	E	203	222
PSM	DNLTLWTSENQGDEGDAGEGEN	9	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:510	ms_run[1]:scan=4692	48.2586	2	2384.0103	2384.0095	R	-	225	247
PSM	AQSLGLLGDEHWATDPDMYLQSPQSER	10	sp|Q9NQU5|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:35,25-UNIMOD:21	ms_run[1]:scan=5532	58.54074	3	3253.390630	3253.388859	R	T	111	138
PSM	STAGDTHLGGEDFDNR	11	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=1687	24.67	2	1724.7814	1724.7814	K	M	221	237
PSM	DNLTLWTSDQQDDDGGEGNN	12	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=5017	51.52	2	2226.9361	2226.9361	R	-	228	248
PSM	TAPATGQLPGRSSPAGSPR	13	sp|Q9NQU5|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:510,13-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1697	24.743096666666666	2	2000.9304	2000.9289	R	T	335	354
PSM	AQSLGPAEFQGASQR	14	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=3353	36.783	2	1739.7493	1739.7493	K	C	177	192
PSM	DNLTLWTSDMQGDGEEQNK	15	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3895	41.134	2	2264.0539	2264.0539	R	E	204	223
PSM	DNLTLWTSDQQDDDGGEGNN	16	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=4720	48.485	2	2226.9361	2226.9361	R	-	228	248
PSM	SVTEQGAELSNEER	17	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=1538	23.611	2	1581.7695	1581.7695	K	N	28	42
PSM	DNLTLWTSDTQGDEAEAGEGGEN	18	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=4852	49.862	2	2442.0519	2442.0519	R	-	223	246
PSM	TDYNASVSVPDSSGPER	19	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2623	31.428	2	1893.8206	1893.8206	R	I	70	87
PSM	ETVSEESNVLCLSK	20	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3281	36.253	2	1661.8818	1661.8818	R	S	581	595
PSM	ETVSEESNVLCLSK	21	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:4,13-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3633	38.872	2	1741.8482	1741.8482	R	S	581	595
PSM	GILAADESTGSIAK	22	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2751	32.353	2	1479.7858	1479.7858	K	R	29	43
PSM	NPDDITQEEYGEFYK	23	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3911	41.255	2	1914.916	1914.9160	R	S	292	307
PSM	RAQSLGLLGDEHWATDPDMYLQSPQSER	24	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,4-UNIMOD:21,19-UNIMOD:35,23-UNIMOD:21	ms_run[2]:scan=5146	52.991	3	3409.49	3409.4900	R	T	110	138
PSM	EEASDYLELDTIK	25	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4264	44.209	2	1592.8458	1592.8458	K	N	253	266
PSM	HLSSCAAPAPLTSAER	26	sp|Q6IBS0|TWF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2004	26.982	2	1780.8392	1780.8392	K	E	137	153
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	27	sp|P13807-2|GYS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3445	37.481	3	3219.4993	3219.4993	K	-	644	674
PSM	DLADELALVDVIEDK	28	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6056	67.455	2	1724.972	1724.9720	K	L	43	58
PSM	DNLTLWTSDQQDDDGGEGNN	29	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=4816	49.529	3	2226.9361	2226.9361	R	-	228	248
PSM	ELSLAGNELGDEGAR	30	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3839	40.527	2	1643.7616	1643.7616	K	L	288	303
PSM	EVDEQMLNVQNK	31	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2643	31.569	2	1513.8083	1513.8083	K	N	325	337
PSM	QNPSRCSVSLSNVEAR	32	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=2083	27.544	2	1916.8988	1916.8988	R	R	721	737
PSM	SVTEQGAELSNEER	33	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1925	26.412	2	1661.7358	1661.7358	K	N	28	42
PSM	VASMAPVTAEGFQER	34	sp|Q969S3|ZN622_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=2675	31.803	2	1721.7908	1721.7908	K	V	36	51
PSM	VASMAPVTAEGFQER	35	sp|Q969S3|ZN622_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3503	37.906	2	1705.7959	1705.7959	K	V	36	51
PSM	AQSLGLLGDEHWATDPDMYLQSPQSER	36	sp|Q9NQU5|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=5672	60.713521666666665	3	3237.3957	3237.3934	R	T	111	138
PSM	RAQSLGLLGDEHWATDPDMYLQSPQSER	37	sp|Q9NQU5|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,4-UNIMOD:21,19-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=5146	52.991055	3	3409.491207	3409.489970	R	T	110	138
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	38	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2604	31.29	3	2810.1902	2810.1902	R	E	418	442
