MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100616_008PKN1.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100616_008PKN1.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	228-UNIMOD:510	0.09	45.0	4	1	0
PRT	sp|Q16512-2|PKN1_HUMAN	Isoform 2 of Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	149-UNIMOD:510,162-UNIMOD:21,164-UNIMOD:510,528-UNIMOD:510,539-UNIMOD:21,192-UNIMOD:510,211-UNIMOD:21,154-UNIMOD:35,527-UNIMOD:510,543-UNIMOD:21,778-UNIMOD:510,780-UNIMOD:21,782-UNIMOD:4,784-UNIMOD:21,293-UNIMOD:510,302-UNIMOD:21,307-UNIMOD:21,193-UNIMOD:510,559-UNIMOD:510,565-UNIMOD:21,568-UNIMOD:21,571-UNIMOD:510,778-UNIMOD:21,310-UNIMOD:510,320-UNIMOD:21,321-UNIMOD:21,323-UNIMOD:4,324-UNIMOD:510,550-UNIMOD:510,555-UNIMOD:21,558-UNIMOD:510,296-UNIMOD:510,905-UNIMOD:510,922-UNIMOD:21,303-UNIMOD:21,864-UNIMOD:510,866-UNIMOD:21,867-UNIMOD:21,875-UNIMOD:510	0.20	40.0	18	13	6
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	207-UNIMOD:510	0.14	38.0	1	1	1
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,446-UNIMOD:510	0.03	37.0	2	2	2
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	228-UNIMOD:510	0.08	36.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	119-UNIMOD:510,136-UNIMOD:21,137-UNIMOD:510,205-UNIMOD:510,209-UNIMOD:21	0.16	36.0	2	2	2
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	142-UNIMOD:510,176-UNIMOD:510	0.05	36.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,44-UNIMOD:510,46-UNIMOD:21	0.08	35.0	2	2	2
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	354-UNIMOD:510,365-UNIMOD:21,353-UNIMOD:510,366-UNIMOD:21	0.02	35.0	3	2	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	221-UNIMOD:510,329-UNIMOD:510,340-UNIMOD:21	0.06	35.0	3	2	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	34.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	43-UNIMOD:510,57-UNIMOD:510,100-UNIMOD:510,105-UNIMOD:4,103-UNIMOD:21	0.11	33.0	3	2	1
PRT	sp|Q16512|PKN1_HUMAN	Serine/threonine-protein kinase N1 OS=Homo sapiens OX=9606 GN=PKN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	522-UNIMOD:510,533-UNIMOD:21,537-UNIMOD:21,143-UNIMOD:510,153-UNIMOD:21,158-UNIMOD:510,772-UNIMOD:510,772-UNIMOD:21,776-UNIMOD:4,778-UNIMOD:21,156-UNIMOD:21,287-UNIMOD:510,297-UNIMOD:21,301-UNIMOD:21,372-UNIMOD:510,372-UNIMOD:21,374-UNIMOD:21,376-UNIMOD:21,382-UNIMOD:510,396-UNIMOD:510,553-UNIMOD:510,562-UNIMOD:21,565-UNIMOD:510,773-UNIMOD:21,774-UNIMOD:21,764-UNIMOD:510,766-UNIMOD:35,290-UNIMOD:510,296-UNIMOD:21,187-UNIMOD:510,202-UNIMOD:21,768-UNIMOD:21	0.17	33.0	14	9	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	8-UNIMOD:510,23-UNIMOD:510	0.05	32.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	512-UNIMOD:510,514-UNIMOD:21,519-UNIMOD:21,515-UNIMOD:21,435-UNIMOD:510,76-UNIMOD:510	0.06	32.0	5	3	2
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	126-UNIMOD:510,139-UNIMOD:21,129-UNIMOD:510	0.11	31.0	2	2	2
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	292-UNIMOD:510,306-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,45-UNIMOD:21,482-UNIMOD:510,491-UNIMOD:510,276-UNIMOD:510,276-UNIMOD:21,284-UNIMOD:510,457-UNIMOD:510,462-UNIMOD:21,466-UNIMOD:35,187-UNIMOD:510,459-UNIMOD:21	0.13	31.0	9	7	5
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	933-UNIMOD:510,936-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	39-UNIMOD:510,40-UNIMOD:21	0.09	29.0	1	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	47-UNIMOD:510,53-UNIMOD:21,58-UNIMOD:510,500-UNIMOD:510,251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,270-UNIMOD:510	0.06	29.0	4	3	2
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	581-UNIMOD:510,591-UNIMOD:4,593-UNIMOD:21,594-UNIMOD:510,33-UNIMOD:510,38-UNIMOD:21,41-UNIMOD:4,42-UNIMOD:510,639-UNIMOD:510	0.04	29.0	3	3	3
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	29.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	81-UNIMOD:510,83-UNIMOD:21,86-UNIMOD:21,93-UNIMOD:510	0.09	28.0	1	1	1
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	189-UNIMOD:510,193-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510	0.03	28.0	2	1	0
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	204-UNIMOD:510,206-UNIMOD:21,210-UNIMOD:35,215-UNIMOD:35,182-UNIMOD:510,184-UNIMOD:21,192-UNIMOD:510	0.12	28.0	2	2	2
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	323-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|Q9H788-2|SH24A_HUMAN	Isoform 2 of SH2 domain-containing protein 4A OS=Homo sapiens OX=9606 GN=SH2D4A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	268-UNIMOD:510,270-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	27.0	2	1	0
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	239-UNIMOD:510,19-UNIMOD:510,40-UNIMOD:510,50-UNIMOD:510,52-UNIMOD:21,53-UNIMOD:21,61-UNIMOD:510,360-UNIMOD:510	0.17	27.0	4	4	3
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	129-UNIMOD:510,133-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	238-UNIMOD:510,240-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q8IXH6|T53I2_HUMAN	Tumor protein p53-inducible nuclear protein 2 OS=Homo sapiens OX=9606 GN=TP53INP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	205-UNIMOD:510,208-UNIMOD:21,214-UNIMOD:4,207-UNIMOD:21	0.06	25.0	2	1	0
