MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100624_001CLK1.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100624_001CLK1.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	228-UNIMOD:510	0.09	44.0	7	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	204-UNIMOD:510,222-UNIMOD:510,213-UNIMOD:35,223-UNIMOD:510	0.13	41.0	4	2	1
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,446-UNIMOD:510,466-UNIMOD:35	0.03	40.0	3	2	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	230-UNIMOD:510,232-UNIMOD:21,230-UNIMOD:21,241-UNIMOD:21	0.04	40.0	4	1	0
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	75-UNIMOD:510	0.13	39.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	431-UNIMOD:510,439-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	142-UNIMOD:510,176-UNIMOD:510,578-UNIMOD:510,580-UNIMOD:21,589-UNIMOD:510	0.07	39.0	2	2	2
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	239-UNIMOD:510,19-UNIMOD:510,316-UNIMOD:510,318-UNIMOD:21,325-UNIMOD:35,326-UNIMOD:510,292-UNIMOD:510,297-UNIMOD:21,304-UNIMOD:21	0.17	39.0	5	4	2
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	207-UNIMOD:510,86-UNIMOD:510,91-UNIMOD:510,102-UNIMOD:21	0.26	39.0	3	2	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	469-UNIMOD:510,502-UNIMOD:510	0.07	38.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	221-UNIMOD:510,37-UNIMOD:510	0.06	38.0	3	2	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	228-UNIMOD:510	0.08	36.0	2	1	0
PRT	sp|Q96EY7-2|PTCD3_HUMAN	Isoform 2 of Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	252-UNIMOD:510,266-UNIMOD:21,280-UNIMOD:510	0.11	36.0	1	1	1
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	127-UNIMOD:510,132-UNIMOD:21,127-UNIMOD:35	0.05	36.0	2	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	323-UNIMOD:510,323-UNIMOD:21,346-UNIMOD:21,351-UNIMOD:510,25-UNIMOD:510	0.10	36.0	2	2	2
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	60-UNIMOD:510	0.27	35.0	1	1	1
PRT	sp|Q96S44|PRPK_HUMAN	EKC/KEOPS complex subunit TP53RK OS=Homo sapiens OX=9606 GN=TP53RK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	6-UNIMOD:510,8-UNIMOD:21,7-UNIMOD:21	0.09	35.0	4	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	28-UNIMOD:510,30-UNIMOD:21,223-UNIMOD:510	0.16	34.0	3	2	1
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	463-UNIMOD:510,473-UNIMOD:21,482-UNIMOD:510	0.01	33.0	1	1	0
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	14-UNIMOD:510	0.06	33.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	73-UNIMOD:510,83-UNIMOD:35,76-UNIMOD:21	0.20	33.0	4	1	0
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	null	463-UNIMOD:510,475-UNIMOD:21,482-UNIMOD:510	0.01	33.0	1	1	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	28-UNIMOD:510,30-UNIMOD:21,223-UNIMOD:510,237-UNIMOD:4	0.16	32.0	2	2	2
PRT	sp|Q9HDC5|JPH1_HUMAN	Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	411-UNIMOD:510,413-UNIMOD:21,425-UNIMOD:510	0.02	32.0	1	1	1
PRT	sp|P04075-2|ALDOA_HUMAN	Isoform 2 of Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	83-UNIMOD:510,93-UNIMOD:21,96-UNIMOD:510	0.04	32.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	120-UNIMOD:510,123-UNIMOD:21,145-UNIMOD:510	0.11	32.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	32.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	31.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	31.0	1	1	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	8-UNIMOD:510,23-UNIMOD:510,320-UNIMOD:510,320-UNIMOD:21,329-UNIMOD:510	0.08	31.0	2	2	2
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	null	884-UNIMOD:510,897-UNIMOD:21,899-UNIMOD:21	0.03	31.0	1	1	0
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	30.0	1	1	1
PRT	sp|O15061-2|SYNEM_HUMAN	Isoform 2 of Synemin OS=Homo sapiens OX=9606 GN=SYNM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	1042-UNIMOD:510,1044-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	103-UNIMOD:510,114-UNIMOD:510,76-UNIMOD:510	0.03	30.0	2	2	2
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	826-UNIMOD:510,837-UNIMOD:21,841-UNIMOD:21	0.04	29.0	1	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	325-UNIMOD:510,336-UNIMOD:510,330-UNIMOD:35	0.03	29.0	2	1	0
PRT	sp|P10696|PPBN_HUMAN	Alkaline phosphatase, germ cell type OS=Homo sapiens OX=9606 GN=ALPG PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510	0.03	29.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	29.0	1	1	0
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	288-UNIMOD:510,290-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	418-UNIMOD:510,435-UNIMOD:21,441-UNIMOD:510,420-UNIMOD:35	0.05	28.0	2	1	0
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	1153-UNIMOD:510	0.02	28.0	1	1	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	158-UNIMOD:510,160-UNIMOD:21	0.07	28.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	77-UNIMOD:510	0.05	27.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	542-UNIMOD:510	0.03	27.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	496-UNIMOD:510,498-UNIMOD:21,500-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|Q9UJ70|NAGK_HUMAN	N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	70-UNIMOD:510,76-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	250-UNIMOD:510,251-UNIMOD:510,252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4,281-UNIMOD:510	0.04	26.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	539-UNIMOD:510,550-UNIMOD:510,551-UNIMOD:510,613-UNIMOD:510,617-UNIMOD:35,620-UNIMOD:35,621-UNIMOD:35,623-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510,187-UNIMOD:510	0.07	26.0	6	5	4
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	26.0	1	1	1
PRT	sp|Q92995-2|UBP13_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens OX=9606 GN=USP13	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	51-UNIMOD:510,57-UNIMOD:21,73-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	995-UNIMOD:510,999-UNIMOD:21,1005-UNIMOD:21,1013-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	100-UNIMOD:510,102-UNIMOD:21	0.02	26.0	1	1	0