PSM	KNSVVEASEAAYK	39	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1614	24.153	2	1576.8598	1576.8598	K	E	143	156
PSM	NPDDITNEEYGEFYK	40	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3858	40.791	2	1900.9003	1900.9003	R	S	300	315
PSM	RVSVCAETYNPDEEEEDTDPR	41	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2632	31.493	3	2624.0798	2624.0798	R	V	97	118
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	42	sp|Q9BXV9|GON7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=2790	32.64	3	2865.1757	2865.1757	R	T	60	86
PSM	TDPHGLYLSCNGGTPAGHK	43	sp|Q9NQU5|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=2388	29.743848333333332	2	2208.9705	2208.9696	R	Q	138	157
PSM	AQSLGPAEFQGASQR	44	sp|Q9NQU5|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=2803	32.73563333333333	2	1659.7837	1659.7825	K	C	177	192
PSM	DNLTLWTSENQGDEGDAGEGEN	45	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510	ms_run[1]:scan=4688	48.227205	3	2384.0127	2384.0095	R	-	225	247
PSM	AELFTQSCADLDK	46	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=3793	40.124	2	1644.7743	1644.7743	K	W	1369	1382
PSM	CLQLGACLQSSPPGASPPTGTNR	47	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=4421	45.582	3	2562.1221	2562.1221	R	H	192	215
PSM	DNLTLWTSDQQDDDGGEGNN	48	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=4916	50.498	2	2226.9361	2226.9361	R	-	228	248
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	49	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2138	27.944	3	2826.1852	2826.1852	R	E	418	442
PSM	RASTAFCPPAASSEAPDGPSSTAR	50	sp|O00562-2|PITM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2244	28.702	3	2504.1215	2504.1215	R	L	662	686
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	51	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:35	ms_run[2]:scan=4219	43.793	3	3506.5004	3506.5004	R	-	207	238
PSM	VQSTADIFGDEEGDLFK	52	sp|Q9Y4E1-5|WAC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=5479	57.661	2	2017.9558	2017.9558	K	E	452	469
PSM	YLSVPPSPNISTSESR	53	sp|Q9BTC0-1|DIDO1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3441	37.452	2	1846.8926	1846.8926	R	S	1024	1040
PSM	GVVDSEDLPLNISR	54	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510	ms_run[1]:scan=4025	42.18319833333334	2	1546.8431	1546.8410	R	E	379	393
PSM	HSSLAGCQIINYR	55	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=2789	32.63326666666667	2	1631.772443	1631.770344	R	T	145	158
PSM	DSSTSPGDYVLSVSENSR	56	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4521	46.509	2	2012.8788	2012.8788	R	V	39	57
PSM	DYEEVGVDSVEGEGEEEGEEY	57	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=4565	46.972	2	2381.9607	2381.9607	K	-	396	417
PSM	HELQANCYEEVK	58	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1398	22.607	2	1586.8035	1586.8035	K	D	133	145
PSM	HSSLAGCQIINYR	59	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2789	32.633	2	1631.7703	1631.7703	R	T	145	158
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	60	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4929	50.628	3	2995.386	2995.3860	R	G	2913	2938
PSM	RALANSLACQGK	61	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1163	20.883	2	1435.7643	1435.7643	K	Y	331	343
PSM	SAADSISESVPVGPK	62	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2922	33.606	2	1590.8179	1590.8179	R	V	756	771
PSM	TAFQEALDAAGDK	63	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3230	35.865	2	1403.7569	1403.7569	K	L	9	22
PSM	TTPSVVAFTADGER	64	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3659	39.069	2	1563.7394	1563.7394	R	L	86	100
PSM	DSSTSPGDYVLSVSENSR	65	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=4521	46.509186666666665	2	2012.8809	2012.8783	R	V	39	57
PSM	RASTAFCPPAASSEAPDGPSSTAR	66	sp|O00562|PITM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=2244	28.701555	3	2504.124631	2504.121535	R	L	662	686
PSM	GASWIDTADGSANHR	67	sp|Q8NBJ7-2|SUMF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2833	32.954	3	1670.7262	1670.7262	R	A	166	181
PSM	KEESEESDDDMGFGLFD	68	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4396	45.361	2	2032.8732	2032.8732	K	-	73	90
PSM	QVQSLTCEVDALK	69	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=4305	44.537	2	1637.8372	1637.8372	R	G	322	335
