MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100527_014CTK_MATK.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100527_014CTK_MATK.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	223-UNIMOD:510	0.10	45.0	4	1	0
PRT	sp|Q27J81-2|INF2_HUMAN	Isoform 2 of Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	null	1192-UNIMOD:510,1206-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q96S44|PRPK_HUMAN	EKC/KEOPS complex subunit TP53RK OS=Homo sapiens OX=9606 GN=TP53RK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	6-UNIMOD:510,8-UNIMOD:21	0.09	43.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	180-UNIMOD:510,182-UNIMOD:21,105-UNIMOD:510,107-UNIMOD:21,119-UNIMOD:510	0.03	43.0	2	2	2
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	396-UNIMOD:510,397-UNIMOD:21,416-UNIMOD:21,277-UNIMOD:510,277-UNIMOD:21,280-UNIMOD:4,281-UNIMOD:4,278-UNIMOD:35	0.08	42.0	9	2	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	228-UNIMOD:510	0.09	42.0	10	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	198-UNIMOD:510,206-UNIMOD:21,154-UNIMOD:510	0.08	41.0	3	2	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	223-UNIMOD:510,139-UNIMOD:510,149-UNIMOD:21,157-UNIMOD:510	0.18	41.0	4	2	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	82-UNIMOD:510,94-UNIMOD:21,469-UNIMOD:510,502-UNIMOD:510,327-UNIMOD:510,328-UNIMOD:510	0.13	40.0	4	3	2
PRT	sp|P42679|MATK_HUMAN	Megakaryocyte-associated tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=MATK PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	484-UNIMOD:510,501-UNIMOD:21,499-UNIMOD:21,504-UNIMOD:21,12-UNIMOD:510,16-UNIMOD:4,18-UNIMOD:21	0.08	40.0	8	3	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	204-UNIMOD:510,213-UNIMOD:35,222-UNIMOD:510,121-UNIMOD:510,131-UNIMOD:510	0.14	39.0	5	2	0
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	314-UNIMOD:510,324-UNIMOD:21,319-UNIMOD:21,175-UNIMOD:510,177-UNIMOD:21	0.12	39.0	3	2	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	85-UNIMOD:510,89-UNIMOD:21,93-UNIMOD:4,90-UNIMOD:21,85-UNIMOD:21	0.04	39.0	3	1	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	221-UNIMOD:510,37-UNIMOD:510,41-UNIMOD:21,540-UNIMOD:510,545-UNIMOD:21,549-UNIMOD:35,550-UNIMOD:510,26-UNIMOD:510	0.08	39.0	5	4	3
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	207-UNIMOD:510,214-UNIMOD:21,218-UNIMOD:35	0.14	39.0	4	1	0
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	75-UNIMOD:510,84-UNIMOD:35	0.13	38.0	3	1	0
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	431-UNIMOD:510,432-UNIMOD:21,423-UNIMOD:510,430-UNIMOD:510	0.06	38.0	3	2	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	92-UNIMOD:510,97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,106-UNIMOD:21,112-UNIMOD:4,116-UNIMOD:4,117-UNIMOD:510	0.05	38.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	37.0	null	292-UNIMOD:510,301-UNIMOD:21,305-UNIMOD:21,306-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,379-UNIMOD:510,276-UNIMOD:510,276-UNIMOD:21,284-UNIMOD:510,482-UNIMOD:510,484-UNIMOD:21,485-UNIMOD:21,491-UNIMOD:510,613-UNIMOD:510,623-UNIMOD:510,457-UNIMOD:510,472-UNIMOD:21,462-UNIMOD:21,466-UNIMOD:35,297-UNIMOD:21,492-UNIMOD:510,617-UNIMOD:35,621-UNIMOD:35	0.15	37.0	18	8	4
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	300-UNIMOD:510,309-UNIMOD:21,314-UNIMOD:510,313-UNIMOD:21,192-UNIMOD:510,282-UNIMOD:510,283-UNIMOD:510,284-UNIMOD:21,292-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510,547-UNIMOD:510,558-UNIMOD:510,559-UNIMOD:510,251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,270-UNIMOD:510,621-UNIMOD:510,631-UNIMOD:510,490-UNIMOD:510,499-UNIMOD:510	0.15	36.0	12	9	7
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	230-UNIMOD:510,232-UNIMOD:21,230-UNIMOD:21	0.04	36.0	3	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	239-UNIMOD:510,240-UNIMOD:21,292-UNIMOD:510,294-UNIMOD:21,305-UNIMOD:35,306-UNIMOD:21,360-UNIMOD:510,297-UNIMOD:21,19-UNIMOD:510,184-UNIMOD:510,191-UNIMOD:510,197-UNIMOD:510,362-UNIMOD:21	0.22	36.0	10	6	3
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|O75208-2|COQ9_HUMAN	Isoform 2 of Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Homo sapiens OX=9606 GN=COQ9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	82-UNIMOD:510,93-UNIMOD:21	0.16	36.0	1	1	1
PRT	sp|Q9Y2Z0-2|SGT1_HUMAN	Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	280-UNIMOD:510,285-UNIMOD:21,293-UNIMOD:510,94-UNIMOD:510,95-UNIMOD:21,107-UNIMOD:510	0.09	35.0	2	2	2
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	167-UNIMOD:510,167-UNIMOD:21,168-UNIMOD:510,182-UNIMOD:510,305-UNIMOD:510,307-UNIMOD:21,318-UNIMOD:510	0.11	35.0	3	3	2
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	223-UNIMOD:510,237-UNIMOD:4,140-UNIMOD:510,149-UNIMOD:21,157-UNIMOD:510,158-UNIMOD:510	0.18	34.0	4	3	2
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	528-UNIMOD:510,538-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	29-UNIMOD:510,36-UNIMOD:21,42-UNIMOD:510,39-UNIMOD:21,343-UNIMOD:510,346-UNIMOD:21,364-UNIMOD:21,344-UNIMOD:21	0.10	34.0	5	2	0
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	385-UNIMOD:510,391-UNIMOD:21,402-UNIMOD:510	0.03	34.0	1	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	null	431-UNIMOD:510,432-UNIMOD:21	0.05	34.0	1	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	null	180-UNIMOD:510,184-UNIMOD:21	0.05	34.0	1	1	0
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	14-UNIMOD:510,32-UNIMOD:21,35-UNIMOD:510,446-UNIMOD:510,446-UNIMOD:4,456-UNIMOD:21,18-UNIMOD:510	0.05	33.0	3	3	3
PRT	sp|P20618|PSB1_HUMAN	Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	147-UNIMOD:510,150-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	4-UNIMOD:510,15-UNIMOD:21	0.01	33.0	1	1	0
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	105-UNIMOD:510,112-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|O00488|ZN593_HUMAN	Zinc finger protein 593 OS=Homo sapiens OX=9606 GN=ZNF593 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	91-UNIMOD:510,93-UNIMOD:21	0.11	33.0	1	1	1
PRT	sp|Q96FV9|THOC1_HUMAN	THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	640-UNIMOD:510	0.03	33.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	203-UNIMOD:510,221-UNIMOD:510,33-UNIMOD:510,44-UNIMOD:21,270-UNIMOD:510,270-UNIMOD:21,281-UNIMOD:510,280-UNIMOD:21,272-UNIMOD:21,93-UNIMOD:510,103-UNIMOD:510,263-UNIMOD:510	0.16	32.0	7	5	4
PRT	sp|Q9C0C2-2|TB182_HUMAN	Isoform 2 of 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	550-UNIMOD:510,554-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	656-UNIMOD:510,658-UNIMOD:21,669-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	226-UNIMOD:510,244-UNIMOD:510,143-UNIMOD:510,152-UNIMOD:21,153-UNIMOD:510,245-UNIMOD:510	0.17	32.0	3	3	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	129-UNIMOD:510,133-UNIMOD:21,144-UNIMOD:510,135-UNIMOD:21	0.07	32.0	4	1	0
PRT	sp|Q9UK59|DBR1_HUMAN	Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	null	529-UNIMOD:510,533-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|O94906-2|PRP6_HUMAN	Isoform 2 of Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	97-UNIMOD:510,105-UNIMOD:21,110-UNIMOD:510	0.02	31.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	43-UNIMOD:510,57-UNIMOD:510,175-UNIMOD:510,181-UNIMOD:21,185-UNIMOD:510,248-UNIMOD:510	0.14	31.0	3	3	3
PRT	sp|Q9H1E3-2|NUCKS_HUMAN	Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	89-UNIMOD:510,98-UNIMOD:35,106-UNIMOD:21,110-UNIMOD:510	0.11	31.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510	0.02	31.0	1	1	1
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	325-UNIMOD:510,336-UNIMOD:510,330-UNIMOD:35,47-UNIMOD:510,50-UNIMOD:21,58-UNIMOD:510	0.06	31.0	3	2	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	31.0	2	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	310-UNIMOD:510,314-UNIMOD:21,320-UNIMOD:21,235-UNIMOD:510,241-UNIMOD:21,247-UNIMOD:4,321-UNIMOD:21	0.09	31.0	3	2	1