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	74-UNIMOD:510,76-UNIMOD:21,80-UNIMOD:4,74-UNIMOD:21	0.06	26.0	3	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|P49759-3|CLK1_HUMAN	Isoform 3 of Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	365-UNIMOD:510,380-UNIMOD:21,384-UNIMOD:21,459-UNIMOD:510,466-UNIMOD:21,383-UNIMOD:21,182-UNIMOD:510,182-UNIMOD:21,193-UNIMOD:4,195-UNIMOD:21,370-UNIMOD:21,241-UNIMOD:510,242-UNIMOD:4,247-UNIMOD:21,257-UNIMOD:21	0.16	26.0	7	5	4
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	462-UNIMOD:510,468-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	114-UNIMOD:510	0.13	26.0	1	1	1
PRT	sp|Q9BQA1-2|MEP50_HUMAN	Isoform 2 of Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	116-UNIMOD:510,122-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	208-UNIMOD:510,210-UNIMOD:21,220-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	11-UNIMOD:510,14-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	104-UNIMOD:510,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:510	0.12	24.0	1	1	1
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	416-UNIMOD:510,418-UNIMOD:21,422-UNIMOD:21,414-UNIMOD:510,420-UNIMOD:21	0.03	24.0	2	2	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510	0.05	24.0	2	2	2
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	186-UNIMOD:510,193-UNIMOD:21,204-UNIMOD:510	0.03	24.0	2	2	2
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	257-UNIMOD:510,260-UNIMOD:4,272-UNIMOD:21	0.05	24.0	1	1	0
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	175-UNIMOD:510,181-UNIMOD:21,185-UNIMOD:510,248-UNIMOD:510,100-UNIMOD:510,105-UNIMOD:4	0.13	24.0	3	3	3
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	871-UNIMOD:510,872-UNIMOD:4,876-UNIMOD:21,882-UNIMOD:510,846-UNIMOD:510,848-UNIMOD:21,856-UNIMOD:21,875-UNIMOD:21,2690-UNIMOD:510,2692-UNIMOD:21,2694-UNIMOD:21,1101-UNIMOD:510,1103-UNIMOD:21,2130-UNIMOD:510,2130-UNIMOD:4,2132-UNIMOD:21	0.03	24.0	7	5	3
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	340-UNIMOD:510,342-UNIMOD:21,353-UNIMOD:510	0.04	24.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	323-UNIMOD:510	0.06	24.0	1	1	1
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	116-UNIMOD:510,118-UNIMOD:21,117-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	125-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	82-UNIMOD:510,89-UNIMOD:21,103-UNIMOD:510	0.17	23.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	172-UNIMOD:510,180-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	187-UNIMOD:510,195-UNIMOD:21,186-UNIMOD:510,188-UNIMOD:21	0.03	22.0	2	2	2
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	74-UNIMOD:510,95-UNIMOD:510,101-UNIMOD:4	0.23	22.0	2	2	2
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	186-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	220-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	156-UNIMOD:510,160-UNIMOD:4,161-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q15052-2|ARHG6_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	333-UNIMOD:510,334-UNIMOD:21,341-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	544-UNIMOD:510,550-UNIMOD:21,554-UNIMOD:21,565-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	1052-UNIMOD:510,1055-UNIMOD:21,1069-UNIMOD:35,1070-UNIMOD:4,1054-UNIMOD:35	0.02	22.0	3	1	0
PRT	sp|P18615-4|NELFE_HUMAN	Isoform 3 of Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	113-UNIMOD:510,115-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q02241-2|KIF23_HUMAN	Isoform 2 of Kinesin-like protein KIF23 OS=Homo sapiens OX=9606 GN=KIF23	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	155-UNIMOD:510,160-UNIMOD:21,165-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	102-UNIMOD:510,113-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P07951|TPM2_HUMAN	Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	269-UNIMOD:510,271-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q96GM8-2|TOE1_HUMAN	Isoform 2 of Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	338-UNIMOD:510,339-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	223-UNIMOD:510,128-UNIMOD:510,138-UNIMOD:510	0.14	21.0	2	2	2
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	28-UNIMOD:510,32-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	295-UNIMOD:510,305-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	129-UNIMOD:510,133-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	145-UNIMOD:510,169-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	80-UNIMOD:510,82-UNIMOD:21,92-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	86-UNIMOD:510,87-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|Q6UN15|FIP1_HUMAN	Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	490-UNIMOD:510,492-UNIMOD:21,494-UNIMOD:21	0.03	21.0	1	1	0
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	42-UNIMOD:510,42-UNIMOD:4,43-UNIMOD:21,67-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	333-UNIMOD:510,335-UNIMOD:21,349-UNIMOD:510	0.02	21.0	1	1	0
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	257-UNIMOD:510,260-UNIMOD:4,271-UNIMOD:21	0.04	21.0	1	1	0
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	78-UNIMOD:510,396-UNIMOD:510	0.08	20.0	2	2	2
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	158-UNIMOD:510	0.20	20.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4,206-UNIMOD:510	0.04	20.0	3	2	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	44-UNIMOD:510	0.12	20.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	93-UNIMOD:510,94-UNIMOD:35,103-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	301-UNIMOD:510,312-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	107-UNIMOD:510,109-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	80-UNIMOD:510,82-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	815-UNIMOD:510,815-UNIMOD:21,817-UNIMOD:21,819-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	55-UNIMOD:510,62-UNIMOD:21,74-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	112-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	250-UNIMOD:510,263-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|Q7Z4H7|HAUS6_HUMAN	HAUS augmin-like complex subunit 6 OS=Homo sapiens OX=9606 GN=HAUS6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	821-UNIMOD:510,823-UNIMOD:21	0.02	20.0	1	1	0
PRT	sp|Q63ZY3-3|KANK2_HUMAN	Isoform 3 of KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	354-UNIMOD:510,356-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	166-UNIMOD:510,574-UNIMOD:510	0.05	19.0	2	2	2