PSM	RVSVCAETYNPDEEEEDTDPR	70	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2636	31.518	2	2624.0798	2624.0798	R	V	97	118
PSM	SYELPDGQVITIGNER	71	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=4709	48.389	2	1823.9478	1823.9478	K	F	239	255
PSM	YLRSVGDGETVEFDVVEGEK	72	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4242	44	3	2375.157	2375.1570	K	G	131	151
PSM	AITGASLADIMAK	73	sp|P83731|RL24_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5226	54.034	2	1488.7337	1488.7337	R	R	81	94
PSM	CQVFEETQIGGER	74	sp|Q99832-2|TCPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=2752	32.36	2	1585.7619	1585.7619	R	Y	141	154
PSM	CSVLAAANPVYGR	75	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21	ms_run[2]:scan=3531	38.11	2	1490.7165	1490.7165	R	Y	446	459
PSM	DNLTLWTSDTQGDEAEAGEGGEN	76	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4850	49.847	3	2442.0519	2442.0519	R	-	223	246
PSM	DNLTLWTSDTQGDEAEAGEGGEN	77	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4961	50.911	3	2442.0519	2442.0519	R	-	223	246
PSM	DVIELTDDSFDK	78	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=4472	46.054	2	1463.7668	1463.7668	K	N	158	170
PSM	EALQDVEDENQ	79	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=2219	28.52	2	1322.605	1322.6050	K	-	223	234
PSM	EVDEQMLNVQNK	80	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1668	24.541	2	1529.8032	1529.8032	K	N	325	337
PSM	GASWIDTADGSANHR	81	sp|Q8NBJ7-2|SUMF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2835	32.968	2	1670.7262	1670.7262	R	A	166	181
PSM	GSTDNLMDDIER	82	sp|P50990-3|TCPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=3563	38.34	2	1398.6509	1398.6509	R	A	306	318
PSM	HFSQAEGSQLDEVR	83	sp|Q7L5Y9-3|MAEA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2237	28.65	3	1715.7728	1715.7728	K	Q	183	197
PSM	HGYIGEFEIIDDHR	84	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=3619	38.768	3	1733.8586	1733.8586	K	A	44	58
PSM	IAQLEEELEEEQGNTELINDR	85	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4632	47.661	3	2505.2295	2505.2295	R	L	1731	1752
PSM	IRYESLTDPSK	86	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2718	32.113	2	1455.7647	1455.7647	K	L	59	70
PSM	KEESEESDDDMGFGLFD	87	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=5103	52.482	2	2016.8783	2016.8783	K	-	73	90
PSM	NASLASSNNDLQVAEEQYQR	88	sp|Q08378-4|GOGA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3865	40.856	3	2350.0651	2350.0651	K	L	495	515
PSM	NGSEADIDEGLYSR	89	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=2528	30.747	2	1558.7323	1558.7323	K	Q	4	18
PSM	QRSLASDITDEQK	90	sp|P16083|NQO2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2054	27.337	2	1637.8298	1637.8298	K	K	78	91
PSM	QVVESAYEVIK	91	sp|P00338-4|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2920	33.592	2	1331.7973	1331.7973	K	L	175	186
PSM	RVSAIVEQSWNDS	92	sp|P63146|UBE2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3860	40.806	2	1603.7456	1603.7456	K	-	140	153
PSM	TGLYNYYDDEK	93	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2898	33.432	2	1447.7144	1447.7144	R	E	240	251
PSM	VPTANVSVVDLTCR	94	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4314	44.606	2	1723.783	1723.7830	R	L	235	249
PSM	AQSLGLLGDEHWATD	95	sp|Q9NQU5|PAK6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=5149	53.014246666666665	2	1725.7843	1725.7818	R	P	111	126
PSM	AQSLGPAEFQGASQR	96	sp|Q9NQU5|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2999	34.174051666666664	2	1659.7837	1659.7825	K	C	177	192
PSM	VEIIANDQGNR	97	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510	ms_run[1]:scan=1524	23.514854999999997	2	1261.685047	1261.683881	R	I	50	61
PSM	QVVESAYEVIK	98	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[1]:scan=2925	33.62827166666667	2	1331.798795	1331.797302	K	L	233	244
PSM	ASLEAAIADAEQR	99	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4350	44.937484999999995	2	1457.6991	1457.6970	R	G	329	342
PSM	AFLAELEQNSPK	100	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4078	42.609	2	1493.7803	1493.7803	K	I	2424	2436
PSM	AGGIETIANEYSDR	101	sp|P34932-2|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=3310	36.469	2	1528.7582	1528.7582	R	C	20	34
PSM	ATSVALPGWSPSETR	102	sp|Q16513-5|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4170	43.372	2	1671.8082	1671.8082	K	S	25	40