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	241-UNIMOD:510,243-UNIMOD:21,246-UNIMOD:4,253-UNIMOD:510,244-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	66-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510,65-UNIMOD:510	0.09	24.0	2	2	2
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	291-UNIMOD:510,294-UNIMOD:21,301-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	221-UNIMOD:510,223-UNIMOD:21,231-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	340-UNIMOD:510,344-UNIMOD:21,353-UNIMOD:510	0.04	24.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	131-UNIMOD:510,135-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	96-UNIMOD:510	0.09	23.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	77-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	295-UNIMOD:510,305-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	237-UNIMOD:510,241-UNIMOD:21,246-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|Q8TEW0-8|PARD3_HUMAN	Isoform 8 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	832-UNIMOD:510,834-UNIMOD:21,843-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	235-UNIMOD:510,241-UNIMOD:21,247-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	26-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	133-UNIMOD:510,134-UNIMOD:4,136-UNIMOD:21,140-UNIMOD:21,144-UNIMOD:510	0.07	23.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	129-UNIMOD:510,130-UNIMOD:21,135-UNIMOD:21,144-UNIMOD:510	0.07	22.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	125-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	8-UNIMOD:510	0.07	22.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	134-UNIMOD:510	0.07	22.0	1	1	1
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	546-UNIMOD:510,550-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q8N257|H2B3B_HUMAN	Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	36-UNIMOD:510,39-UNIMOD:21,44-UNIMOD:510	0.08	22.0	1	1	1
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	175-UNIMOD:510,180-UNIMOD:21,184-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	329-UNIMOD:510,335-UNIMOD:21,336-UNIMOD:4,337-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	11-UNIMOD:510,11-UNIMOD:35,13-UNIMOD:21,19-UNIMOD:510	0.03	22.0	2	1	0
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	48-UNIMOD:510,51-UNIMOD:21,62-UNIMOD:510	0.09	22.0	1	1	1
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	257-UNIMOD:510,260-UNIMOD:4,272-UNIMOD:21	0.05	22.0	1	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	107-UNIMOD:510,116-UNIMOD:21,121-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|Q9UKV8-2|AGO2_HUMAN	Isoform 2 of Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	385-UNIMOD:510,387-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	333-UNIMOD:510,353-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	192-UNIMOD:510,194-UNIMOD:21,207-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	82-UNIMOD:510,92-UNIMOD:510	0.07	22.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	245-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.04	22.0	1	1	0
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	463-UNIMOD:510,475-UNIMOD:21,482-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q5SSJ5-3|HP1B3_HUMAN	Isoform 3 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	71-UNIMOD:510,75-UNIMOD:21,81-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:510,7-UNIMOD:21	0.21	21.0	1	1	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	134-UNIMOD:510,142-UNIMOD:510,145-UNIMOD:21,154-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	821-UNIMOD:510,823-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	286-UNIMOD:510,287-UNIMOD:21,294-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	200-UNIMOD:510,200-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	63-UNIMOD:510,65-UNIMOD:21,85-UNIMOD:510,68-UNIMOD:21	0.04	21.0	2	1	0
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	908-UNIMOD:510,910-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|Q9Y3B8-2|ORN_HUMAN	Isoform 2 of Oligoribonuclease, mitochondrial OS=Homo sapiens OX=9606 GN=REXO2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	158-UNIMOD:510,165-UNIMOD:21,167-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	166-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	773-UNIMOD:510,773-UNIMOD:4,775-UNIMOD:21,780-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	483-UNIMOD:510,485-UNIMOD:21,494-UNIMOD:510,496-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	1343-UNIMOD:510,1349-UNIMOD:21,1353-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|Q92890|UFD1_HUMAN	Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	290-UNIMOD:510,299-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	91-UNIMOD:510,94-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	118-UNIMOD:510,122-UNIMOD:21,126-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	35-UNIMOD:510,37-UNIMOD:21,39-UNIMOD:21,44-UNIMOD:510	0.09	20.