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	8-UNIMOD:510	0.07	19.0	1	1	1
PRT	sp|P24844-2|MYL9_HUMAN	Isoform 2 of Myosin regulatory light polypeptide 9 OS=Homo sapiens OX=9606 GN=MYL9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	36-UNIMOD:510	0.09	19.0	1	1	1
PRT	sp|Q12968-5|NFAC3_HUMAN	Isoform 5 of Nuclear factor of activated T-cells, cytoplasmic 3 OS=Homo sapiens OX=9606 GN=NFATC3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	159-UNIMOD:510,161-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	30-UNIMOD:510,38-UNIMOD:21,41-UNIMOD:510	0.09	19.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	91-UNIMOD:510,94-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|P26373-2|RL13_HUMAN	Isoform 2 of 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	75-UNIMOD:510,77-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|P62899-3|RL31_HUMAN	Isoform 3 of 60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	13-UNIMOD:510,15-UNIMOD:21	0.10	19.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	203-UNIMOD:510,207-UNIMOD:21,212-UNIMOD:4,213-UNIMOD:510	0.00	19.0	1	1	1
PRT	sp|P62316-2|SMD2_HUMAN	Isoform 2 of Small nuclear ribonucleoprotein Sm D2 OS=Homo sapiens OX=9606 GN=SNRPD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	28-UNIMOD:510,36-UNIMOD:4	0.10	19.0	1	1	1
PRT	sp|P30085-2|KCY_HUMAN	Isoform 2 of UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	48-UNIMOD:510,57-UNIMOD:510	0.07	19.0	1	1	1
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	205-UNIMOD:510,208-UNIMOD:21,218-UNIMOD:35	0.10	19.0	1	1	1
PRT	sp|O00469-3|PLOD2_HUMAN	Isoform 3 of Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	101-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	305-UNIMOD:510,307-UNIMOD:21,318-UNIMOD:510,305-UNIMOD:21,310-UNIMOD:21,303-UNIMOD:510,303-UNIMOD:21	0.06	19.0	5	3	1
PRT	sp|Q9NR28-2|DBLOH_HUMAN	Isoform 2 of Diablo homolog, mitochondrial OS=Homo sapiens OX=9606 GN=DIABLO	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	167-UNIMOD:510,177-UNIMOD:21	0.11	19.0	1	1	1
PRT	sp|Q8WYB5|KAT6B_HUMAN	Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	null	355-UNIMOD:21,367-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q5VSL9-3|STRP1_HUMAN	Isoform 3 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	69-UNIMOD:510,75-UNIMOD:21,85-UNIMOD:510	0.04	18.0	1	1	0
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	792-UNIMOD:510,805-UNIMOD:21,811-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|A6NMY6|AXA2L_HUMAN	Putative annexin A2-like protein OS=Homo sapiens OX=9606 GN=ANXA2P2 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	330-UNIMOD:510,335-UNIMOD:4,136-UNIMOD:510	0.06	18.0	2	2	2
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	519-UNIMOD:510,521-UNIMOD:21,532-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	483-UNIMOD:510,485-UNIMOD:21,494-UNIMOD:510,496-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|P78345|RPP38_HUMAN	Ribonuclease P protein subunit p38 OS=Homo sapiens OX=9606 GN=RPP38 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	251-UNIMOD:510,253-UNIMOD:21,260-UNIMOD:510	0.04	18.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	98-UNIMOD:510,107-UNIMOD:510,130-UNIMOD:510,142-UNIMOD:510	0.09	18.0	2	2	2
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	79-UNIMOD:510,96-UNIMOD:510,106-UNIMOD:21,116-UNIMOD:510	0.17	18.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	18.0	null	225-UNIMOD:510,227-UNIMOD:21,242-UNIMOD:510,226-UNIMOD:21	0.05	18.0	2	1	0
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	null	94-UNIMOD:21,95-UNIMOD:21,111-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P49682|CXCR3_HUMAN	C-X-C chemokine receptor type 3 OS=Homo sapiens OX=9606 GN=CXCR3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	null	347-UNIMOD:510,358-UNIMOD:21,360-UNIMOD:21,365-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	492-UNIMOD:510,506-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	164-UNIMOD:510,201-UNIMOD:510	0.19	17.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	17.0	1	1	1
PRT	sp|Q7Z4S6-6|KI21A_HUMAN	Isoform 6 of Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	1174-UNIMOD:510,1176-UNIMOD:21,1184-UNIMOD:510	0.01	17.0	1	1	1
PRT	sp|Q9NYF8-4|BCLF1_HUMAN	Isoform 4 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	317-UNIMOD:510,319-UNIMOD:21,332-UNIMOD:510	0.02	17.0	1	1	1
PRT	sp|Q99614|TTC1_HUMAN	Tetratricopeptide repeat protein 1 OS=Homo sapiens OX=9606 GN=TTC1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	273-UNIMOD:510	0.07	17.0	1	1	1
PRT	sp|Q7Z4H7-3|HAUS6_HUMAN	Isoform 3 of HAUS augmin-like complex subunit 6 OS=Homo sapiens OX=9606 GN=HAUS6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	786-UNIMOD:510,791-UNIMOD:21	0.02	17.0	1	1	0
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	null	292-UNIMOD:510,297-UNIMOD:21,303-UNIMOD:21	0.06	17.0	1	1	0
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	null	27-UNIMOD:510,39-UNIMOD:21	0.04	17.0	2	2	2

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510	ms_run[2]:scan=4285	49.035	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=4551	52.101	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	3	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4127	47.394	2	2248.059	2248.0590	R	E	204	223
PSM	DNLTLWTSDQQDDDGGEGNN	4	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=4376	50.068	2	2226.9361	2226.9361	R	-	228	248
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	5	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2267	29.448	3	2847.2212	2847.2212	K	M	445	470
PSM	SSSPAPADIAQTVQEDLR	6	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4611	52.894	2	1997.9519	1997.9519	K	T	230	248
PSM	DWEDDSDEDMSNFDR	7	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=3625	42.435	2	1908.7168	1908.7168	K	F	75	90
PSM	DYEEVGADSADGEDEGEEY	8	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3483	41.089	2	2191.7691	2191.7691	K	-	431	450
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	9	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,35-UNIMOD:510	ms_run[2]:scan=2819	34.598	3	4220.6251	4220.6251	K	A	142	177