PSM	DNLTLWTSDMQGDGEEQNK	103	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4582	47.12	3	2248.059	2248.0590	R	E	204	223
PSM	DNLTLWTSDSAGEECDAAEGAEN	104	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=4938	50.728	2	2488.0396	2488.0396	R	-	223	246
PSM	DNPGVVTCLDEAR	105	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:4	ms_run[2]:scan=2959	33.881	2	1478.7248	1478.7248	K	H	187	200
PSM	ETWDTAEEDSGTDSEYDESGK	106	sp|Q96K76-2|UBP47_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=2970	33.959	3	2497.9806	2497.9806	K	S	916	937
PSM	HQGVMVGMGQKDSYVGDEAQSK	107	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:35,11-UNIMOD:510,13-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=1579	23.902	3	2548.2188	2548.2188	R	R	40	62
PSM	LISWYDNEFGYSNR	108	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5242	54.208	2	1876.8245	1876.8245	K	V	310	324
PSM	LYRPGSVAYVSR	109	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2256	28.787	2	1480.7652	1480.7652	K	S	380	392
PSM	NAGVEGSLIVEK	110	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2446	30.153	2	1282.7769	1282.7769	K	I	482	494
PSM	RLSQSDEDVIR	111	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1731	24.985	2	1430.6979	1430.6979	K	L	119	130
PSM	RSSSAEESGQDVLENTFSQK	112	sp|Q14789-4|GOGB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=3766	39.91	3	2346.1013	2346.1013	K	H	461	481
PSM	SIYYITGESK	113	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2688	31.897	2	1227.7023	1227.7023	K	E	482	492
PSM	TAPATGQLPGRSSPAGSPR	114	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=1448	22.97	2	1920.9631	1920.9631	R	T	335	354
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	115	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,32-UNIMOD:510	ms_run[2]:scan=1888	26.149	3	2580.1514	2580.1514	R	A	19	51
PSM	TAPATGQLPGRSSPAGSPR	116	sp|Q9NQU5|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=1448	22.969991666666665	2	1920.9652	1920.9626	R	T	335	354
PSM	NRPTSISWDGLDSGK	117	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3639	38.91746333333333	2	1779.8844	1779.8824	K	L	48	63
PSM	TGLYNYYDDEK	118	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[1]:scan=2915	33.555335	2	1447.7141	1447.7138	R	E	240	251
PSM	RSSSAEESGQDVLENTFSQK	119	sp|Q14789|GOGB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=3766	39.90990166666666	3	2346.104191	2346.101299	K	H	536	556
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	120	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,32-UNIMOD:510	ms_run[1]:scan=1888	26.148861666666665	3	2580.154543	2580.151437	R	A	19	51
PSM	DMGSVALDAGTAK	121	sp|Q9HCN4-3|GPN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3470	37.665	2	1382.6789	1382.6789	K	D	203	216
PSM	DNLTLWTSDQQDDDGGEGNN	122	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=4921	50.552	3	2226.9361	2226.9361	R	-	228	248
PSM	DQGTYEDYVEGLR	123	sp|P60660-2|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=4233	43.928	2	1577.7422	1577.7422	K	V	82	95
PSM	EAAENSLVAYK	124	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2013	27.047	2	1261.7191	1261.7191	K	A	121	132
PSM	ELSLAGNELGDEGAR	125	sp|P13489|RINI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3316	36.512	2	1563.7953	1563.7953	K	L	288	303
PSM	ERYSYVCPDLVK	126	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=3194	35.601	2	1675.8317	1675.8317	K	E	229	241
PSM	GDRSEDFGVNEDLADSDAR	127	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=2870	33.223	3	2100.9408	2100.9408	K	A	186	205
PSM	GGIVDEGALLR	128	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3414	37.251	2	1132.6664	1132.6664	R	A	237	248
PSM	GVVDSDDLPLNVSR	129	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3684	39.257	2	1518.8102	1518.8102	K	E	435	449
PSM	LGDVYVNDAFGTAHR	130	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3368	36.893	3	1667.848	1667.8480	K	A	129	144
PSM	AQSLGPAEFQGASQR	131	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2803	32.736	2	1659.783	1659.7830	K	C	177	192
PSM	AQSQTDRVDLGTLR	132	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2542	30.845	2	1672.8358	1672.8358	K	G	93	107
PSM	CLYASVLTAQPR	133	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=4135	43.053	2	1491.7369	1491.7369	R	L	728	740
PSM	EGLELPEDEEEK	134	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2820	32.858	2	1483.7566	1483.7566	K	K	547	559