PRT	sp|P46063|RECQ1_HUMAN	ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	48-UNIMOD:510,49-UNIMOD:4,61-UNIMOD:21,70-UNIMOD:510	0.04	31.0	1	1	1
PRT	sp|Q9UKK9|NUDT5_HUMAN	ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	15-UNIMOD:510,16-UNIMOD:21,27-UNIMOD:510	0.06	31.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	31.0	1	1	1
PRT	sp|Q9H2U1-3|DHX36_HUMAN	Isoform 3 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	161-UNIMOD:510,169-UNIMOD:21,183-UNIMOD:510	0.02	31.0	1	1	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	null	47-UNIMOD:510,52-UNIMOD:21,58-UNIMOD:510	0.04	31.0	1	1	0
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	444-UNIMOD:510,448-UNIMOD:21,458-UNIMOD:21,463-UNIMOD:510	0.03	31.0	2	1	0
PRT	sp|P55010|IF5_HUMAN	Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	384-UNIMOD:510,406-UNIMOD:21,407-UNIMOD:510,405-UNIMOD:21	0.06	30.0	2	1	0
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	174-UNIMOD:510,178-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510,140-UNIMOD:21,82-UNIMOD:510,92-UNIMOD:510,54-UNIMOD:510,68-UNIMOD:21,73-UNIMOD:510	0.28	30.0	4	3	2
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	108-UNIMOD:510,125-UNIMOD:21,33-UNIMOD:510,39-UNIMOD:21,87-UNIMOD:510	0.12	30.0	3	3	3
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	86-UNIMOD:510,87-UNIMOD:21,89-UNIMOD:21	0.02	30.0	2	1	0
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	193-UNIMOD:510	0.12	29.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	29.0	2	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	472-UNIMOD:510,481-UNIMOD:21,493-UNIMOD:510	0.04	29.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	29.0	null	142-UNIMOD:510,142-UNIMOD:21,153-UNIMOD:4,157-UNIMOD:510,11-UNIMOD:510,14-UNIMOD:21,91-UNIMOD:510,92-UNIMOD:21,100-UNIMOD:510	0.16	29.0	5	3	2
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	95-UNIMOD:510,95-UNIMOD:21,106-UNIMOD:510,96-UNIMOD:21	0.09	29.0	4	1	0
PRT	sp|O60664|PLIN3_HUMAN	Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	85-UNIMOD:510,95-UNIMOD:21	0.03	29.0	1	1	0
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	153-UNIMOD:510,156-UNIMOD:21,167-UNIMOD:510	0.08	28.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	77-UNIMOD:510	0.05	28.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	74-UNIMOD:510	0.11	28.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	1781-UNIMOD:510,1790-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	158-UNIMOD:510,166-UNIMOD:4,178-UNIMOD:21	0.07	28.0	1	1	1
PRT	sp|O60664-4|PLIN3_HUMAN	Isoform 4 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	85-UNIMOD:510,91-UNIMOD:21,95-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q9Y262-2|EIF3L_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	39-UNIMOD:510,40-UNIMOD:21,53-UNIMOD:510	0.03	28.0	1	1	1
PRT	sp|Q14693|LPIN1_HUMAN	Phosphatidate phosphatase LPIN1 OS=Homo sapiens OX=9606 GN=LPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	434-UNIMOD:510,438-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q13158|FADD_HUMAN	FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	190-UNIMOD:510,193-UNIMOD:35,194-UNIMOD:21,196-UNIMOD:35,197-UNIMOD:21	0.10	28.0	2	1	0
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	232-UNIMOD:510,236-UNIMOD:21,242-UNIMOD:21,245-UNIMOD:510	0.06	28.0	1	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	20-UNIMOD:510,30-UNIMOD:21,333-UNIMOD:510,336-UNIMOD:21	0.04	27.0	2	2	2
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	228-UNIMOD:510	0.08	27.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	82-UNIMOD:510,89-UNIMOD:21,14-UNIMOD:510	0.15	27.0	2	2	2
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	27.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	97-UNIMOD:510,237-UNIMOD:510,237-UNIMOD:4,243-UNIMOD:21,249-UNIMOD:510	0.07	27.0	2	2	2
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	333-UNIMOD:510,345-UNIMOD:4,346-UNIMOD:510,526-UNIMOD:510,529-UNIMOD:21,537-UNIMOD:510	0.03	27.0	2	2	2
PRT	sp|Q9UET6-2|TRM7_HUMAN	Isoform 2 of Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	247-UNIMOD:510,258-UNIMOD:21,259-UNIMOD:510	0.04	27.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	27.0	1	1	1
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	200-UNIMOD:510,213-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	38-UNIMOD:510,54-UNIMOD:21,22-UNIMOD:510,25-UNIMOD:21	0.11	27.0	2	2	2
PRT	sp|P08581|MET_HUMAN	Hepatocyte growth factor receptor OS=Homo sapiens OX=9606 GN=MET PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	1361-UNIMOD:510,1361-UNIMOD:4,1365-UNIMOD:21,1389-UNIMOD:21,1381-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	null	116-UNIMOD:510,118-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	null	424-UNIMOD:510,443-UNIMOD:21,447-UNIMOD:510	0.05	27.0	1	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	26.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	39-UNIMOD:510,43-UNIMOD:21	0.09	26.0	1	1	0
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	256-UNIMOD:510,263-UNIMOD:21,174-UNIMOD:510,185-UNIMOD:21,189-UNIMOD:510,103-UNIMOD:510,106-UNIMOD:21	0.14	26.0	4	3	2
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	126-UNIMOD:510,128-UNIMOD:21,36-UNIMOD:510,45-UNIMOD:21,52-UNIMOD:510	0.09	26.0	2	2	2
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	120-UNIMOD:510,145-UNIMOD:510	0.11	26.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	158-UNIMOD:510,189-UNIMOD:510,104-UNIMOD:510,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:510	0.25	26.0	3	2	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	140-UNIMOD:510,144-UNIMOD:21,152-UNIMOD:510	0.09	26.0	1	1	1
PRT	sp|Q96KG9-3|SCYL1_HUMAN	Isoform 3 of N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	620-UNIMOD:510,624-UNIMOD:21,634-UNIMOD:510	0.02	26.0	1	1	0
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	72-UNIMOD:510,91-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	995-UNIMOD:510,999-UNIMOD:21,1013-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	496-UNIMOD:510,498-UNIMOD:21,500-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P18615-3|NELFE_HUMAN	Isoform 2 of Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	120-UNIMOD:510,122-UNIMOD:21,138-UNIMOD:510,140-UNIMOD:21	0.07	26.0	2	2	2
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	1875-UNIMOD:510,1893-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q15369|ELOC_HUMAN	Elongin-C OS=Homo sapiens OX=9606 GN=ELOC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	7-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:4,20-UNIMOD:510,7-UNIMOD:21	0.13	26.0	2	1	0
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	42-UNIMOD:510,50-UNIMOD:21,53-UNIMOD:510	0.03	26.0	1	1	0
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	241-UNIMOD:510,243-UNIMOD:21,246-UNIMOD:4,253-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	967-UNIMOD:510,968-UNIMOD:21,972-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	70-UNIMOD:510,76-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|O15013|ARHGA_HUMAN	Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	1301-UNIMOD:510,1307-UNIMOD:21,1311-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	26.0	1	1	0
PRT	sp|Q96KG9|SCYL1_HUMAN	N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	721-UNIMOD:510,723-UNIMOD:21,735-UNIMOD:510	0.02	26.0	1	1	0
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	285-UNIMOD:510,285-UNIMOD:21,295-UNIMOD:21,298-UNIMOD:510,289-UNIMOD:21	0.05	26.0	2	1	0