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	93-UNIMOD:510,94-UNIMOD:35,103-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q6UXN9|WDR82_HUMAN	WD repeat-containing protein 82 OS=Homo sapiens OX=9606 GN=WDR82 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	3-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q9GZZ9|UBA5_HUMAN	Ubiquitin-like modifier-activating enzyme 5 OS=Homo sapiens OX=9606 GN=UBA5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	45-UNIMOD:21,50-UNIMOD:21,54-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	206-UNIMOD:510,207-UNIMOD:510,222-UNIMOD:21,224-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|P29692-4|EF1D_HUMAN	Isoform 4 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	39-UNIMOD:510,44-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P60900-3|PSA6_HUMAN	Isoform 3 of Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	93-UNIMOD:510,98-UNIMOD:21,102-UNIMOD:510	0.07	20.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	186-UNIMOD:510,188-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	97-UNIMOD:510,100-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	140-UNIMOD:510,140-UNIMOD:21,147-UNIMOD:510,155-UNIMOD:35,157-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|P43490|NAMPT_HUMAN	Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	470-UNIMOD:510,472-UNIMOD:21,478-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	598-UNIMOD:510,601-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	55-UNIMOD:510,63-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	16-UNIMOD:510,24-UNIMOD:21,26-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	33-UNIMOD:510,41-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	20.0	1	1	0
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	3924-UNIMOD:510,3927-UNIMOD:21,3936-UNIMOD:510	0.00	20.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	121-UNIMOD:510,123-UNIMOD:21,127-UNIMOD:35,128-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	71-UNIMOD:510,77-UNIMOD:4,78-UNIMOD:21	0.13	19.0	1	1	1
PRT	sp|Q6PCE3|PGM2L_HUMAN	Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	166-UNIMOD:510,171-UNIMOD:35,175-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q8IY81|SPB1_HUMAN	pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	683-UNIMOD:510,688-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	44-UNIMOD:510,52-UNIMOD:510	0.07	19.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	130-UNIMOD:510,142-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	25-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	263-UNIMOD:510,270-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	63-UNIMOD:510,64-UNIMOD:21,66-UNIMOD:4,74-UNIMOD:4,78-UNIMOD:510	0.08	19.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	64-UNIMOD:510,65-UNIMOD:510,66-UNIMOD:21,67-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	10-UNIMOD:510,14-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	213-UNIMOD:510,215-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q8N8S7-3|ENAH_HUMAN	Isoform 3 of Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	123-UNIMOD:510,125-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q9UQ35-2|SRRM2_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	846-UNIMOD:510,848-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|A6NMY6|AXA2L_HUMAN	Putative annexin A2-like protein OS=Homo sapiens OX=9606 GN=ANXA2P2 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	136-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	128-UNIMOD:510,138-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	40-UNIMOD:510,44-UNIMOD:35,47-UNIMOD:35,50-UNIMOD:510,52-UNIMOD:21,53-UNIMOD:21,61-UNIMOD:510	0.06	19.0	1	1	0
PRT	sp|Q8TDR0-2|MIPT3_HUMAN	Isoform 2 of TRAF3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TRAF3IP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	357-UNIMOD:21,372-UNIMOD:510	0.04	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510	ms_run[2]:scan=4643	48.931	2	2226.9361	2226.9361	R	-	228	248
PSM	QGAENMIQTYSNGSTK	2	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,14-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2887	32.73	2	1875.871	1875.8710	K	D	149	165
PSM	LIPNATGTGTFSPGASPGSEAR	3	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3588	38.494	2	2201.0578	2201.0578	R	T	528	550
PSM	RALQAGQLENQAAPDDTQGSPDLGAVELR	4	sp|Q16512-2|PKN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=3835	40.797	3	3133.5254	3133.5254	R	I	192	221
PSM	QGAENMIQTYSNGSTK	5	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,6-UNIMOD:35,14-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1743	23.995	2	1891.8659	1891.8659	K	D	149	165
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	6	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=4586	48.366	3	3490.5054	3490.5054	R	-	207	238
PSM	DNLTLWTSDQQDDDGGEGNN	7	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=4751	50.034	2	2226.9361	2226.9361	R	-	228	248
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	8	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2462	29.359	3	2847.2212	2847.2212	K	M	445	470
PSM	DNLTLWTSDQQDEEAGEGN	9	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=4614	48.625	2	2154.9402	2154.9402	R	-	228	247