PSM	EGMNIVEAMER	135	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:35	ms_run[2]:scan=2890	33.373	2	1327.6324	1327.6324	K	F	74	85
PSM	ELISNSSDALDK	136	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2165	28.135	2	1358.7566	1358.7566	R	I	47	59
PSM	EQISDIDDAVR	137	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2667	31.743	2	1293.6625	1293.6625	K	K	115	126
PSM	GGAEQFMEETER	138	sp|Q99832-2|TCPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2619	31.398	2	1416.6404	1416.6404	R	S	172	184
PSM	ITPSYVAFTPEGER	139	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4086	42.669	2	1679.802	1679.8020	R	L	61	75
PSM	KRSSITEPEGPNGPNIQK	140	sp|Q13625-2|ASPP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=1365	22.367	3	2133.168	2133.1680	K	L	611	629
PSM	LGSLVENNER	141	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2229	28.593	2	1243.6022	1243.6022	K	V	853	863
PSM	LMIEMDGTENK	142	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3028	34.386	2	1347.7051	1347.7051	K	S	93	104
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	143	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,6-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=3886	41.068	3	2895.1876	2895.1876	R	L	22	47
PSM	SVAAEGALLPQTPPSPR	144	sp|Q86X27-3|RGPS2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3807	40.243	2	1803.9344	1803.9344	K	N	315	332
PSM	TDPHGLYLSCNGGTPAGHK	145	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2023	27.118	3	2129.0038	2129.0038	R	Q	138	157
PSM	YALYDATYETK	146	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3012	34.271	2	1404.7449	1404.7449	R	E	82	93
PSM	DVLSVAFSSDNR	147	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=5021	51.579135	2	1422.6619	1422.6599	K	Q	107	119
PSM	AGNFYVPAEPK	148	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2621	31.413	2	1259.7187	1259.7187	K	L	78	89
PSM	ALAAAGYDVEK	149	sp|P22492|H1T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2006	26.996	2	1174.687	1174.6870	K	N	69	80
PSM	CDENILWLDYK	150	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=4876	50.061	2	1535.7966	1535.7967	K	N	152	163
PSM	DVTPPPETEVVLIK	151	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4651	47.838	2	1683.9372	1683.9372	K	N	519	533
PSM	EQVANSAFVER	152	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1719	24.9	2	1282.673	1282.6730	K	V	492	503
PSM	EVFEDAAEIR	153	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2834	32.961	2	1211.6246	1211.6246	K	L	411	421
PSM	GEFVTTVQQR	154	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1692	24.706	2	1197.6566	1197.6566	K	G	132	142
PSM	GYFEYIEENK	155	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3720	39.527	2	1358.7031	1358.7031	R	Y	237	247
PSM	HGSEEARPQSCLVGSATGR	156	sp|Q9NQU5-2|PAK6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=1764	25.223	3	2191.9295	2191.9295	K	P	222	241
PSM	HSSVYPTQEELEAVQNMVSHTER	157	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4994	51.282	3	2784.2638	2784.2638	K	A	18	41
PSM	NDSWGSFDLR	158	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4695	48.282	2	1309.5552	1309.5552	R	A	650	660
PSM	NFSDNQLQEGK	159	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1726	24.949	2	1346.7103	1346.7103	R	N	182	193
PSM	QLSSSVTGLTNIEEENCQR	160	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=3963	41.701	3	2278.0361	2278.0361	K	Y	478	497
PSM	QMPWPEPQSPR	161	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=2633	31.498	2	1481.6587	1481.6587	K	V	157	168
PSM	RMTGSEFDFEEMK	162	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3995	41.941	2	1753.7729	1753.7729	K	R	378	391
PSM	SEDYVDIVQGNR	163	sp|O00469-3|PLOD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=3154	35.309	2	1427.7105	1427.7105	R	V	101	113
PSM	VPTANVSVVDLTCR	164	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3855	40.756	2	1643.8166	1643.8166	R	L	235	249
PSM	NGSLDSPGKQDTEEDEEEDEK	165	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,9-UNIMOD:510,12-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=1260	21.602225	3	2532.1152	2532.1120	K	D	134	155
PSM	ADSWVEKEEPAPSN	166	sp|Q8N163|CCAR2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:510	ms_run[2]:scan=2802	32.728	2	1705.7873	1705.7873	K	-	910	924