PRT	sp|P62191-2|PRS4_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	106-UNIMOD:510,110-UNIMOD:21,125-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	223-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|P18084|ITB5_HUMAN	Integrin beta-5 OS=Homo sapiens OX=9606 GN=ITGB5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	498-UNIMOD:510,498-UNIMOD:4,500-UNIMOD:4,509-UNIMOD:21,513-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q9BQA1-2|MEP50_HUMAN	Isoform 2 of Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	116-UNIMOD:510,122-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	217-UNIMOD:510,223-UNIMOD:4,233-UNIMOD:21,238-UNIMOD:510	0.10	25.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	130-UNIMOD:510,142-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	398-UNIMOD:510,409-UNIMOD:21,411-UNIMOD:35,410-UNIMOD:21	0.04	25.0	3	1	0
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	301-UNIMOD:510,312-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	871-UNIMOD:510,872-UNIMOD:4,876-UNIMOD:21,882-UNIMOD:510,2130-UNIMOD:510,2130-UNIMOD:4,2132-UNIMOD:21,2135-UNIMOD:35	0.01	25.0	3	2	1
PRT	sp|Q86WR7-2|PRSR2_HUMAN	Isoform 2 of Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	41-UNIMOD:510,43-UNIMOD:21,52-UNIMOD:510,43-UNIMOD:510,45-UNIMOD:21	0.04	25.0	2	2	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	68-UNIMOD:510,78-UNIMOD:4,79-UNIMOD:21	0.09	25.0	1	1	1
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	0.07	25.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	99-UNIMOD:510,102-UNIMOD:21,118-UNIMOD:510,99-UNIMOD:21,205-UNIMOD:510,209-UNIMOD:21,218-UNIMOD:35	0.16	25.0	3	2	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	110-UNIMOD:510,116-UNIMOD:21,120-UNIMOD:510,111-UNIMOD:510	0.06	25.0	3	2	1
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	450-UNIMOD:510,456-UNIMOD:21,467-UNIMOD:510	0.02	25.0	1	1	0
PRT	sp|P21980|TGM2_HUMAN	Protein-glutamine gamma-glutamyltransferase 2 OS=Homo sapiens OX=9606 GN=TGM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	365-UNIMOD:510,368-UNIMOD:21,370-UNIMOD:4,371-UNIMOD:4	0.02	25.0	1	1	0
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	327-UNIMOD:510,333-UNIMOD:21,332-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|P30043|BLVRB_HUMAN	Flavin reductase (NADPH) OS=Homo sapiens OX=9606 GN=BLVRB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	188-UNIMOD:510,188-UNIMOD:4,202-UNIMOD:21,205-UNIMOD:21	0.10	24.0	2	1	0
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	644-UNIMOD:510,645-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	244-UNIMOD:510,246-UNIMOD:21,255-UNIMOD:4,256-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	58-UNIMOD:510,65-UNIMOD:21	0.09	24.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	129-UNIMOD:510,133-UNIMOD:21	0.04	24.0	3	1	0
PRT	sp|Q15427|SF3B4_HUMAN	Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	10-UNIMOD:510,16-UNIMOD:21,23-UNIMOD:510	0.04	24.0	1	1	1
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	70-UNIMOD:510,75-UNIMOD:21,71-UNIMOD:510	0.11	24.0	2	2	2
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	607-UNIMOD:510,609-UNIMOD:21,622-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|P23434|GCSH_HUMAN	Glycine cleavage system H protein, mitochondrial OS=Homo sapiens OX=9606 GN=GCSH PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	137-UNIMOD:510,138-UNIMOD:4,139-UNIMOD:21,146-UNIMOD:510	0.06	24.0	1	1	1
PRT	sp|P21980-2|TGM2_HUMAN	Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2 OS=Homo sapiens OX=9606 GN=TGM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	365-UNIMOD:510,369-UNIMOD:21,370-UNIMOD:4,371-UNIMOD:4	0.03	24.0	1	1	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	70-UNIMOD:510,75-UNIMOD:21,156-UNIMOD:510,160-UNIMOD:4,161-UNIMOD:4	0.07	24.0	2	2	2
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	256-UNIMOD:510,260-UNIMOD:21,265-UNIMOD:510,251-UNIMOD:510,257-UNIMOD:21	0.02	24.0	2	2	2
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	105-UNIMOD:510,115-UNIMOD:21,116-UNIMOD:21	0.04	24.0	2	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	326-UNIMOD:510,336-UNIMOD:21,327-UNIMOD:35	0.07	24.0	2	1	0
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	21-UNIMOD:510,30-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	20-UNIMOD:510,22-UNIMOD:21,30-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	576-UNIMOD:510,578-UNIMOD:21,580-UNIMOD:21,576-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|Q01826|SATB1_HUMAN	DNA-binding protein SATB1 OS=Homo sapiens OX=9606 GN=SATB1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	16-UNIMOD:35,17-UNIMOD:21,21-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q16513-5|PKN2_HUMAN	Isoform 5 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	255-UNIMOD:510,257-UNIMOD:21,613-UNIMOD:510,632-UNIMOD:21	0.06	23.0	2	2	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	156-UNIMOD:510,168-UNIMOD:21,373-UNIMOD:510,381-UNIMOD:21	0.07	23.0	2	2	2
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	519-UNIMOD:510,521-UNIMOD:21,532-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	25-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	239-UNIMOD:510,244-UNIMOD:21,249-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:510,7-UNIMOD:21	0.21	23.0	2	1	0
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	110-UNIMOD:510,113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4,128-UNIMOD:510	0.07	23.0	1	1	1
PRT	sp|P30085|KCY_HUMAN	UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	44-UNIMOD:510,49-UNIMOD:21,55-UNIMOD:510	0.07	23.0	1	1	1
PRT	sp|P05997|CO5A2_HUMAN	Collagen alpha-2(V) chain OS=Homo sapiens OX=9606 GN=COL5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1307-UNIMOD:510,1308-UNIMOD:21,1325-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	238-UNIMOD:510,242-UNIMOD:21	0.07	23.0	1	1	0
PRT	sp|Q9Y3D8-2|KAD6_HUMAN	Isoform 2 of Adenylate kinase isoenzyme 6 OS=Homo sapiens OX=9606 GN=AK6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	28-UNIMOD:510,28-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q14444-2|CAPR1_HUMAN	Isoform 2 of Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	99-UNIMOD:510,99-UNIMOD:21,110-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	null	167-UNIMOD:510,167-UNIMOD:21,168-UNIMOD:510,182-UNIMOD:510	0.05	23.0	1	1	0
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	273-UNIMOD:510,279-UNIMOD:21,281-UNIMOD:4	0.02	23.0	2	1	0
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	null	236-UNIMOD:510,239-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	null	271-UNIMOD:510,278-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	41-UNIMOD:510,41-UNIMOD:21,52-UNIMOD:510	0.03	23.0	1	1	0
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	42-UNIMOD:510,42-UNIMOD:4,45-UNIMOD:21,67-UNIMOD:510,43-UNIMOD:21	0.05	22.0	2	1	0
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	128-UNIMOD:510,128-UNIMOD:4	0.07	22.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	44-UNIMOD:510,48-UNIMOD:21,54-UNIMOD:21,8-UNIMOD:510	0.17	22.0	2	2	2
PRT	sp|Q96K76-2|UBP47_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	916-UNIMOD:510,931-UNIMOD:21,936-UNIMOD:510	0.02	22.0	1	1	0
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	91-UNIMOD:510,94-UNIMOD:4,129-UNIMOD:510,130-UNIMOD:4,136-UNIMOD:21	0.15	22.0	2	2	2
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	46-UNIMOD:510,48-UNIMOD:21,54-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	328-UNIMOD:510,330-UNIMOD:21,340-UNIMOD:510	0.03	22.0	2	1	0
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	269-UNIMOD:510,295-UNIMOD:21,298-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	206-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	323-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	250-UNIMOD:510,256-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	435-UNIMOD:510,446-UNIMOD:21,448-UNIMOD:35	0.04	22.0	1	1	0