PSM	GAEAANVTGPGGVPVQGSK	10	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,18-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2224	27.556	2	1842.9513	1842.9513	K	Y	119	138
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	11	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,35-UNIMOD:510	ms_run[2]:scan=3127	34.662	3	4220.6251	4220.6251	K	A	142	177
PSM	RLIPNATGTGTFSPGASPGSEAR	12	sp|Q16512-2|PKN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,13-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=3576	38.38	3	2437.1252	2437.1252	R	T	527	550
PSM	GILAADESTGSIAK	13	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2874	32.635	2	1479.7858	1479.7858	K	R	29	43
PSM	SDIDEIVLVGGSTR	14	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4517	47.689	2	1573.7813	1573.7813	K	I	354	368
PSM	STAGDTHLGGEDFDNR	15	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=1865	24.886	2	1724.7814	1724.7814	K	M	221	237
PSM	TPEELDDSDFETEDFDVR	16	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4769	50.193	2	2271.9157	2271.9157	R	S	264	282
PSM	ESLKEEDESDDDNM	17	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=1120	19.145	2	1738.7364	1738.7364	K	-	235	249
PSM	DLADELALVDVIEDK	18	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6093	68.185	2	1724.972	1724.9720	K	L	43	58
PSM	LIPNATGTGTFSPGASPGSEAR	19	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=3945	41.82648333333333	2	2281.0203	2281.0236	R	T	522	544
PSM	DNLTLWTSDQQDDDGGEGNN	20	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:510	ms_run[1]:scan=5279	56.98240333333333	2	2227.936759	2226.936145	R	-	228	248
PSM	LIAPVAEEEATVPNNK	21	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=3025	33.77	2	1762.0149	1762.0149	K	I	8	24
PSM	SQIHDIVLVGGSTR	22	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3215	35.439	2	1594.8292	1594.8292	K	I	329	343
PSM	QGAENMIQTYSNGSTK	23	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,11-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=2887	32.729861666666665	2	1875.8693	1875.8705	K	D	143	159
PSM	FQSSHHPTDITSLDQYVER	24	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=4020	42.537198333333336	3	2453.0501	2453.0509	R	M	512	531
PSM	IGRIEDVTPIPSDSTR	25	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=3350	36.476	2	1868.9457	1868.9457	K	R	126	142
PSM	NPDDITQEEYGEFYK	26	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3923	41.604	2	1914.916	1914.9160	R	S	292	307
PSM	TSTFCGTPEFLAPEVLTDTSYTR	27	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=5899	65.505	2	2786.2012	2786.2012	R	A	778	801
PSM	TSTFCGTPEFLAPEVLTDTSYTR	28	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=5899	65.50454	2	2786.1915	2786.2006	R	A	772	795
PSM	FQSSHHPTDITSLDQYVER	29	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4020	42.537	3	2453.0514	2453.0514	R	M	512	531
PSM	GVVDSDDLPLNVSR	30	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=3731	39.814	2	1518.8102	1518.8102	K	E	435	449
PSM	LLREELAAASSAAFSTR	31	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=3671	39.284	2	1985.9437	1985.9437	R	L	293	310
PSM	RNTTQNTGYSSGTQNANYPVR	32	sp|Q12965|MYO1E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1588	22.873	3	2442.1137	2442.1137	R	A	933	954
PSM	DSSTSPGDYVLSVSENSR	33	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4391	46.398	2	2012.8788	2012.8788	R	V	39	57
PSM	ELISNASDALDK	34	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2865	32.571	2	1342.7616	1342.7616	R	I	42	54
PSM	ELISNSSDALDK	35	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2775	31.843	2	1438.7229	1438.7229	R	I	47	59
PSM	ETVSEESNVLCLSK	36	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:4,13-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3646	39.076	2	1741.8482	1741.8482	R	S	581	595
PSM	TAFQEALDAAGDK	37	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3333	36.354	2	1403.7569	1403.7569	K	L	9	22
PSM	AITGASLADIMAK	38	sp|P83731|RL24_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5081	54.078	2	1488.7337	1488.7337	R	R	81	94
PSM	EIDDSVLGQTGPYR	39	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3842	40.874	2	1662.7714	1662.7714	K	R	189	203
PSM	EVDEQMLNVQNK	40	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1819	24.548	2	1529.8032	1529.8032	K	N	325	337
PSM	GASQAGMTGYGMPR	41	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=1292	20.582	2	1528.6264	1528.6264	R	Q	204	218
PSM	KSDIDEIVLVGGSTR	42	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3846	40.903	2	1735.9394	1735.9394	K	I	353	368
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	43	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2860	32.533	3	2685.0632	2685.0632	K	M	446	470
PSM	TAENATSGETLEENEAGD	44	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=1988	25.779	2	1870.8128	1870.8128	K	-	323	341
PSM	TLSSSAQEDIIR	45	sp|Q9H788-2|SH24A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2951	33.211	2	1432.7023	1432.7023	R	W	268	280
PSM	ALQAGQLENQAAPDDTQGSPDLGAVELR	46	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,19-UNIMOD:21	ms_run[2]:scan=4349	45.93	3	2977.4242	2977.4242	R	I	193	221
PSM	DNLTLWTSDQQDDDGGEGNN	47	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=5187	55.55	2	2226.9361	2226.9361	R	-	228	248