PSM	AGFAGDDAPR	167	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1135	20.677	2	1009.5041	1009.5041	K	A	19	29
PSM	DNLTLWTSDQQDEEAGEGN	168	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4777	49.104	2	2154.9402	2154.9402	R	-	228	247
PSM	DVNQQEFVR	169	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2025	27.133	2	1167.6097	1167.6097	K	A	8	17
PSM	EDCEQWWEDCR	170	sp|P15328|FOLR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=3778	40.014	2	1645.635	1645.6350	K	T	137	148
PSM	ELISNASDALDK	171	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2712	32.07	2	1342.7616	1342.7616	R	I	103	115
PSM	GALAGEDTGVVTHEQFK	172	sp|Q9NQU5-2|PAK6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=2721	32.134	3	1905.951	1905.9510	K	A	375	392
PSM	GATQQILDEAER	173	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2408	29.886	2	1363.7156	1363.7156	R	S	330	342
PSM	GTVTDFPGFDER	174	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4278	44.314	2	1453.6339	1453.6339	R	A	7	19
PSM	HTLSYVDVGTGK	175	sp|P31040-3|SDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2230	28.6	2	1423.7385	1423.7385	K	V	480	492
PSM	INPDGSQSVVEVPYAR	176	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3617	38.753	2	1843.893	1843.8930	R	S	58	74
PSM	LGSIAIQGAIEK	177	sp|P24752-2|THIL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4118	42.91	2	1346.7847	1346.7847	K	A	67	79
PSM	LMIEMDGTENK	178	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=1793	25.473	2	1363.7	1363.7000	K	S	93	104
PSM	MVVESAYEVIK	179	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3522	38.045	2	1334.7792	1334.7792	K	L	234	245
PSM	NELESYAYSLK	180	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3746	39.762	2	1383.7558	1383.7558	R	N	563	574
PSM	QMPWPEPQSPR	181	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=3534	38.133	2	1481.6587	1481.6587	K	V	157	168
PSM	RVSHQGYSTEAEFEEPR	182	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1897	26.214	3	2134.9533	2134.9533	R	V	240	257
PSM	SLEDQVEMLR	183	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:35	ms_run[2]:scan=3300	36.395	2	1268.6495	1268.6495	K	T	168	178
PSM	SLQSVAEER	184	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2353	29.492	2	1131.5385	1131.5385	R	A	97	106
PSM	SVTEQGAELSNEER	185	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1928	26.433	3	1661.7358	1661.7358	K	N	28	42
PSM	TASFSESRADEVAPAKK	186	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510,17-UNIMOD:510	ms_run[2]:scan=1486	23.241	3	1975.0512	1975.0512	R	A	192	209
PSM	VIGSGCNLDSAR	187	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1383	22.498	2	1281.656	1281.6560	R	F	100	112
PSM	VTDSSVSVQLRE	188	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2960	33.888	2	1432.7023	1432.7023	R	-	264	276
PSM	YEWDVAEAR	189	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3011	34.264	2	1171.5722	1171.5722	K	K	639	648
PSM	QMPWPEPQSPR	190	sp|Q9NQU5|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,2-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=3059	34.61331333333333	2	1481.6602	1481.6581	K	V	157	168
PSM	TTPSYVAFTDTER	191	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510	ms_run[1]:scan=3200	35.644146666666664	2	1520.759252	1520.757106	R	L	37	50
PSM	ALRTDYNASVSVPDSSGPER	192	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=2695	31.947176666666667	3	2235.0482	2234.0422	K	I	67	87
PSM	SVTEQGAELSNEER	193	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1928	26.433104999999998	3	1661.737877	1661.735792	K	N	28	42
PSM	QNPSRCSVSLSNVEAR	194	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,6-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=2083	27.543658333333333	2	1916.900327	1916.898792	R	R	721	737
PSM	DIVVQETMEDIDK	195	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4461	45.958	2	1601.8495	1601.8495	K	N	190	203
PSM	DLEAEHVEVEDTTLNR	196	sp|Q9H3K6-2|BOLA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3085	34.8	3	1902.9383	1902.9383	R	C	15	31
PSM	DLIHDQDEDEEEEEGQR	197	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1992	26.894	3	2118.9038	2118.9038	R	F	77	94
PSM	DNNQFASASLDR	198	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2296	29.078	2	1370.6639	1370.6639	K	T	125	137
PSM	EDQTEYLEER	199	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1927	26.426	2	1344.6258	1344.6258	K	R	192	202