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	22.0	null	258-UNIMOD:510,260-UNIMOD:35,269-UNIMOD:21,272-UNIMOD:35,267-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	663-UNIMOD:510,669-UNIMOD:4,672-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	582-UNIMOD:510,597-UNIMOD:21,600-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	186-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|O75131|CPNE3_HUMAN	Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	238-UNIMOD:510,243-UNIMOD:21,249-UNIMOD:4,253-UNIMOD:510,240-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	42-UNIMOD:510,49-UNIMOD:21,53-UNIMOD:510	0.02	22.0	1	1	0
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	64-UNIMOD:510,69-UNIMOD:21,72-UNIMOD:21,129-UNIMOD:510,133-UNIMOD:21	0.24	21.0	3	2	1
PRT	sp|P46379-5|BAG6_HUMAN	Isoform 5 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	957-UNIMOD:510,967-UNIMOD:21,978-UNIMOD:35	0.02	21.0	2	1	0
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	175-UNIMOD:510,180-UNIMOD:21,184-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	237-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|Q13404-6|UB2V1_HUMAN	Isoform 4 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	92-UNIMOD:510,100-UNIMOD:4,101-UNIMOD:21	0.13	21.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	209-UNIMOD:510,214-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q5T035|CI129_HUMAN	Putative uncharacterized protein C9orf129 OS=Homo sapiens OX=9606 GN=C9orf129 PE=4 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	60-UNIMOD:510,67-UNIMOD:21,75-UNIMOD:510	0.09	21.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	78-UNIMOD:510,86-UNIMOD:21,88-UNIMOD:35,96-UNIMOD:510,6-UNIMOD:510,6-UNIMOD:21	0.07	21.0	3	2	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	158-UNIMOD:510,159-UNIMOD:21	0.07	21.0	1	1	0
PRT	sp|Q06124|PTN11_HUMAN	Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	579-UNIMOD:510,580-UNIMOD:21,590-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	114-UNIMOD:510	0.13	21.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	47-UNIMOD:510,61-UNIMOD:510,64-UNIMOD:21	0.04	21.0	3	2	1
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	207-UNIMOD:510,210-UNIMOD:510,216-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	158-UNIMOD:510,160-UNIMOD:21	0.02	21.0	1	1	0
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	161-UNIMOD:510,163-UNIMOD:21,164-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q96K76|UBP47_HUMAN	Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	1004-UNIMOD:510,1022-UNIMOD:21,1024-UNIMOD:510	0.02	21.0	1	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	44-UNIMOD:510,56-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|Q9NPI6-2|DCP1A_HUMAN	Isoform 2 of mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	483-UNIMOD:510,487-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	416-UNIMOD:510,418-UNIMOD:21,420-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	85-UNIMOD:510,91-UNIMOD:4,97-UNIMOD:510,217-UNIMOD:510,221-UNIMOD:21	0.10	20.0	2	2	2
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	128-UNIMOD:510,133-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	263-UNIMOD:510,266-UNIMOD:21,267-UNIMOD:4,99-UNIMOD:510	0.07	20.0	2	2	2
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	44-UNIMOD:510,52-UNIMOD:510	0.07	20.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	125-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	122-UNIMOD:510,127-UNIMOD:21,129-UNIMOD:510	0.07	20.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	117-UNIMOD:510,121-UNIMOD:21,125-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|Q00653|NFKB2_HUMAN	Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	242-UNIMOD:510,247-UNIMOD:21,250-UNIMOD:4,252-UNIMOD:510,690-UNIMOD:510,703-UNIMOD:4,710-UNIMOD:21,722-UNIMOD:510	0.05	20.0	2	2	2
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	540-UNIMOD:510,547-UNIMOD:21,551-UNIMOD:4,556-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	578-UNIMOD:510,580-UNIMOD:21,589-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	16-UNIMOD:510,35-UNIMOD:21,47-UNIMOD:4,48-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|P46778|RL21_HUMAN	60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	22-UNIMOD:510,29-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	105-UNIMOD:510,115-UNIMOD:21,62-UNIMOD:510,67-UNIMOD:21,483-UNIMOD:510,485-UNIMOD:21,494-UNIMOD:510,496-UNIMOD:510	0.09	20.0	3	3	3
PRT	sp|Q07666-3|KHDR1_HUMAN	Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	139-UNIMOD:510,145-UNIMOD:21,152-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	81-UNIMOD:510,87-UNIMOD:21,89-UNIMOD:21,101-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	80-UNIMOD:510,82-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	127-UNIMOD:510,129-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	20.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	169-UNIMOD:510,171-UNIMOD:21,177-UNIMOD:510,76-UNIMOD:510	0.02	20.0	2	2	2
PRT	sp|O60220|TIM8A_HUMAN	Mitochondrial import inner membrane translocase subunit Tim8 A OS=Homo sapiens OX=9606 GN=TIMM8A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	87-UNIMOD:510,88-UNIMOD:510,94-UNIMOD:21	0.12	20.0	1	1	1
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	348-UNIMOD:510,351-UNIMOD:4,352-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P62910|RL32_HUMAN	60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	94-UNIMOD:510,96-UNIMOD:4,106-UNIMOD:510	0.10	20.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	5-UNIMOD:510,9-UNIMOD:21,8-UNIMOD:510,11-UNIMOD:21	0.06	20.0	2	2	2
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	95-UNIMOD:510,95-UNIMOD:21,99-UNIMOD:21,105-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q16513|PKN2_HUMAN	Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	581-UNIMOD:510,582-UNIMOD:21	0.02	20.0	1	1	0
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	492-UNIMOD:510,506-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q9H814|PHAX_HUMAN	Phosphorylated adapter RNA export protein OS=Homo sapiens OX=9606 GN=PHAX PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	43-UNIMOD:510,51-UNIMOD:4,57-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	96-UNIMOD:510	0.09	19.0	1	1	1
PRT	sp|Q8NBF2|NHLC2_HUMAN	NHL repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=NHLRC2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	35-UNIMOD:510,39-UNIMOD:21,44-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	49-UNIMOD:510,55-UNIMOD:21,58-UNIMOD:510,54-UNIMOD:21	0.07	19.0	2	1	0
PRT	sp|Q13601-2|KRR1_HUMAN	Isoform 2 of KRR1 small subunit processome component homolog OS=Homo sapiens OX=9606 GN=KRR1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	224-UNIMOD:510,230-UNIMOD:21,233-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|A0MZ66-2|SHOT1_HUMAN	Isoform 2 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	18-UNIMOD:510,24-UNIMOD:21,33-UNIMOD:510	0.04	19.0	1	1	1
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	28-UNIMOD:510,30-UNIMOD:21,32-UNIMOD:21	0.14	19.0	1	1	1
PRT	sp|P51965-2|UB2E1_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens OX=9606 GN=UBE2E1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	40-UNIMOD:510,44-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|P26373-2|RL13_HUMAN	Isoform 2 of 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	75-UNIMOD:510,77-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	1855-UNIMOD:510,1859-UNIMOD:21,1869-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	14-UNIMOD:510	0.06	19.0	1	1	1
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	648-UNIMOD:510,657-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	534-UNIMOD:510,535-UNIMOD:21,541-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	66-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510	0.09	19.0	1	1	1
PRT	sp|Q96AT1|K1143_HUMAN	Uncharacterized protein KIAA1143 OS=Homo sapiens OX=9606 GN=KIAA1143 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	141-UNIMOD:510,146-UNIMOD:21	0.10	19.0	1	1	1