PSM	EGLELPEDEEEK	48	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2965	33.314	2	1483.7566	1483.7566	K	K	539	551
PSM	EVDEQMLNVQNK	49	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2787	31.944	2	1513.8083	1513.8083	K	N	325	337
PSM	FQSSHHPTDITSLDQYVER	50	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3703	39.581	3	2373.0851	2373.0851	R	M	512	531
PSM	KEESEESDDDMGFGLFD	51	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=5014	53.202	2	2016.8783	2016.8783	K	-	73	90
PSM	LNLGTDSDSSPQK	52	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2747	31.64	2	1588.7059	1588.7059	K	S	559	572
PSM	RVSVCAETYNPDEEEEDTDPR	53	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2727	31.44	3	2624.0798	2624.0798	R	V	97	118
PSM	SYELPDGQVITIGNER	54	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4692	49.362	2	1823.9478	1823.9478	K	F	239	255
PSM	TSTFCGTPEFLAPEVLTDTSYTR	55	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=5594	61.262	3	2706.2348	2706.2348	R	A	778	801
PSM	LGDVYVNDAFGTAHR	56	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3674	39.305	3	1747.8143	1747.8143	K	A	129	144
PSM	SRTHSTSSSLGSGESPFSR	57	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1902	25.153	3	2079.9435	2079.9435	R	S	238	257
PSM	TDYNASVSVPDSSGPER	58	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2691	31.18	2	1893.8206	1893.8206	R	I	70	87
PSM	QGAENMIQTYSNGSTK	59	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,14-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=2908	32.881811666666664	2	1875.869856	1875.871028	K	D	143	159
PSM	KSDIDEIVLVGGSTR	60	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[1]:scan=3846	40.903490000000005	2	1735.938116	1735.939366	K	I	353	368
PSM	LLREELAAASSAAFSTR	61	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=3671	39.2842	2	1985.941708	1985.943691	R	L	287	304
PSM	ELISNASDALDK	62	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3702	39.574	2	1422.728	1422.7280	R	I	42	54
PSM	LAGPFPATHYSTLCK	63	sp|Q16512-2|PKN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:4,15-UNIMOD:510	ms_run[2]:scan=4222	44.548	2	1889.8825	1889.8825	R	P	310	325
PSM	LIPNATGTGTFSPGASPGSEAR	64	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=3990	42.255	3	2281.0241	2281.0241	R	T	528	550
PSM	NFSDNQLQEGK	65	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2382	28.752	2	1426.6766	1426.6766	R	N	182	193
PSM	NQSSFIYQPCQR	66	sp|Q8IXH6|T53I2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=2998	33.569	2	1640.7231	1640.7231	K	Q	205	217
PSM	VDSTTCLFPVEEK	67	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=4238	44.714	2	1671.8103	1671.8103	R	A	241	254
PSM	SGSLSGRSSLKAEAENTSEVSTVLK	68	sp|Q16512|PKN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,3-UNIMOD:21,5-UNIMOD:21,11-UNIMOD:510,25-UNIMOD:510	ms_run[1]:scan=4126	43.450064999999995	3	2878.3843	2878.3859	R	L	372	397
PSM	LNLGTDSDSSPQK	69	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=2246	27.714895000000002	2	1508.7378	1508.7391	K	S	553	566
PSM	TSTFCGTPEFLAPEVLTDTSYTR	70	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=5899	65.50454	2	2786.192094	2786.201164	R	A	772	795
PSM	LLREELAAASSAAFSTR	71	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=3660	39.203	3	1985.9437	1985.9437	R	L	293	310
PSM	NQSFCPTVNLDK	72	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=3425	37.081	2	1569.7535	1569.7535	R	L	66	78
PSM	RAESMLQQADK	73	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1676	23.512	2	1423.7167	1423.7167	K	L	291	302
PSM	SASWGSADQLK	74	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2994	33.54	2	1296.6388	1296.6388	R	E	221	232
PSM	SGSSSPDSEITELK	75	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3091	34.333	2	1583.7604	1583.7604	R	F	340	354
PSM	SLYESFVSSSDR	76	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3932	41.668	2	1489.655	1489.6550	K	L	131	143
PSM	TTGDISVEKLNLGTDSDSSPQK	77	sp|Q16512-2|PKN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:510,19-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=3900	41.438	3	2553.2349	2553.2349	R	S	550	572
PSM	LIPNATGTGTFSPGASPGSEAR	78	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=4057	42.842818333333334	2	2281.0203	2281.0236	R	T	522	544
PSM	PGTETEESMGGGEGNHR	79	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=933	17.398591666666665	3	1743.7097	1743.7113	D	A	2014	2031
PSM	DGNGYISAAELR	80	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=3253	35.755	2	1298.6679	1298.6679	K	H	96	108
PSM	DLIHDQDEDEEEEEGQR	81	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2103	26.623	3	2118.9038	2118.9038	R	F	77	94
PSM	EELAAASSAAFSTR	82	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3170	35.025	2	1603.6745	1603.6745	R	L	296	310
PSM	ELISNSSDALDK	83	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2363	28.617	2	1358.7566	1358.7566	R	I	47	59
PSM	FASENDLPEWK	84	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4301	45.387	2	1482.7068	1482.7068	R	E	58	69
PSM	GDLGIEIPAEK	85	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3603	38.672	2	1208.7289	1208.7289	R	V	295	306
PSM	GYFEYIEENK	86	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3853	40.994	2	1438.6694	1438.6694	R	Y	237	247