PSM	ETAENYLGHTAK	200	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1389	22.541	3	1400.7572	1400.7572	K	N	176	188
PSM	EVYELLDSPGK	201	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3397	37.11	2	1316.75	1316.7500	K	V	20	31
PSM	FASENDLPEWK	202	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4354	44.968	2	1482.7068	1482.7068	R	E	58	69
PSM	GASQAGMTGYGMPR	203	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=1152	20.801	2	1528.6264	1528.6264	R	Q	204	218
PSM	HIYYITGETK	204	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=1845	25.844	2	1291.7449	1291.7449	K	D	490	500
PSM	NLVTEDVMR	205	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2676	31.81	2	1109.5963	1109.5963	K	M	58	67
PSM	QEYDESGPSIVHR	206	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1568	23.824	3	1549.7585	1549.7585	K	K	360	373
PSM	RVSALNSVHCEHVEDEGESR	207	sp|Q13085-3|ACACA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=1608	24.111	4	2423.0749	2423.0749	K	Y	1682	1702
PSM	SLRTAPATGQLPGR	208	sp|Q9NQU5-2|PAK6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1830	25.738	3	1537.819	1537.8190	K	S	332	346
PSM	SLRTAPATGQLPGRSSPAGSPR	209	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,4-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=2787	32.619	3	2517.0793	2517.0793	K	T	332	354
PSM	SLYESFVSSSDR	210	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3936	41.473	2	1489.655	1489.6550	K	L	131	143
PSM	STTPPPAEPVSLPQEPPKPR	211	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2780	32.567	3	2272.2141	2272.2141	K	V	225	245
PSM	SWASPVYTEADGTFSR	212	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4574	47.058	2	1886.83	1886.8300	R	L	342	358
PSM	TDPHGLYLSCNGGTPAGHK	213	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2377	29.668	3	2208.9701	2208.9701	R	Q	138	157
PSM	TLEEDEEELFK	214	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3769	39.933	2	1448.7559	1448.7559	K	M	40	51
PSM	TWNDPSVQQDIK	215	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2652	31.634	2	1497.81	1497.8100	R	F	102	114
PSM	TYLEEELDK	216	sp|Q16719-2|KYNU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=2909	33.513	2	1206.6656	1206.6656	K	W	85	94
PSM	VPTANVSVVDLTCR	217	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3853	40.741	3	1643.8166	1643.8166	R	L	235	249
PSM	YKPESEELTAER	218	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:510	ms_run[2]:scan=1406	22.665	3	1518.8202	1518.8202	K	I	327	339
PSM	DGFVTVDELK	219	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[1]:scan=3916	41.29203166666667	2	1189.6879	1189.6862	K	D	85	95
PSM	STTPPPAEPVSLPQEPPKPR	220	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2780	32.56705	3	2272.2166	2272.2136	K	V	225	245
PSM	ERYSYVCPDLVK	221	sp|P61158|ARP3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:510	ms_run[1]:scan=3194	35.600903333333335	2	1675.8336	1675.8312	K	E	229	241
PSM	RDSFDDRGPSLNPVLDYDHGSR	222	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3493	37.83257833333333	4	2631.195468	2631.192726	R	S	186	208
PSM	CLGLTEAQTR	223	sp|P31327-3|CPSM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=1800	25.521	2	1181.6287	1181.6287	K	E	926	936
PSM	CLQLGACLQSSPPGASPPTGTNR	224	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=4311	44.583	3	2562.1221	2562.1221	R	H	192	215
PSM	DFFDAEIK	225	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:510	ms_run[2]:scan=4158	43.255	2	1051.5862	1051.5862	K	K	1062	1070
PSM	DNLTLWTSDMQGDGEEQNK	226	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3882	41.038	3	2264.0539	2264.0539	R	E	204	223
PSM	DNLTLWTSDSAGEECDAAEGAEN	227	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=4935	50.705	3	2488.0396	2488.0396	R	-	223	246
PSM	DQIYDIFQK	228	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=4665	47.949	2	1236.7027	1236.7027	K	L	194	203
PSM	DYTYEELLNR	229	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4363	45.038	2	1348.6723	1348.6723	R	V	173	183
PSM	EALTYDGALLGDR	230	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3805	40.229	2	1426.7516	1426.7516	K	S	97	110
PSM	EGLELPEDEEEKK	231	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2242	28.687	3	1645.9147	1645.9147	K	K	547	560
PSM	EGMNIVEAMER	232	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3967	41.732	2	1311.6375	1311.6375	K	F	74	85