PSM	SYELPDGQVITIGNER	10	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=4310	49.317	2	1823.9478	1823.9478	K	F	239	255
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	11	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=4222	48.421	3	3490.5054	3490.5054	R	-	207	238
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	12	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=2987	36.162	3	3112.2782	3112.2782	K	L	595	622
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	13	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,34-UNIMOD:510	ms_run[2]:scan=4453	50.842	4	3824.5651	3824.5651	K	A	469	503
PSM	STAGDTHLGGEDFDNR	14	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=1721	24.926	2	1724.7814	1724.7814	K	M	221	237
PSM	DNLTLWTSDQQDDDGGEGNN	15	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=4185	48.042	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDQQDEEAGEGN	16	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=4251	48.686	2	2154.9402	2154.9402	R	-	228	247
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	17	sp|Q96EY7-2|PTCD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,15-UNIMOD:21,29-UNIMOD:510	ms_run[2]:scan=3932	45.332	3	3082.3147	3082.3147	K	-	252	281
PSM	MEREDSSEEEEEEIDDEEIER	18	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2682	33.309	3	2740.0643	2740.0643	R	R	127	148
PSM	SGTIFDNFLITNDEAYAEEFGNETWGVTK	19	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,1-UNIMOD:21,24-UNIMOD:21,29-UNIMOD:510	ms_run[2]:scan=6295	80.146	3	3495.5473	3495.5473	K	A	323	352
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	20	sp|Q9BXV9|GON7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=2581	32.331	3	2865.1757	2865.1757	R	T	60	86
PSM	ATTPADGEEPAPEAEALAAAR	21	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3408	40.25968666666667	2	2150.9920	2150.9940	R	E	6	27
PSM	SSSPAPADIAQTVQEDLR	22	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=4611	52.89415666666667	2	1997.951236	1997.951933	K	T	230	248
PSM	SVTEQGAELSNEER	23	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2101	27.97	2	1661.7358	1661.7358	K	N	28	42
PSM	AGEEDEGEEDSDSDYEISAK	24	sp|A2RRP1-2|NBAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2275	29.507	2	2321.9221	2321.9221	R	A	463	483
PSM	ATTPADGEEPAPEAEALAAAR	25	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3408	40.26	2	2150.9945	2150.9945	R	E	6	27
PSM	DNLTLWTSDQQDDDGGEGNN	26	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4290	49.072	3	2226.9361	2226.9361	R	-	228	248
PSM	IQALQQQADEAEDR	27	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=1918	26.502	2	1647.8276	1647.8276	K	A	14	28
PSM	KEESEESDDDMGFGLFD	28	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=3985	45.859	2	2032.8732	2032.8732	K	-	73	90
PSM	KEESEESDDDMGFGLFD	29	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=5013	59.033	2	2096.8446	2096.8446	K	-	73	90
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	30	sp|Q9UPR0-2|PLCL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2611	32.622	3	2685.0632	2685.0632	K	M	446	470
PSM	SVTEQGAELSNEER	31	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=1556	23.605	2	1581.7695	1581.7695	K	N	28	42
PSM	TPEELDDSDFETEDFDVR	32	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4392	50.201	2	2271.9157	2271.9157	R	S	264	282
PSM	AGEEDEGEEDSDSDYEISAK	33	sp|A2RRP1|NBAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=2275	29.5069	2	2321.9162	2321.9215	R	A	463	483
PSM	AVTEQGAELSNEER	34	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1720	24.919	2	1645.7409	1645.7409	K	N	28	42
PSM	ELSPDFYQPGPDYVK	35	sp|Q9HDC5|JPH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4016	46.265	2	1901.9125	1901.9125	R	Q	411	426
PSM	GILAADESTGSIAK	36	sp|P04075-2|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2633	32.814	2	1479.7858	1479.7858	K	R	83	97
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	37	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3700	43.082	3	3090.3451	3090.3451	K	E	120	146
PSM	TAFQEALDAAGDK	38	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3015	36.421	2	1403.7569	1403.7569	K	L	9	22
PSM	AFLAELEQNSPK	39	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3710	43.158	2	1493.7803	1493.7803	K	I	2424	2436
PSM	DSSTSPGDYVLSVSENSR	40	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4025	46.332	2	2012.8788	2012.8788	R	V	39	57
PSM	LIAPVAEEEATVPNNK	41	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2743	33.856	2	1762.0149	1762.0149	K	I	8	24
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	42	sp|Q9UPR0-2|PLCL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=2162	28.509	3	2701.0581	2701.0581	K	M	446	470
PSM	APVSSTESVIQSNTPTPPPSQPLNETAEEESR	43	sp|Q9HC35|EMAL4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=3406	40.24429333333333	4	3572.6002	3572.6016	K	I	884	916
PSM	ESLKEEDESDDDNM	44	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=1041	19.139	2	1738.7364	1738.7364	K	-	235	249
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	45	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=3848	44.539	3	3461.4719	3461.4719	K	F	86	114
PSM	QRSPAPGSPDEEGGAEAPAAGIR	46	sp|O15061-2|SYNEM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1747	25.148	3	2333.0861	2333.0861	R	F	1042	1065
PSM	ELISNASDALDK	47	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=2615	32.65222166666667	2	1342.761535	1342.761645	R	I	103	115
PSM	APVSSTESVIQSNTPTPPPSQPLNETAEEESR	48	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=3406	40.244	4	3572.6021	3572.6021	K	I	826	858
PSM	EVDEQMLNVQNK	49	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2550	32.018	2	1513.8083	1513.8083	K	N	325	337
PSM	HVPDSGATATAYLCGVK	50	sp|P10696|PPBN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=3117	37.397	2	1893.9332	1893.9332	K	G	107	124
PSM	KEESEESDDDMGFGLFD	51	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4522	51.749	2	2112.8395	2112.8395	K	-	73	90
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	52	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=4228	48.464	4	3490.5054	3490.5054	R	-	207	238
PSM	DSSTSPGDYVLSVSENSR	53	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4025	46.33166	2	2012.877947	2012.878828	R	V	39	57
PSM	ELSLAGNELGDEGAR	54	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3457	40.813	2	1643.7616	1643.7616	K	L	288	303