PSM	QFSDASQLDFVK	87	sp|Q8TEW0-8|PARD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4426	46.669	2	1531.7596	1531.7596	K	T	832	844
PSM	TDVSNFDEEFTGEAPTLSPPRDAR	88	sp|Q16512-2|PKN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=4635	48.82	3	2764.2442	2764.2442	R	P	905	929
PSM	VIGSGCNLDSAR	89	sp|P00338-4|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1570	22.743	2	1281.656	1281.6560	R	F	100	112
PSM	VPTANVSVVDLTCR	90	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3870	41.182	2	1643.8166	1643.8166	R	L	235	249
PSM	EGMGYGDRTSTFCGTPEFLAPEVLTDTSYTR	91	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,3-UNIMOD:35,9-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=5445	59.35668166666667	3	3667.5274	3667.5344	K	A	764	795
PSM	VEIIANDQGNR	92	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510	ms_run[1]:scan=1716	23.804593333333333	2	1261.6827	1261.6834	K	T	26	37
PSM	GCGTVLLSGPRK	93	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,2-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2358	28.58013833333333	2	1471.7282	1471.7291	K	G	133	145
PSM	AGFAGDDAPR	94	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1331	20.887	2	1009.5041	1009.5041	K	A	19	29
PSM	ASGNYATVISHNPETK	95	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2953	33.226	3	1915.8755	1915.8755	R	K	129	145
PSM	DNNQFASASLDR	96	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2441	29.207	2	1370.6639	1370.6639	K	T	125	137
PSM	DQVANSAFVER	97	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2192	27.323	2	1268.6573	1268.6573	K	L	500	511
PSM	DVNQQEFVR	98	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2189	27.301	2	1167.6097	1167.6097	K	A	8	17
PSM	EGMNIVEAMER	99	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4064	42.894	2	1311.6375	1311.6375	K	F	134	145
PSM	ERLESLNIQR	100	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2878	32.664	2	1370.7131	1370.7131	K	E	546	556
PSM	ESYSIYVYK	101	sp|Q8N257|H2B3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3756	40.012	2	1298.6472	1298.6472	K	V	36	45
PSM	FLDGIYVSEK	102	sp|P32969|RL9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4138	43.548	2	1317.6894	1317.6894	K	G	175	185
PSM	GPLQSVQVFGR	103	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3974	42.114	2	1300.6753	1300.6753	K	K	5	16
PSM	GSQFGQSCCLR	104	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=2162	27.109	2	1412.579	1412.5790	K	A	329	340
PSM	IEDVTPIPSDSTR	105	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2936	33.103	2	1542.7391	1542.7391	R	R	129	142
PSM	LQSIGTENTEENR	106	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1780	24.255	2	1603.7303	1603.7303	R	R	44	57
PSM	MESALDQLK	107	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2622	30.626	2	1197.5989	1197.5989	R	Q	11	20
PSM	NRPTSISWDGLDSGK	108	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3712	39.674	2	1779.8829	1779.8829	K	L	48	63
PSM	QENCGAQQVPAGPGTSTPPSSPVR	109	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=2419	29.017	3	2535.1637	2535.1637	R	T	257	281
PSM	RNQSFCPTVNLDK	110	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2730	31.462	2	1725.8546	1725.8546	K	L	65	78
PSM	RQAVTNPNNTFYATK	111	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1775	24.22	3	1871.9567	1871.9567	K	R	107	122
PSM	SASFNTDPYVR	112	sp|Q9UKV8-2|AGO2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3037	33.885	2	1369.6128	1369.6128	R	E	385	396
PSM	SIYYITGESK	113	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2889	32.745	2	1227.7023	1227.7023	K	E	482	492
PSM	SSGSPYGGGYGSGGGSGGYGSR	114	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=2006	25.91	2	2023.8121	2023.8121	R	R	333	355
PSM	STLTDSLVCK	115	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4,10-UNIMOD:510	ms_run[2]:scan=2921	32.979	2	1270.6516	1270.6516	K	A	33	43
PSM	TASFSESRADEVAPAK	116	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2034	26.115	2	1812.8931	1812.8931	R	K	192	208
PSM	VDSTTCLFPVEEK	117	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=4254	44.898	2	1671.8103	1671.8103	R	A	241	254
PSM	YALYDATYETK	118	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3154	34.884	2	1404.7449	1404.7449	R	E	82	93
PSM	YIDQEELNK	119	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=1915	25.247	2	1298.6432	1298.6432	K	T	276	285
PSM	EELAAASSAAFSTR	120	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=2990	33.511343333333336	2	1523.7065	1523.7076	R	L	290	304
PSM	EALQDVEDENQ	121	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510	ms_run[1]:scan=2304	28.158878333333334	2	1322.604350	1322.605022	K	-	245	256
PSM	QENCGAQQVPAGPGTSTPPSSPVR	122	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=2419	29.017359999999996	3	2535.1612	2535.1632	R	T	257	281
PSM	AGEEDEGEEDSDSDYEISAK	123	sp|A2RRP1-2|NBAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2476	29.459	2	2321.9221	2321.9221	R	A	463	483
PSM	DVIELTDDSFDK	124	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=4418	46.611	2	1463.7668	1463.7668	K	N	158	170
PSM	FAFQAEVNR	125	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3078	34.213	2	1114.5984	1114.5984	K	M	76	85