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	455-UNIMOD:510,459-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q99614|TTC1_HUMAN	Tetratricopeptide repeat protein 1 OS=Homo sapiens OX=9606 GN=TTC1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	273-UNIMOD:510	0.07	19.0	1	1	1
PRT	sp|P28074-3|PSB5_HUMAN	Isoform 3 of Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	63-UNIMOD:510	0.09	19.0	1	1	1
PRT	sp|Q9Y4E1-5|WAC2C_HUMAN	Isoform 5 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	951-UNIMOD:510,957-UNIMOD:21,963-UNIMOD:35	0.01	19.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	87-UNIMOD:510,95-UNIMOD:35,96-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	468-UNIMOD:510,470-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	114-UNIMOD:510,119-UNIMOD:21,127-UNIMOD:510	0.07	19.0	1	1	1
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	202-UNIMOD:510,207-UNIMOD:21,211-UNIMOD:510,313-UNIMOD:510,314-UNIMOD:510,315-UNIMOD:21	0.08	19.0	2	2	1
PRT	sp|P43490|NAMPT_HUMAN	Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	470-UNIMOD:510,472-UNIMOD:21,478-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|Q6Y7W6|GGYF2_HUMAN	GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	359-UNIMOD:510,382-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P31153|METK2_HUMAN	S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	235-UNIMOD:510,242-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P61353|RL27_HUMAN	60S ribosomal protein L27 OS=Homo sapiens OX=9606 GN=RPL27 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	85-UNIMOD:510,85-UNIMOD:21,93-UNIMOD:510,86-UNIMOD:21	0.07	19.0	2	1	0
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	85-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	47-UNIMOD:510,50-UNIMOD:21,58-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	19.0	null	48-UNIMOD:510,52-UNIMOD:21,62-UNIMOD:510,51-UNIMOD:21	0.09	19.0	2	1	0
PRT	sp|P57058|HUNK_HUMAN	Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens OX=9606 GN=HUNK PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	588-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9Y639-3|NPTN_HUMAN	Isoform 3 of Neuroplastin OS=Homo sapiens OX=9606 GN=NPTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	94-UNIMOD:510,100-UNIMOD:21,102-UNIMOD:4,104-UNIMOD:21,111-UNIMOD:510	0.07	18.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	162-UNIMOD:510,168-UNIMOD:21,127-UNIMOD:510,138-UNIMOD:510	0.05	18.0	2	2	2
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	335-UNIMOD:510,337-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	450-UNIMOD:510,454-UNIMOD:21,457-UNIMOD:4,455-UNIMOD:21	0.02	18.0	2	1	0
PRT	sp|P55786-2|PSA_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	753-UNIMOD:510	0.01	18.0	1	1	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	58-UNIMOD:510,59-UNIMOD:21,62-UNIMOD:4,200-UNIMOD:510,206-UNIMOD:4	0.10	18.0	2	2	2
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	189-UNIMOD:510,194-UNIMOD:21,196-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	211-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	480-UNIMOD:510,488-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	50-UNIMOD:510,61-UNIMOD:4,64-UNIMOD:510	0.12	18.0	1	1	1
PRT	sp|Q92574-2|TSC1_HUMAN	Isoform 2 of Hamartin OS=Homo sapiens OX=9606 GN=TSC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	450-UNIMOD:510,454-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q96MU7-2|YTDC1_HUMAN	Isoform 2 of YTH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=YTHDC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	306-UNIMOD:510,308-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q13228-3|SBP1_HUMAN	Isoform 3 of Methanethiol oxidase OS=Homo sapiens OX=9606 GN=SELENBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	21-UNIMOD:510,28-UNIMOD:21,31-UNIMOD:4,33-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P13674-3|P4HA1_HUMAN	Isoform 3 of Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	277-UNIMOD:510,282-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	44-UNIMOD:510	0.12	18.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1153-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|Q641Q2-2|WAC2A_HUMAN	Isoform 2 of WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1027-UNIMOD:510,1032-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	243-UNIMOD:510,246-UNIMOD:4,257-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|P31327-3|CPSM_HUMAN	Isoform 3 of Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	204-UNIMOD:510,213-UNIMOD:510	0.01	18.0	1	1	1
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	165-UNIMOD:510,175-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|P42224-2|STAT1_HUMAN	Isoform Beta of Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	162-UNIMOD:510,170-UNIMOD:21,173-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	18.0	null	225-UNIMOD:510,226-UNIMOD:21,242-UNIMOD:510,227-UNIMOD:21,225-UNIMOD:21	0.05	18.0	3	1	0
PRT	sp|P98082-2|DAB2_HUMAN	Isoform 2 of Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	35-UNIMOD:510,38-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|A6NKF1|SAC31_HUMAN	SAC3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SAC3D1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	383-UNIMOD:510,402-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|Q96P70|IPO9_HUMAN	Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	883-UNIMOD:510,884-UNIMOD:510,889-UNIMOD:21,891-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	264-UNIMOD:510,267-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	292-UNIMOD:510,294-UNIMOD:21,306-UNIMOD:21	0.06	18.0	1	1	0
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	356-UNIMOD:510,369-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	75-UNIMOD:510,84-UNIMOD:21,91-UNIMOD:510	0.10	18.0	1	1	1
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	69-UNIMOD:510,74-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4	0.20	18.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	null	202-UNIMOD:510,208-UNIMOD:21,211-UNIMOD:510	0.03	18.0	1	1	0
PRT	sp|O00469-3|PLOD2_HUMAN	Isoform 3 of Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	256-UNIMOD:510,257-UNIMOD:4,267-UNIMOD:21,269-UNIMOD:510	0.04	17.0	1	1	1
PRT	sp|Q00534|CDK6_HUMAN	Cyclin-dependent kinase 6 OS=Homo sapiens OX=9606 GN=CDK6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	9-UNIMOD:510,13-UNIMOD:21,15-UNIMOD:4,26-UNIMOD:510	0.06	17.0	1	1	1
PRT	sp|Q6PCE3|PGM2L_HUMAN	Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	166-UNIMOD:510,171-UNIMOD:35,175-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	187-UNIMOD:510,202-UNIMOD:21,186-UNIMOD:510,188-UNIMOD:21	0.03	17.0	2	2	2
PRT	sp|Q16719-2|KYNU_HUMAN	Isoform 2 of Kynureninase OS=Homo sapiens OX=9606 GN=KYNU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	44-UNIMOD:510,45-UNIMOD:4,50-UNIMOD:510	0.03	17.0	1	1	1
PRT	sp|P29353-5|SHC1_HUMAN	Isoform 5 of SHC-transforming protein 1 OS=Homo sapiens OX=9606 GN=SHC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	206-UNIMOD:510,213-UNIMOD:21,221-UNIMOD:510	0.05	17.0	1	1	1
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	546-UNIMOD:510,550-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P49023-2|PAXI_HUMAN	Isoform Alpha of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	76-UNIMOD:510,91-UNIMOD:21,93-UNIMOD:510	0.03	17.0	1	1	1