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	55	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2463	31.249	3	2810.1902	2810.1902	R	E	418	442
PSM	IAQLEEELEEEQGNTELINDR	56	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=4196	48.124	3	2505.2295	2505.2295	R	L	1153	1174
PSM	SSTPLPTISSSAENTR	57	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2453	31.162	2	1760.8406	1760.8406	R	Q	158	174
PSM	DLIHDQDEDEEEEEGQR	58	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=1934	26.637	3	2118.9038	2118.9038	R	F	77	94
PSM	EVDEQMLNVQNK	59	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1685	24.636	2	1529.8032	1529.8032	K	N	325	337
PSM	HGSYEDAVHSGALND	60	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=1792	25.477	2	1604.7279	1604.7279	K	-	542	557
PSM	QRSPSPAPAPAPAAAAGPPTR	61	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=1566	23.68	3	2161.0295	2161.0295	R	K	496	517
PSM	RVSVCAETYNPDEEEEDTDPR	62	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2495	31.504	3	2624.0798	2624.0798	R	V	97	118
PSM	SLGLSLSGGDQEDAGR	63	sp|Q9UJ70|NAGK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3442	40.616	2	1674.7674	1674.7674	R	I	70	86
PSM	DNLTLWTSDTQGDEAEAGEGGEN	64	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510	ms_run[1]:scan=4331	49.56805166666667	3	2442.0511	2442.0514	R	-	223	246
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	65	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4,32-UNIMOD:510	ms_run[2]:scan=4462	50.961	4	4015.8382	4015.8382	R	I	250	282
PSM	EGLELPEDEEEK	66	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2696	33.415	2	1483.7566	1483.7566	K	K	539	551
PSM	FASENDLPEWK	67	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3926	45.286	2	1482.7068	1482.7068	R	E	58	69
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	68	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2088	27.87	3	2826.1852	2826.1852	R	E	418	442
PSM	IFLDLDTDDDLNSDDYEYEDEAK	69	sp|Q92995-2|UBP13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=4932	57.774	3	2900.2325	2900.2325	K	L	51	74
PSM	MEREDSSEEEEEEIDDEEIER	70	sp|P55081|MFAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=2540	31.943	3	2756.0592	2756.0592	R	R	127	148
PSM	QREESETRSESSDFEVVPK	71	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2419	30.845	3	2466.0989	2466.0989	R	R	995	1014
PSM	RLSQSDEDVIR	72	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1773	25.339	2	1430.6979	1430.6979	K	L	119	130
PSM	SSSPVQVEEEPVR	73	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1981	27.025	2	1555.7343	1555.7343	R	L	100	113
PSM	TQSPGGCSAEAVLAR	74	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2439	31.057	2	1616.7442	1616.7442	R	K	74	89
PSM	TQSPGGCSAEAVLAR	75	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2445	31.102	3	1616.7442	1616.7442	R	K	74	89
PSM	TVIIEQSWGSPK	76	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3514	41.36	2	1491.8011	1491.8011	R	V	61	73
PSM	VVDFGSATYDDEHHSTLVSTRHYR	77	sp|P49759-3|CLK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,16-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=2802	34.435	3	2985.2908	2985.2908	K	A	365	389
PSM	YEQGTGCWQGPNR	78	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=1740	25.069	2	1585.7156	1585.7156	K	S	462	475
PSM	YFQINQDEEEEEDED	79	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=2989	36.177	2	1964.786	1964.7860	R	-	114	129
PSM	DSVFLSCSEDNR	80	sp|Q9BQA1-2|MEP50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2630	32.778	2	1461.6618	1461.6618	K	I	116	128
PSM	EVSFQSTGESEWK	81	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3267	38.876	2	1660.7658	1660.7658	R	D	208	221
PSM	GPLQSVQVFGR	82	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3593	42.127	2	1300.6753	1300.6753	K	K	5	16
PSM	HGESAWNLENR	83	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2250	29.293	2	1425.6251	1425.6251	R	F	11	22
PSM	TQSPGGCSAEAVLAR	84	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=2445	31.101956666666666	3	1616.7431	1616.7437	R	K	74	89
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	85	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=3223	38.398	4	3527.556	3527.5560	K	L	104	135
PSM	DHSPTPSVFNSDEER	86	sp|Q6UN15-3|FIP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=2505	31.605	2	1909.7345	1909.7345	R	Y	416	431
PSM	DNLTLWTSDMQGDGEEQNK	87	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4115	47.277	3	2248.059	2248.0590	R	E	204	223
PSM	DNLTLWTSDQQDDDGGEGNN	88	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=4474	51.156	3	2226.9361	2226.9361	R	-	228	248
PSM	ESEDKPEIEDVGSDEEEEK	89	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=1994	27.122	3	2294.1022	2294.1022	K	K	251	270
PSM	KEESEESDDDMGFGLFD	90	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=4617	52.94	2	2016.8783	2016.8783	K	-	73	90
PSM	LDWDEHSSAGR	91	sp|P49759-3|CLK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2158	28.479	2	1385.5825	1385.5825	R	Y	459	470
PSM	MLAESDESGDEESVSQTDK	92	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2074	27.766	3	2203.9352	2203.9352	K	T	186	205
PSM	MLAESDESGDEESVSQTDKTELQNTLR	93	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3427	40.464	3	3159.4439	3159.4439	K	T	186	213
PSM	QENCGAQQVPAGPGTSTPPSSPVR	94	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=2241	29.201	3	2535.1637	2535.1637	R	T	257	281
PSM	QVVESAYEVIK	95	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2864	35.043	2	1411.7636	1411.7636	K	L	175	186
PSM	SCFESSPDPELK	96	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:4,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2472	31.317	2	1542.695	1542.6950	R	S	871	883
PSM	SGSSSPDSEITELK	97	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2839	34.81	2	1583.7604	1583.7604	R	F	340	354
PSM	TAENATSGETLEENEAGD	98	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1833	25.799	2	1870.8128	1870.8128	K	-	323	341
PSM	VVDFGSATYDDEHHSTLVSTR	99	sp|P49759-3|CLK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,19-UNIMOD:21	ms_run[2]:scan=2971	36.037	3	2449.1011	2449.1011	K	H	365	386
PSM	SSSPAPADIAQTVQEDLR	100	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=4615	52.924415	3	1997.9513	1997.9514	K	T	230	248
PSM	SSSPVQVEEEPVR	101	sp|Q8IZ21|PHAR4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1969	26.937073333333334	2	1555.732957	1555.734336	R	L	116	129