PSM	EGYSGVGLLSR	233	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3039	34.466	2	1170.6457	1170.6457	K	Q	126	137
PSM	ENRESLVVNYEDLAAR	234	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3942	41.516	3	1990.9574	1990.9574	K	E	225	241
PSM	EQFLDGDGWTSR	235	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3780	40.029	2	1443.6843	1443.6843	K	W	25	37
PSM	ERESLQQMAEVTR	236	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2398	29.814	2	1689.797	1689.7970	K	E	123	136
PSM	GDFCIQVGR	237	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=2868	33.208	2	1084.5548	1084.5548	R	N	91	100
PSM	GLSEDTTEETLK	238	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1905	26.272	2	1389.7511	1389.7511	K	E	578	590
PSM	GVNTFSPEGR	239	sp|P28066|PSA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1506	23.385	2	1096.5725	1096.5725	R	L	11	21
PSM	GVQYLNEIK	240	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=2692	31.924	2	1130.6972	1130.6972	K	D	668	677
PSM	HLSVNDLPVGR	241	sp|P30048-2|PRDX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3067	34.671	2	1319.6811	1319.6811	K	S	179	190
PSM	IDYIAGLDSR	242	sp|P07741-2|APT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3548	38.233	2	1155.6348	1155.6348	R	G	58	68
PSM	LAAIAESGVER	243	sp|P28072|PSB6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1846	25.851	2	1148.6614	1148.6614	R	Q	210	221
PSM	NDLAVVDVR	244	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2575	31.083	2	1033.598	1033.5980	K	I	334	343
PSM	QDIAFAYQR	245	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2711	32.063	2	1144.6089	1144.6089	R	R	87	96
PSM	QLSSGVSEIR	246	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2175	28.205	2	1188.5964	1188.5964	R	H	80	90
PSM	QRSLASDITDEQK	247	sp|P16083|NQO2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2045	27.273	3	1637.8298	1637.8298	K	K	78	91
PSM	RCSLLDCDLK	248	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4,10-UNIMOD:510	ms_run[2]:scan=2728	32.186	2	1426.6986	1426.6986	K	Q	760	770
PSM	RDSIVAELDR	249	sp|O14579-3|COPE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2614	31.363	2	1286.6444	1286.6444	R	E	97	107
PSM	RLSQIGVENTEENRR	250	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1563	23.791	3	1913.9533	1913.9533	K	L	43	58
PSM	RMTGSEFDFEEMK	251	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3986	41.874	3	1753.7729	1753.7729	K	R	378	391
PSM	RVSISEGDDKIEYR	252	sp|P22087|FBRL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2449	30.174	2	1813.9248	1813.9248	K	A	122	136
PSM	SLRTAPATGQLPGRSSPAGSPR	253	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=2207	28.438	3	2437.113	2437.1130	K	T	332	354
PSM	SYELPDGQVITIGNER	254	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4737	48.614	3	1823.9478	1823.9478	K	F	239	255
PSM	TAPATGQLPGRSSPAGSPR	255	sp|Q9NQU5-2|PAK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=2011	27.032	3	2080.8958	2080.8958	R	T	335	354
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	256	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4689	48.235	4	3490.5054	3490.5054	R	-	207	238
PSM	TIAQDYGVLK	257	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2594	31.22	2	1174.7234	1174.7234	R	A	111	121
PSM	TNQELQEINR	258	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1428	22.823	2	1277.6788	1277.6788	R	V	154	164
PSM	VAVVAGYGDVGK	259	sp|P23526-2|SAHH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2360	29.546	2	1201.7343	1201.7343	K	G	187	199
PSM	VEVTEFEDIK	260	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3686	39.273	2	1275.7235	1275.7235	R	S	98	108
PSM	YALYDASFETK	261	sp|P60981-2|DEST_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3681	39.234	2	1374.7344	1374.7344	R	E	65	76
PSM	YYVTIIDAPGHR	262	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2932	33.68	3	1437.7829	1437.7829	K	D	85	97
PSM	YHTSQSGDEMTSLSEYVSR	263	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=3046	34.516306666666665	3	2305.965149	2305.962240	R	M	457	476
PSM	TLNDRSSIVMGEPISQSSSNSQ	264	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=3413	37.243195	3	2450.123739	2450.120866	R	-	762	784
PSM	SLSEAIEKSTEQR	265	sp|A0JNW5|UH1BL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=4762	48.91972166666667	2	1590.7795	1590.7709	K	K	259	272