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	96-UNIMOD:510,104-UNIMOD:21,117-UNIMOD:510,98-UNIMOD:21	0.04	17.0	2	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	773-UNIMOD:510,805-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q8NDI1-3|EHBP1_HUMAN	Isoform 3 of EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	549-UNIMOD:510,550-UNIMOD:21,557-UNIMOD:510	0.01	17.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	295-UNIMOD:510,305-UNIMOD:510	0.02	17.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	383-UNIMOD:510,389-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	144-UNIMOD:510,148-UNIMOD:21,149-UNIMOD:510	0.05	17.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	544-UNIMOD:510,550-UNIMOD:21,565-UNIMOD:510	0.02	17.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	320-UNIMOD:510,329-UNIMOD:510,320-UNIMOD:21	0.03	17.0	2	1	0
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	859-UNIMOD:510,859-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q6GYQ0-3|RGPA1_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	1047-UNIMOD:510,1047-UNIMOD:21,1063-UNIMOD:510	0.02	17.0	1	1	0
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	null	385-UNIMOD:510,398-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	null	29-UNIMOD:510,37-UNIMOD:510	0.05	17.0	1	1	1
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	null	295-UNIMOD:510,295-UNIMOD:21,299-UNIMOD:21,303-UNIMOD:21,311-UNIMOD:510	0.05	17.0	1	1	1
PRT	sp|P19622|HME2_HUMAN	Homeobox protein engrailed-2 OS=Homo sapiens OX=9606 GN=EN2 PE=2 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	null	36-UNIMOD:21,42-UNIMOD:21	0.08	17.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	null	797-UNIMOD:510,798-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q6GYQ0|RGPA1_HUMAN	Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	null	1000-UNIMOD:510,1002-UNIMOD:21,1016-UNIMOD:510	0.01	17.0	1	1	0
PRT	sp|Q86U06|RBM23_HUMAN	Probable RNA-binding protein 23 OS=Homo sapiens OX=9606 GN=RBM23 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	17.0	null	109-UNIMOD:510	0.03	17.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510	ms_run[2]:scan=4492	49.905	2	2442.0519	2442.0519	R	-	223	246
PSM	DNLTLWTSDTQGDEAEAGEGGEN	2	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510	ms_run[2]:scan=4486	49.859	3	2442.0519	2442.0519	R	-	223	246
PSM	SFSEDAVTDSSGSGTLPR	3	sp|Q27J81-2|INF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3042	36.033	2	1925.8468	1925.8468	K	A	1192	1210
PSM	ATTPADGEEPAPEAEALAAAR	4	sp|Q96S44|PRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3518	40.096	2	2150.9945	2150.9945	R	E	6	27
PSM	INSSGESGDESDEFLQSR	5	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3021	35.823	2	2069.8639	2069.8639	R	K	180	198
PSM	DYEEVGVDSVEGEGEEEGEEY	6	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,2-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=4479	49.777	2	2541.8933	2541.8933	K	-	396	417
PSM	DNLTLWTSDQQDDDGGEGNN	7	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:510	ms_run[1]:scan=4545	50.48657333333333	2	2228.9352	2226.9352	R	-	228	248
PSM	AEDGSVIDYELIDQDAR	8	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4245	47.333	2	2021.9043	2021.9043	R	D	198	215
PSM	DNLTLWTSENQGDEGDAGEGEN	9	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510	ms_run[2]:scan=4321	48.224	2	2384.01	2384.0100	R	-	223	245
PSM	DNLTLWTSDQQDDDGGEGNN	10	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:510	ms_run[1]:scan=4447	49.46791833333334	2	2226.9433	2226.9356	R	-	228	248
PSM	VDATEESDLAQQYGVR	11	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2740	33.624	2	1893.857	1893.8570	K	G	82	98
PSM	SAGAPASVSGQDADGSTSPR	12	sp|P42679|MATK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=1152	21.21036833333333	2	1930.8559	1930.8477	R	S	484	504
PSM	DNLTLWTSDMQGDGEEQNK	13	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3606	41.124	2	2264.0539	2264.0539	R	E	204	223
PSM	DNLTLWTSDMQGDGEEQNK	14	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4236	47.257	2	2248.059	2248.0590	R	E	204	223
PSM	DNLTLWTSENQGDEGDAGEGEN	15	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=4466	49.661	2	2384.01	2384.0100	R	-	223	245
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	16	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2343	30.595	2	2302.9275	2302.9275	R	S	314	339
PSM	SGQVYSFGCNDEGALGR	17	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2929	35.125	2	1929.8141	1929.8141	K	D	85	102
PSM	STAGDTHLGGEDFDNR	18	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=1617	24.788	2	1724.7814	1724.7814	K	M	221	237
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	19	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=4337	48.349	3	3490.5054	3490.5054	R	-	207	238
PSM	DWEDDSDEDMSNFDR	20	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2903	34.928	2	1924.7117	1924.7117	K	F	75	90
PSM	DYEEVGADSADGEDEGEEY	21	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3335	38.477	2	2191.7691	2191.7691	K	-	431	450
PSM	DYEEVGVDSVEGEGEEEGEEY	22	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4453	49.53	2	2461.927	2461.9270	K	-	396	417
PSM	VNDGVCDCCDGTDEYNSGVICENTCK	23	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,6-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:21,21-UNIMOD:4,25-UNIMOD:4,26-UNIMOD:510	ms_run[2]:scan=2634	32.818	3	3188.2175	3188.2175	R	E	92	118
PSM	DNLTLWTSDTQGDEAEAGEGGEN	24	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:510	ms_run[1]:scan=4580	50.87338833333333	3	2442.0622	2442.0512	R	-	223	246
PSM	DWEDDSDEDMSNFDR	25	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=3787	42.772	2	1908.7168	1908.7168	K	F	75	90
PSM	DYEEVGVDSVEGEGEEEGEEY	26	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4358	48.524	2	2461.927	2461.9270	K	-	396	417
PSM	NPDDITQEEYGEFYK	27	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3562	40.6	2	2074.8486	2074.8486	R	S	292	307
PSM	DNLTLWTSDQQDDDGGEGNN	28	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=4866	54.264	2	2226.9361	2226.9361	R	-	228	248
PSM	DYEEVGVDSVEGEGEEEGEEY	29	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=4221	47.093	2	2381.9607	2381.9607	K	-	396	417
PSM	NPDDITNEEYGEFYK	30	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3470	39.637	2	1980.8667	1980.8667	R	S	300	315
PSM	SSSPAPADIAQTVQEDLR	31	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4730	52.529	2	1997.9519	1997.9519	K	T	230	248
PSM	SYELPDGQVITIGNER	32	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4206	46.962	2	1903.9141	1903.9141	K	F	239	255
PSM	SYELPDGQVITIGNER	33	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=4395	48.86	2	1823.9478	1823.9478	K	F	239	255
PSM	TPEELDDSDFETEDFDVR	34	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4523	50.196	2	2271.9157	2271.9157	R	S	264	282
PSM	YTDQGGEEEEDYESEEQLQHR	35	sp|O75208-2|COQ9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=1941	27.52	3	2684.0612	2684.0612	R	I	82	103
PSM	DNLTLWTSDQQDDDGGEGNN	36	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:510	ms_run[1]:scan=4630	51.4908	2	2226.943819	2226.936145	R	-	228	248
PSM	SAGAPASVSGQDADGSTSPR	37	sp|P42679|MATK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=1152	21.21036833333333	2	1930.856377	1930.848196	R	S	484	504
PSM	LFQQIYSDGSDEVK	38	sp|Q9Y2Z0-2|SGT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2961	35.367	2	1775.8655	1775.8655	R	R	280	294
PSM	YKLDEDEDEDDADLSK	39	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,1-UNIMOD:21,2-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=1913	27.313	2	2080.9462	2080.9462	K	Y	167	183
PSM	DNLTLWTSDQQDDDGGEGNN	40	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4349	48.454	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDSAGEECDAAEGAEN	41	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=4575	50.79	2	2488.0396	2488.0396	R	-	223	246
PSM	ELSDPAGAIIYTSR	42	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3825	43.163	2	1605.7864	1605.7864	K	F	528	542
PSM	GILAADESTGSIAK	43	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2747	33.678	2	1479.7858	1479.7858	K	R	29	43
PSM	QSDDEVYAPGLDIESSLK	44	sp|Q15459-2|SF3A1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,7-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4432	49.306	2	2113.014	2113.0140	K	Q	385	403