PSM	DNNQFASASLDR	102	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2244	29.237	2	1370.6639	1370.6639	K	T	125	137
PSM	DNYVPEVSALDQEIIEVDPDTK	103	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=5478	66.285	3	2636.2783	2636.2783	R	E	82	104
PSM	NNSGEEFDCAFR	104	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2646	32.939	2	1478.6309	1478.6309	R	L	355	367
PSM	NVIGLQMGTNR	105	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3173	37.936	2	1315.6532	1315.6532	K	G	172	183
PSM	STAGDTHLGGEDFDNR	106	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1716	24.893	3	1724.7814	1724.7814	K	M	221	237
PSM	SSSPVQVEEEPVR	107	sp|Q8IZ21|PHAR4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=1981	27.025433333333332	2	1555.732957	1555.734336	R	L	116	129
PSM	ATTPADGEEPAPEAEALAAAR	108	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3404	40.229	3	2150.9945	2150.9945	R	E	6	27
PSM	DSFDDRGPSLNPVLDYDHGSR	109	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3669	42.813	4	2475.0916	2475.0916	R	S	187	208
PSM	EGMNIVEAMER	110	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3654	42.688	2	1311.6375	1311.6375	K	F	74	85
PSM	GDRSEDFGVNEDLADSDAR	111	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2706	33.502	3	2100.9408	2100.9408	K	A	186	205
PSM	HWILPQDYDHAQAEAR	112	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3008	36.356	3	1982.9811	1982.9811	R	H	220	236
PSM	LFQECCPHSTDR	113	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=1205	20.59	3	1582.7081	1582.7081	K	V	156	168
PSM	MSGFIYQGK	114	sp|Q15052-2|ARHG6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3215	38.339	2	1177.5879	1177.5879	R	I	333	342
PSM	NTFTAWSDEESDYEIDDRDVNK	115	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4167	47.868	3	2876.1739	2876.1739	K	I	544	566
PSM	RQMSVPGIFNPHEIPEEMCD	116	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,18-UNIMOD:35,19-UNIMOD:4	ms_run[2]:scan=4117	47.292	3	2515.0795	2515.0795	K	-	1052	1072
PSM	RQMSVPGIFNPHEIPEEMCD	117	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=4519	51.727	3	2499.0846	2499.0846	K	-	1052	1072
PSM	SGTPPRQGSITSPQANEQSVTPQR	118	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1775	25.353	3	2636.2768	2636.2768	K	R	846	870
PSM	SISADDDLQESSR	119	sp|P18615-4|NELFE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2061	27.671	2	1535.6565	1535.6565	R	R	113	126
PSM	SNDRNSMDIQCEVDALLER	120	sp|Q02241-2|KIF23_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=4984	58.576	3	2378.0456	2378.0456	K	Q	155	174
PSM	TWNDPSVQQDIK	121	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2560	32.091	2	1497.81	1497.8100	R	F	102	114
PSM	ATTPADGEEPAPEAEALAAAR	122	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3404	40.22891166666666	3	2150.994409	2150.994526	R	E	6	27
PSM	AGFAGDDAPR	123	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1236	20.868	2	1009.5041	1009.5041	K	A	19	29
PSM	AISEELDNALNDITSL	124	sp|P07951|TPM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=6326	80.719	2	1830.8712	1830.8712	K	-	269	285
PSM	ATSEVPGSQASPNPVPGDGLHR	125	sp|Q96GM8-2|TOE1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2328	29.995	3	2286.0854	2286.0854	R	A	338	360
PSM	DNLTLWTSDMQGDGEEQNK	126	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3492	41.183	3	2264.0539	2264.0539	R	E	204	223
PSM	DNLTLWTSENQGDEGDAGEGEN	127	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=4173	47.94	2	2384.01	2384.0100	R	-	223	245
PSM	EGLELPEDEEEKK	128	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2258	29.365	3	1645.9147	1645.9147	K	K	539	552
PSM	EITALAPSTMK	129	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2314	29.865	2	1324.6986	1324.6986	K	I	316	327
PSM	FARLSEHATAPTR	130	sp|P33316-2|DUT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1459	22.795	3	1569.7877	1569.7877	R	G	28	41
PSM	GDLGIEIPAEK	131	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3248	38.684	2	1208.7289	1208.7289	R	V	295	306
PSM	IEDVTPIPSDSTR	132	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2350	30.242	2	1542.7391	1542.7391	R	R	129	142
PSM	NDQDTWDYTNPNLSGQGDPGSNPNK	133	sp|P14866-2|HNRPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,25-UNIMOD:510	ms_run[2]:scan=3101	37.265	3	2801.2801	2801.2801	K	R	145	170
PSM	SPSPEPIYNSEGK	134	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1914	26.472	2	1551.7494	1551.7494	R	R	80	93
PSM	TTPSVVAFTADGER	135	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3512	41.345	2	1563.7394	1563.7394	R	L	86	100
PSM	VRYSLDPENPTK	136	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2391	30.598	2	1565.8127	1565.8127	M	S	2	14
PSM	VTLTSEEEAR	137	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1472	22.889	2	1167.6195	1167.6195	K	L	248	258
PSM	VVDFGSATYDDEHHSTLVSTR	138	sp|P49759-3|CLK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,16-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=3197	38.181	3	2529.0674	2529.0674	K	H	365	386
PSM	SGTPPRQGSITSPQANEQSVTPQR	139	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=1775	25.352761666666666	3	2636.2719	2636.2763	K	R	846	870
PSM	DHSPTPSVFNSDEER	140	sp|Q6UN15|FIP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=2505	31.605073333333333	2	1909.7329	1909.7340	R	Y	490	505
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	141	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=2721	33.67928	2	2488.0352	2487.0372	R	R	42	68
PSM	AASPPASASDLIEQQQK	142	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=2908	35.54774666666667	3	1887.9604	1887.9610	R	R	333	350
PSM	SCFESSPDPELK	143	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,2-UNIMOD:4,5-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2472	31.317436666666666	2	1542.694802	1542.694962	R	S	871	883
PSM	QENCGAQQVPAGPGTSTPPSSPVR	144	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,4-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=2241	29.201203333333332	3	2535.161925	2535.163734	R	T	257	281
PSM	DNSTMGYMMAK	145	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=905	17.649	2	1363.6094	1363.6094	R	K	613	624
PSM	EIIDLVLDR	146	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4279	48.965	2	1118.6759	1118.6759	K	I	78	87
PSM	ELISNSSDALDK	147	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2185	28.678	2	1358.7566	1358.7566	R	I	47	59