PSM	GASGSFVVVQK	126	sp|Q5SSJ5-3|HP1B3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2517	29.782	2	1225.6744	1225.6744	K	S	71	82
PSM	GHQQLYWSHPR	127	sp|P62273|RS29_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1762	24.126	2	1521.7091	1521.7091	M	K	2	13
PSM	KEESEESDDDMGFGLFD	128	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4363	46.065	2	2032.8732	2032.8732	K	-	73	90
PSM	NGSLDSPGKQDTEEDEEEDEK	129	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:510,12-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=1361	21.118	3	2532.1125	2532.1125	K	D	134	155
PSM	SGSYSYLEER	130	sp|O14974-5|MYPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2793	31.988	2	1303.5546	1303.5546	R	K	821	831
PSM	STFVLDEFK	131	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=4869	51.477	2	1232.6366	1232.6366	K	R	286	295
PSM	TLSNAEDYLDDEDSD	132	sp|Q92882|OSTF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4459	46.975	2	1814.6831	1814.6831	R	-	200	215
PSM	VIGSGCNLDSAR	133	sp|P00338-4|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=2112	26.704	2	1361.6223	1361.6223	R	F	100	112
PSM	QGAENMIQTYSNGSTK	134	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,14-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=2907	32.87423166666667	3	1875.8699	1875.8705	K	D	143	159
PSM	AASAATAAPTATPAAQESGTIPK	135	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,23-UNIMOD:510	ms_run[1]:scan=2457	29.32359166666667	3	2230.1499	2230.1514	R	K	63	86
PSM	SGSYSYLEER	136	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2798	32.023273333333336	2	1303.5538	1303.5541	R	K	908	918
PSM	NQSSFIYQPCQR	137	sp|Q8IXH6|T53I2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=2998	33.568835	2	1640.7219	1640.7225	K	Q	205	217
PSM	ALQAGQLENQAAPDDTQGSPDLGAVELR	138	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=4349	45.929805	3	2977.421943	2977.424242	R	I	187	215
PSM	AASAATAAPTATPAAQESGTIPK	139	sp|O00116|ADAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=2457	29.324	3	2230.1519	2230.1519	R	K	63	86
PSM	ALDDISESIK	140	sp|Q9Y3B8-2|ORN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3083	34.249	2	1237.6479	1237.6479	R	E	158	168
PSM	ATAGDTHLGGEDFDNR	141	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1889	25.059	3	1708.7865	1708.7865	K	L	166	182
PSM	CLSVMEAK	142	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=2733	31.485	2	1084.5334	1084.5334	K	V	773	781
PSM	EATNPPVIQEEKPK	143	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=1624	23.136	3	1760.981	1760.9810	R	K	483	497
PSM	EELAAASSAAFSTR	144	sp|Q16512-2|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2990	33.511	2	1523.7081	1523.7081	R	L	296	310
PSM	ESEDKPEIEDVGSDEEEEKK	145	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510,20-UNIMOD:510	ms_run[2]:scan=1855	24.811	4	2456.2603	2456.2603	K	D	251	271
PSM	EVDYSDSLTEK	146	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2475	29.453	2	1432.6647	1432.6647	K	Q	1343	1354
PSM	FVAFSGEGQSLR	147	sp|Q92890|UFD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3622	38.811	2	1410.6757	1410.6757	R	K	290	302
PSM	GDFCIQVGR	148	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=3044	33.936	2	1084.5548	1084.5548	R	N	91	100
PSM	HMYHSLYLK	149	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2295	28.094	2	1338.6832	1338.6832	R	V	118	127
PSM	HQGVMVGMGQKDSYVGDEAQSK	150	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510,13-UNIMOD:21,14-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=2468	29.403	3	2612.1902	2612.1902	R	R	40	62
PSM	KESYSVYVYK	151	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3147	34.833	2	1526.756	1526.7560	R	V	35	45
PSM	LGSSERDAEDVK	152	sp|Q16512-2|PKN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1877	24.972	2	1532.6797	1532.6797	R	K	864	876
PSM	LMIEMDGTENK	153	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2757	31.712	2	1363.7	1363.7000	K	S	93	104
PSM	LTDSVLRSFR	154	sp|Q6UXN9|WDR82_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4046	42.726	2	1386.6522	1386.6522	K	V	3	13
PSM	MESALDQLK	155	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3233	35.596	2	1181.604	1181.6040	R	Q	11	20
PSM	MSSEVVDSNPYSRLMALK	156	sp|Q9GZZ9|UBA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21,8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=4767	50.178	2	2265.8853	2265.8853	K	R	43	61
PSM	NKPGPNIESGNEDDDASFK	157	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:510,17-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2060	26.308	3	2215.0531	2215.0531	K	I	206	225
PSM	NNSGEEFDCAFR	158	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2932	33.073	2	1478.6309	1478.6309	R	L	355	367
PSM	QENGASVILR	159	sp|P29692-4|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2773	31.829	2	1199.6124	1199.6124	R	D	39	49
PSM	QEYDESGPSIVHR	160	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1749	24.04	3	1549.7585	1549.7585	K	K	360	373
PSM	QTESTSFLEK	161	sp|P60900-3|PSA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2698	31.231	2	1316.6537	1316.6537	K	K	93	103
PSM	RDSFDDRGPSLNPVLDYDHGSR	162	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3592	38.524	4	2631.1927	2631.1927	R	S	186	208