PSM	DYEEVGVDSVEGEGEEEGEEY	45	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4391	48.828606666666666	3	2461.937666	2461.927019	K	-	431	452
PSM	DNLTLWTSDQQDDDGGEGNN	46	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510	ms_run[1]:scan=4450	49.49151	3	2226.9451	2226.9356	R	-	228	248
PSM	AEDGSVIDYELIDQDAR	47	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=4245	47.33287166666667	2	2021.912117	2021.904314	R	D	180	197
PSM	DYEEVGVDSVEGEGEEEGEEY	48	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,2-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=4456	49.554	3	2541.8933	2541.8933	K	-	396	417
PSM	EAQRDYLDFLDDEEDQGIYQSK	49	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,19-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4793	53.388	3	2824.2753	2824.2753	R	V	14	36
PSM	GAVYSFDPVGSYQR	50	sp|P20618|PSB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3547	40.464	2	1658.7554	1658.7554	K	D	147	161
PSM	NGSEADIDEGLYSR	51	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2301	30.277	2	1638.6987	1638.6987	K	Q	4	18
PSM	NPDDITQEEYGEFYK	52	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3662	41.662	2	1994.8823	1994.8823	R	S	292	307
PSM	NSYVAGQYDDAASYQR	53	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2095	28.673	2	1920.8104	1920.8104	R	L	105	121
PSM	QLSVEPYSQEEAER	54	sp|O00488|ZN593_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2654	32.969	2	1777.7984	1777.7984	K	A	91	105
PSM	SAGAPASVSGQDADGSTSPRSQEP	55	sp|P42679|MATK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=1582	24.527	2	2372.0342	2372.0342	R	-	484	508
PSM	SGLSDLAESLTNDNETNS	56	sp|Q96FV9|THOC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4848	54.089	2	1899.8758	1899.8758	K	-	640	658
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	57	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4284	47.814	3	3570.4718	3570.4718	R	-	207	238
PSM	DNLTLWTSDSAGEECDAAEGAEN	58	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[1]:scan=4568	50.730655	3	2488.050089	2488.039624	R	-	223	246
PSM	DATNVGDEGGFAPNILENK	59	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4094	45.703	2	2028.0436	2028.0436	K	E	203	222
PSM	EAAFSPGQQDWSR	60	sp|Q9C0C2-2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3190	37.222	2	1591.6881	1591.6881	R	D	550	563
PSM	NDSPTQIPVSSDVCR	61	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=2543	32.108	2	1787.7973	1787.7973	R	L	656	671
PSM	DNLTLWTSDMQGDGEEQNK	62	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[1]:scan=4233	47.21859166666667	3	2248.0677	2248.0585	R	E	226	245
PSM	ASGNYATVISHNPETK	63	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=1514	24.01364	2	1835.9163	1835.9086	R	K	129	145
PSM	NQAIYAAVDDDDDDAA	64	sp|Q9UK59|DBR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3225	37.48998666666667	2	1794.712472	1794.704552	R	-	529	545
PSM	AAVPSGASTGIYEALELR	65	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4628	51.473	2	1917.9661	1917.9661	R	D	33	51
PSM	DDEEADAIYAALDK	66	sp|O94906-2|PRP6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4794	53.395	2	1685.771	1685.7710	K	R	97	111
PSM	DLADELALVDVIEDK	67	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=5762	67.634	2	1724.972	1724.9720	K	L	43	58
PSM	DSGSDEDFLMEDDDDSDYGSSK	68	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:35,18-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=3620	41.26	3	2591.9531	2591.9531	K	K	89	111
PSM	ELISNASDALDK	69	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2550	32.162	2	1342.7616	1342.7616	R	I	42	54
PSM	ETVSEESNVLCLSK	70	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3059	36.163	2	1661.8818	1661.8818	R	S	581	595
PSM	EVDEQMLNVQNK	71	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2481	31.635	2	1513.8083	1513.8083	K	N	325	337
PSM	GILAADESTGSIAK	72	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2579	32.398	2	1479.7858	1479.7858	K	R	29	43
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	73	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2007	28.011	3	2826.1852	2826.1852	R	E	418	442
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	74	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2436	31.292	3	2810.1902	2810.1902	R	E	418	442
PSM	LISWYDNEFGYSNR	75	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4856	54.17	2	1956.7909	1956.7909	K	V	310	324
PSM	NPDDITNEEYGEFYK	76	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3594	41.018	2	1980.8667	1980.8667	R	S	300	315
PSM	QCLEDSDAGASNEYDSSPAAWNK	77	sp|P46063|RECQ1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,2-UNIMOD:4,14-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=3000	35.667	3	2662.1167	2662.1167	K	E	48	71
PSM	QYIISEELISEGK	78	sp|Q9UKK9|NUDT5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,2-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4270	47.636	2	1655.8696	1655.8696	K	W	15	28
PSM	RVSVCAETYNPDEEEEDTDPR	79	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2464	31.506	3	2624.0798	2624.0798	R	V	97	118
PSM	SYIDRDSEYLLQENEPDGTLDQK	80	sp|Q9H2U1-3|DHX36_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,9-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=3952	44.398	3	2875.3437	2875.3437	R	L	161	184
PSM	ELISNSSDALDK	81	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2495	31.742034999999998	2	1438.728899	1438.722891	R	I	47	59
PSM	DFPEYTFAIADEEDYAGEVK	82	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=5331	61.01730500000001	3	2536.0752	2536.0642	K	D	444	464
PSM	SAGAPASVSGQDADGSTSPRSQEP	83	sp|P42679|MATK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=1582	24.527433333333335	2	2372.042593	2372.034159	R	-	484	508
PSM	ASGNYATVISHNPETK	84	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,7-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1514	24.014	2	1835.9091	1835.9091	R	K	129	145
PSM	DNLTLWTSDMQGDGEEQNK	85	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3596	41.034	3	2264.0539	2264.0539	R	E	204	223
PSM	EAEEESSGGEEEDEDENIEVVYSK	86	sp|P55010|IF5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,23-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2792	34.023	3	2849.1812	2849.1812	K	A	384	408
PSM	ELTVSNNDINEAGVR	87	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2879	34.713	2	1743.8253	1743.8253	K	V	174	189
PSM	EVDEQMLNVQNK	88	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1619	24.802	2	1529.8032	1529.8032	K	N	325	337
PSM	HELQANCYEEVK	89	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1342	22.696	2	1586.8035	1586.8035	K	D	133	145
PSM	TDLNPDNLQGGDDLDPNYVLSSR	90	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=4735	52.57	3	2631.1914	2631.1914	K	V	108	131
PSM	TTPSVVAFTADGER	91	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3588	40.972	2	1563.7394	1563.7394	R	L	86	100
PSM	VPTANVSVVDLTCR	92	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3572	40.757	2	1643.8166	1643.8166	R	L	235	249
PSM	DYEEVGADSADGEDEGEEY	93	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510	ms_run[1]:scan=3383	38.940266666666666	2	2111.8107	2111.8022	K	-	431	450
PSM	DNLTLWTSDQQDDDGGEGNN	94	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510	ms_run[1]:scan=4547	50.50382666666667	3	2226.9451	2226.9356	R	-	228	248
PSM	DNLTLWTADNAGEEGGEAPQEPQS	95	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=4495	49.93	3	2562.157	2562.1570	R	-	193	217
PSM	KEESEESDDDMGFGLFD	96	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4087	45.648	2	2032.8732	2032.8732	K	-	73	90
PSM	SAGAPASVSGQDADGSTSPRSQEP	97	sp|P42679|MATK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=1625	24.848	3	2372.0342	2372.0342	R	-	484	508
PSM	TSRPENAIIYNNNEDFQVGQAK	98	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=3053	36.118	3	2655.2966	2655.2966	R	V	472	494
PSM	YADLTEDQLPSCESLK	99	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=3551	40.494	2	2015.9435	2015.9435	R	D	142	158