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	148	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2514	31.686	4	3658.6091	3658.6091	K	-	158	196
PSM	GEPNVSYICSR	149	sp|P49841|GSK3B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2269	29.462	2	1394.6114	1394.6114	R	Y	210	221
PSM	GLSEDTTEETLK	150	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2468	31.287	2	1469.7175	1469.7175	K	E	578	590
PSM	HGESAWNLENR	151	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1841	25.858	2	1345.6587	1345.6587	R	F	11	22
PSM	HGYIGEFEIIDDHR	152	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3428	40.471	3	1733.8586	1733.8586	K	A	44	58
PSM	LMIEMDGTENK	153	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2523	31.792	2	1363.7	1363.7000	K	S	93	104
PSM	NNASTDYDLSDK	154	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1504	23.166	2	1409.6947	1409.6947	K	S	301	313
PSM	QASTDAGTAGALTPQHVR	155	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1698	24.733	3	1893.9158	1893.9158	R	A	107	125
PSM	QLSSGVSEIR	156	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2178	28.627	2	1188.5964	1188.5964	R	H	80	90
PSM	RDSFDDRGPSLNPVLDYDHGSR	157	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3262	38.827	4	2631.1927	2631.1927	R	S	186	208
PSM	SADTLWDIQK	158	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3974	45.74	2	1323.6748	1323.6748	K	D	320	330
PSM	SIYYITGESK	159	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2622	32.705	2	1227.7023	1227.7023	K	E	482	492
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	160	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,3-UNIMOD:21	ms_run[2]:scan=2755	33.974	3	2528.1522	2528.1522	R	L	815	839
PSM	STIGVMVTASHNPEEDNGVK	161	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2742	33.848	3	2232.077	2232.0770	K	L	55	75
PSM	SVEDDEEGHLICQSGDVLSAR	162	sp|P49759-3|CLK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=3649	42.638	3	2509.0293	2509.0293	R	Y	182	203
PSM	TLQEVTQLSQEAQR	163	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2812	34.534	3	1663.8953	1663.8953	K	I	112	126
PSM	TTPSYVAFTDTER	164	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3020	36.458	2	1520.7571	1520.7571	R	L	37	50
PSM	VERADGYEPPVQESV	165	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2656	33.04	2	1787.8191	1787.8191	K	-	250	265
PSM	YLSEVASGDNK	166	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1256	21.034	2	1249.6827	1249.6827	R	Q	128	139
PSM	QTTPESDFNLQALR	167	sp|Q7Z4H7|HAUS6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3972	45.724801666666664	3	1732.824381	1732.824548	R	S	821	835
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	168	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=2755	33.97449	3	2530.1522	2528.1512	R	L	815	839
PSM	AQSLEPYGTGLR	169	sp|Q63ZY3-3|KANK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2772	34.154	2	1404.6863	1404.6863	R	A	354	366
PSM	ATAGDTHLGGEDFDNR	170	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1744	25.126	3	1708.7865	1708.7865	K	L	166	182
PSM	DLYANTVLSGGTTMYPGIADR	171	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=4947	58.018	3	2408.0585	2408.0585	K	M	292	313
PSM	DNSTMGYMMAK	172	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2781	34.247	2	1315.6247	1315.6247	R	K	613	624
PSM	DVNQQEFVR	173	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2020	27.341	2	1167.6097	1167.6097	K	A	8	17
PSM	EAFNMIDQNR	174	sp|P24844-2|MYL9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2567	32.144	2	1270.6188	1270.6188	K	D	36	46
PSM	EQFLDGDGWTSR	175	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=3431	40.507	2	1443.6843	1443.6843	K	W	25	37
PSM	ESSLSPSPASSISSR	176	sp|Q12968-5|NFAC3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2152	28.435	2	1604.7507	1604.7507	R	S	159	174
PSM	ESVPEFPLSPPK	177	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4047	46.564	2	1473.7793	1473.7793	K	K	30	42
PSM	GDFCIQVGR	178	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=2750	33.937	2	1084.5548	1084.5548	R	N	91	100
PSM	GFSLEELR	179	sp|P26373-2|RL13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4019	46.286	2	1063.5163	1063.5163	R	V	75	83
PSM	GRSAINEVVTR	180	sp|P62899-3|RL31_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1737	25.047	2	1314.6869	1314.6869	K	E	13	24
PSM	LGMLSPEGTCK	181	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=2936	35.769	2	1339.6553	1339.6553	R	A	203	214
PSM	NNTQVLINCR	182	sp|P62316-2|SMD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=1653	24.385	2	1264.677	1264.6770	K	N	28	38
PSM	NQDNLQGWNK	183	sp|P30085-2|KCY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=1814	25.657	2	1283.6895	1283.6895	R	T	48	58
PSM	QLVRGEPNVSYICSR	184	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=2602	32.541	3	1890.9235	1890.9236	K	Y	206	221
PSM	QVPDSAATATAYLCGVK	185	sp|P09923|PPBI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=3881	44.788	3	1898.9485	1898.9486	R	A	107	124
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	186	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=1930	26.593	4	3352.5468	3352.5468	R	Q	205	235
PSM	SEDYVDIVQGNR	187	sp|O00469-3|PLOD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2919	35.644	2	1427.7105	1427.7105	R	V	101	113
PSM	SLSYSPVER	188	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2666	33.126	2	1230.5147	1230.5147	R	R	2690	2699
PSM	SRSPESQVIGENTK	189	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1378	22.081	2	1678.8564	1678.8564	R	Q	305	319
PSM	TQEEGEERAESEQEAYLRED	190	sp|Q9NR28-2|DBLOH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2424	30.881	3	2511.0499	2511.0499	K	-	167	187
PSM	VVDFGSATYDDEHHSTLVSTR	191	sp|P49759-3|CLK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=3474	41.011	3	2609.0338	2609.0338	K	H	365	386
PSM	EDQTEYLEER	192	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510	ms_run[1]:scan=1900	26.35465	2	1344.6247	1344.6252	K	R	187	197
PSM	SRSPESQVIGENTK	193	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=1378	22.08127	2	1678.8541	1678.8558	R	Q	305	319
PSM	QRLLSVTSDEGSMNAFTGR	194	sp|Q8WYB5|KAT6B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=4376	50.06777666666667	2	2229.927286	2227.933414	K	G	351	370