PSM	RLSQSDEDVIR	163	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1928	25.339	2	1430.6979	1430.6979	K	L	119	130
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	164	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2531	29.894	4	3336.5519	3336.5519	R	Q	205	235
PSM	SLQSVAEER	165	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2510	29.732	2	1131.5385	1131.5385	R	A	97	106
PSM	SSILLDVKPWDDETDMAK	166	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,8-UNIMOD:510,16-UNIMOD:35,18-UNIMOD:510	ms_run[2]:scan=4736	49.831	3	2260.1435	2260.1435	K	L	140	158
PSM	SYSFDEIRK	167	sp|P43490|NAMPT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2934	33.088	2	1291.6486	1291.6486	K	N	470	479
PSM	TDGSISGDRQPVTVADYISR	168	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3815	40.598	3	2250.0742	2250.0742	R	A	598	618
PSM	TLSDYNIQK	169	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=2120	26.762	2	1148.6714	1148.6714	R	E	55	64
PSM	TQVAGGQLSFK	170	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3068	34.14	2	1282.6959	1282.6959	K	G	16	27
PSM	YHTSQSGDEMTSLSEYVSR	171	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3153	34.876	3	2305.9622	2305.9622	R	M	457	476
PSM	LDIDSPPITAR	172	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=3844	40.888648333333336	2	1310.6689	1310.6690	R	N	33	44
PSM	DSSTSPGDYVLSVSENSR	173	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4386	46.34805	3	2012.8777	2012.8783	R	V	39	57
PSM	RQGSFSEDVISHK	174	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=1958	25.55901	3	1636.8230	1636.8241	K	G	3924	3937
PSM	AHSIQIMK	175	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35,8-UNIMOD:510	ms_run[2]:scan=1209	19.948	2	1090.5883	1090.5883	R	V	121	129
PSM	ARLTEGCSFR	176	sp|P42677|RS27_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=1722	23.846	2	1309.6062	1309.6062	K	R	71	81
PSM	AVAGVMITASHNR	177	sp|Q6PCE3|PGM2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=1641	23.259	3	1455.7118	1455.7118	K	K	166	179
PSM	DLIDNSFNR	178	sp|Q8IY81|SPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3401	36.88	2	1206.5494	1206.5494	R	Y	683	692
PSM	DLSLEEIQK	179	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=3507	37.819	2	1141.6867	1141.6867	K	K	44	53
PSM	EDQTEYLEER	180	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2068	26.366	2	1344.6258	1344.6258	K	R	187	197
PSM	EFHLNESGDPSSK	181	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=1919	25.275	3	1513.7685	1513.7685	K	S	130	143
PSM	EQFLDGDGWTSR	182	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=3819	40.628	2	1443.6843	1443.6843	K	W	25	37
PSM	ESYDDVSSFR	183	sp|Q99848|EBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2882	32.693	2	1317.5338	1317.5338	R	A	263	273
PSM	FSVCVLGDQQHCDEAK	184	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,4-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=3740	39.894	3	2039.9118	2039.9118	K	A	63	79
PSM	GEPNVSYICSR	185	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2467	29.397	2	1394.6114	1394.6114	R	Y	210	221
PSM	GKSSFFSDR	186	sp|O00571-2|DDX3X_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21	ms_run[2]:scan=2804	32.067	2	1257.5469	1257.5469	R	G	64	73
PSM	GLSQSALPYR	187	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3124	34.627	2	1204.6066	1204.6066	K	R	10	20
PSM	IQVLQQQADDAEER	188	sp|P06753-4|TPM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2089	26.521	2	1641.7958	1641.7958	K	A	14	28
PSM	KESYSVYVYK	189	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2699	31.237	2	1446.7896	1446.7896	R	V	35	45
PSM	NPSTVEAFDLAQSNSEHSR	190	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3405	36.909	3	2201.9803	2201.9803	R	H	213	232
PSM	QNSQLPAQVQNGPSQEELEIQR	191	sp|Q8N8S7-3|ENAH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3666	39.248	3	2606.255	2606.2550	R	R	123	145
PSM	SGTPPRQGSITSPQANEQSVTPQR	192	sp|Q9UQ35-2|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1932	25.368	3	2636.2768	2636.2768	K	R	846	870
PSM	STAGDTHLGGEDFDNR	193	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1850	24.775	3	1724.7814	1724.7814	K	M	221	237
PSM	TNQELQEINR	194	sp|A6NMY6|AXA2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1613	23.056	2	1277.6788	1277.6788	R	V	136	146
PSM	YEWDVAEAR	195	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=3149	34.847	2	1171.5722	1171.5722	K	K	639	648
PSM	YHTSQSGDEMTSLSEYVSR	196	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4080	43.037	3	2289.9673	2289.9673	R	M	457	476
PSM	YLSEVASGDNK	197	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1349	21.015	2	1249.6827	1249.6827	R	Q	128	139
PSM	EGMGYGDRTSTFCGTPEFLAPEVLTDTSYTR	198	sp|Q16512|PKN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=5614	61.53700166666666	3	3651.5338	3651.5395	K	A	764	795
PSM	HQGVMVGMGQKDSYVGDEAQSK	199	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:510,13-UNIMOD:21,14-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=1453	21.830195	3	2644.1770	2644.1795	R	R	40	62
PSM	NSVEGDSTSDAEGDAGPAGQDK	200	sp|Q8TDR0-2|MIPT3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	7-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=5532	60.390730000000005	2	2221.9002	2219.8912	K	S	351	373