PSM	AASPPASASDLIEQQQK	195	sp|Q5VSL9-3|STRP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=2908	35.548	3	1887.9616	1887.9616	R	R	69	86
PSM	AEEYTEETEEREESTTGFDK	196	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,14-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2393	30.613	3	2527.08	2527.0800	K	S	792	812
PSM	ALLYLCGGDD	197	sp|A6NMY6|AXA2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=4071	46.832	2	1129.5538	1129.5538	K	-	330	340
PSM	DNLTLWTSDQQDEEAGEGN	198	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=4258	48.753	3	2154.9402	2154.9402	R	-	228	247
PSM	DNLTLWTSDSAGEECDAAEGAEN	199	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=4411	50.408	3	2488.0396	2488.0396	R	-	223	246
PSM	DVTPPPETEVVLIK	200	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4229	48.472	2	1683.9372	1683.9372	K	N	519	533
PSM	DYEEVGVDSVEGEGEEEGEEY	201	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=4049	46.58	3	2381.9607	2381.9607	K	-	396	417
PSM	EALQDVEDENQ	202	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=2128	28.221	2	1322.605	1322.6050	K	-	223	234
PSM	EATNPPVIQEEKPK	203	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=1518	23.271	3	1760.981	1760.9810	R	K	483	497
PSM	ERDHSPTPSVFNSDEER	204	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=1931	26.601	3	2194.8782	2194.8782	R	Y	414	431
PSM	GGSGSGPTIEEVD	205	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=2111	28.06	2	1237.5886	1237.5886	K	-	574	587
PSM	KITIADCGQLE	206	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2556	32.061	2	1314.749	1314.7490	K	-	95	106
PSM	QASVTLQPLK	207	sp|P78345|RPP38_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2729	33.739	2	1231.7214	1231.7214	R	I	251	261
PSM	SSSPVTELASR	208	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2200	28.817	2	1246.6019	1246.6019	R	S	1101	1112
PSM	TNQELQEINR	209	sp|A6NMY6|AXA2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=1486	22.992	2	1277.6788	1277.6788	R	V	136	146
PSM	VEVTEFEDIK	210	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3387	40.05	2	1275.7235	1275.7235	R	S	98	108
PSM	YGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAK	211	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,18-UNIMOD:510,28-UNIMOD:21,38-UNIMOD:510	ms_run[2]:scan=4321	49.453	4	4205.7706	4205.7706	K	R	79	117
PSM	DNLTLWTSDQQDDDGGEGNN	212	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510	ms_run[1]:scan=4384	50.14074166666667	3	2227.9402	2226.9352	R	-	228	248
PSM	STTPPPAEPVSLPQEPPKPR	213	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2659	33.07589333333333	3	2272.2129	2272.2136	K	V	225	245
PSM	SVSTPSEAGSQDSGDGAVGSR	214	sp|Q13409|DC1I2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,4-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=3483	41.089441666666666	2	2191.767641	2189.755249	K	T	92	113
PSM	QPSSSRRDSSWSETSEASYSGL	215	sp|P49682|CXCR3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=2624	32.719503333333336	3	2679.028490	2677.019585	R	-	347	369
PSM	ADLLLSTQPGREEGSPLELER	216	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3983	45.844	3	2423.2158	2423.2158	K	L	492	513
PSM	CRSPGMLEPLGSSR	217	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=2504	31.598	3	1659.7686	1659.7686	R	T	2130	2144
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	218	sp|Q6NXS1|IPP2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,38-UNIMOD:510	ms_run[2]:scan=3489	41.16	4	4335.7936	4335.7936	K	L	164	202
PSM	DVIELTDDSFDK	219	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=4040	46.498	2	1463.7668	1463.7668	K	N	158	170
PSM	EFHLNESGDPSSK	220	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=1770	25.316	3	1513.7685	1513.7685	K	S	130	143
PSM	EITALAPSTMK	221	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2952	35.886	2	1308.7037	1308.7037	K	I	316	327
PSM	ELSPPPGLPSK	222	sp|Q7Z4S6-6|KI21A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2898	35.42	2	1268.7054	1268.7054	K	I	1174	1185
PSM	FAFQAEVNR	223	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510	ms_run[2]:scan=2773	34.161	2	1114.5984	1114.5984	K	M	76	85
PSM	GEPNVSYICSR	224	sp|P49841|GSK3B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2380	30.505	2	1394.6114	1394.6114	R	Y	210	221
PSM	GRSSFYPDGGDQETAK	225	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1793	25.484	3	1861.852	1861.8520	R	T	317	333
PSM	QDSSTGSYSINFVQNPNNNR	226	sp|Q99614|TTC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510	ms_run[2]:scan=3102	37.273	3	2275.0678	2275.0678	K	-	273	293
PSM	QTTPESDFNLQALR	227	sp|Q7Z4H7-3|HAUS6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3972	45.725	3	1732.8245	1732.8245	R	S	786	800
PSM	RQMSVPGIFNPHEIPEEMCD	228	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,3-UNIMOD:35,4-UNIMOD:21,18-UNIMOD:35,19-UNIMOD:4	ms_run[2]:scan=3695	43.034	3	2531.0744	2531.0745	K	-	1052	1072
PSM	SRSPESQVIGENTKQP	229	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1647	24.34	3	1903.9677	1903.9677	R	-	305	321
PSM	STTPPPAEPVSLPQEPPKPR	230	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,2-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2659	33.076	3	2272.2141	2272.2141	K	V	225	245
PSM	TRSRSPESQVIGENTK	231	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1357	21.907	3	2015.9715	2015.9715	R	Q	303	319
PSM	VIGSGCNLDSAR	232	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1451	22.734	2	1281.656	1281.6560	R	F	100	112
PSM	YCEAARSEIQVLEHLNTTDPNSTFR	233	sp|P49759-3|CLK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,2-UNIMOD:4,7-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=4438	50.705	4	3144.3837	3144.3837	R	C	241	266
PSM	DLYANTVLSGGTTMYPGIADR	234	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=4947	58.01842166666667	3	2408.0577	2408.0579	K	M	292	313
PSM	VEIIANDQGNRTTPSYVAFTDTER	235	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=3725	43.32378833333333	3	2810.3321	2810.3331	K	L	27	51
PSM	VEIIANDQGNR	236	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510	ms_run[1]:scan=1582	23.812435	2	1261.6827	1261.6834	K	T	27	38
PSM	TRSRSPESQVIGENTK	237	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=1357	21.907188333333334	3	2015.9704	2015.9710	R	Q	303	319
PSM	SSSPAPADIAQTVQEDLR	238	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[1]:scan=4615	52.924415	3	1997.951851	1997.951933	K	T	230	248