PSM	EAAENSLVAYK	100	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=1784	26.20531833333333	2	1341.690923	1341.685383	K	A	143	154
PSM	YSQVLANGLDNK	101	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2345	30.611878333333333	2	1468.7655	1468.7594	K	L	95	107
PSM	EAEEESSGGEEEDEDENIEVVYSK	102	sp|P55010|IF5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,22-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=2792	34.022953333333334	3	2849.1932	2849.1802	K	A	384	408
PSM	LEPQIASASEYAHR	103	sp|O60664|PLIN3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=2000	27.961901666666666	2	1684.8102	1684.8029	K	G	85	99
PSM	YSQVLANGLDNK	104	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2345	30.611878333333333	2	1468.766022	1468.759945	K	L	95	107
PSM	LISWYDNEFGYSNR	105	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=4856	54.170143333333336	2	1956.798932	1956.790879	K	V	310	324
PSM	AEEYEFLTPVEEAPK	106	sp|P52565|GDIR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4039	45.144	2	1898.9227	1898.9227	R	G	153	168
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	107	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=3068	36.231	3	3112.2782	3112.2782	K	L	595	622
PSM	DLIHDQDEDEEEEEGQR	108	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=1860	26.923	3	2118.9038	2118.9038	R	F	77	94
PSM	DSGSDEDFLMEDDDDSDYGSSK	109	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,18-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4192	46.805	3	2575.9582	2575.9582	K	K	89	111
PSM	EGMNIVEAMER	110	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=3696	41.959	2	1311.6375	1311.6375	K	F	74	85
PSM	EISEASENIYSDVR	111	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2720	33.473	2	1724.7718	1724.7718	K	G	1781	1795
PSM	FASENDLPEWK	112	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4021	44.999	2	1482.7068	1482.7068	R	E	58	69
PSM	HDDSSDNFCEADDIQSPEAEYVDLLLNPER	113	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,9-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=5257	59.966	4	3606.5194	3606.5194	K	Y	158	188
PSM	LEPQIASASEYAHR	114	sp|O60664-4|PLIN3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2000	27.962	2	1684.8034	1684.8034	K	G	85	99
PSM	NNSGEEFDCAFR	115	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2603	32.581	2	1478.6309	1478.6309	R	L	355	367
PSM	QYEQQTYQVIPEVIK	116	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4174	46.618	2	2013.0496	2013.0496	R	N	39	54
PSM	SANQSPQSVGSSGVDSGVESTSDGLR	117	sp|Q14693|LPIN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2671	33.096	3	2621.1666	2621.1666	R	D	434	460
PSM	SGAMSPMSWNSDASTSEAS	118	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:35,5-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=2491	31.711	2	2047.76	2047.7600	R	-	190	209
PSM	SSGPYGGGGQYFAK	119	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1964	27.693	2	1602.6793	1602.6793	R	P	232	246
PSM	SAGAPASVSGQDADGSTSPR	120	sp|P42679|MATK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=1150	21.195186666666668	3	1930.8559	1930.8477	R	S	484	504
PSM	AGGIETIANEYSDR	121	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2674	33.119	2	1608.7245	1608.7245	R	C	20	34
PSM	DNLTLWTSDQQDEEAGEGN	122	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4407	48.994	2	2154.9402	2154.9402	R	-	228	247
PSM	DQGTYEDYVEGLR	123	sp|P60660-2|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3693	41.936	2	1657.7085	1657.7085	K	V	82	95
PSM	ESLKEEDESDDDNM	124	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=947	19.523	2	1738.7364	1738.7364	K	-	235	249
PSM	KEESEESDDDMGFGLFD	125	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4747	52.696	2	2016.8783	2016.8783	K	-	73	90
PSM	LVQDVANNTNEEAGDGTTTATVLAR	126	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=2748	33.686	3	2593.3044	2593.3044	K	S	97	122
PSM	NPDDITNEEYGEFYK	127	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3494	39.864	2	2060.833	2060.8330	R	S	300	315
PSM	QDENDDDDDWNPCK	128	sp|Q14974|IMB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,13-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=2165	29.202	2	1832.7432	1832.7432	K	A	333	347
PSM	SYPLDLEGGSEYK	129	sp|Q9UET6-2|TRM7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3508	40.003	2	1604.7648	1604.7648	R	Y	247	260
PSM	TAFQEALDAAGDK	130	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3033	35.938	2	1403.7569	1403.7569	K	L	9	22
PSM	TLSNAEDYLDDEDSD	131	sp|Q92882|OSTF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=4058	45.364	2	1814.6831	1814.6831	R	-	200	215
PSM	VLQAQGSSDPEEESVLYSNR	132	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=2928	35.118	3	2321.0637	2321.0637	R	A	38	58
PSM	CVAPYPSLLSSEDNADDEVDTRPASFWETS	133	sp|P08581|MET_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,1-UNIMOD:4,5-UNIMOD:21,29-UNIMOD:21	ms_run[1]:scan=5593	64.97086166666666	3	3551.4702	3551.4572	K	-	1361	1391
PSM	SSSPVQVEEEPVR	134	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1843	26.780334999999997	2	1555.741076	1555.734336	R	L	116	129
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	135	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,20-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=2436	31.292386666666665	3	2810.201572	2810.190250	R	E	424	448
PSM	AFLAELEQNSPK	136	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3782	42.735	2	1493.7803	1493.7803	K	I	2424	2436
PSM	DNLTLWTSENQGDEGDAGEGEN	137	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4319	48.207	3	2384.01	2384.0100	R	-	223	245
PSM	DSSTSPGDYVLSVSENSR	138	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4174	46.618	2	2012.8788	2012.8788	R	V	39	57
PSM	DWILPSDYDHAEAEAR	139	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3920	44.086	2	2000.873	2000.8730	K	H	256	272
PSM	EDIYAVEIVGGATR	140	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4144	46.267	2	1605.7864	1605.7864	K	I	333	347
PSM	EGYSGVGLLSR	141	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2908	34.966	2	1250.612	1250.6120	K	Q	126	137
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	142	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,26-UNIMOD:510	ms_run[2]:scan=3478	39.698	3	3010.3787	3010.3787	K	E	120	146
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	143	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,32-UNIMOD:510	ms_run[2]:scan=3099	36.473	3	3790.3213	3790.3213	K	A	158	190
PSM	LAPDYDALDVANK	144	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3349	38.632	2	1551.7858	1551.7858	R	I	140	153
PSM	LASEYNWGGPESSDK	145	sp|Q96KG9-3|SCYL1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2623	32.733	2	1786.8087	1786.8087	R	G	620	635
PSM	LEPQIASASEYAHR	146	sp|O60664-4|PLIN3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1988	27.873	3	1684.8034	1684.8034	K	G	85	99
PSM	LQQGAGLESPQGQPEPGAASPQR	147	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=2052	28.349	3	2416.1596	2416.1596	R	Q	72	95
PSM	QENCGAQQVPAGPGTSTPPSSPVR	148	sp|Q96G46-2|DUS3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=2154	29.12	3	2535.1637	2535.1637	R	T	257	281
PSM	QREESETRSESSDFEVVPK	149	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2017	28.087	3	2386.1326	2386.1326	R	R	995	1014
PSM	QRSPSPAPAPAPAAAAGPPTR	150	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=1465	23.652	3	2161.0295	2161.0295	R	K	496	517
PSM	SISADDDLQESSR	151	sp|P18615-3|NELFE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1976	27.78	2	1535.6565	1535.6565	R	R	120	133
PSM	SNTSPEELGPLANQLTSDYGR	152	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,19-UNIMOD:21	ms_run[2]:scan=4243	47.316	3	2362.0902	2362.0902	K	L	1875	1896
PSM	SSAYESLMEIVK	153	sp|Q14974|IMB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4692	52.1	2	1503.7568	1503.7568	R	N	526	538
PSM	TTPSYVAFTDTER	154	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2865	34.602	2	1600.7234	1600.7234	R	L	37	50
PSM	TYGGCEGPDAMYVK	155	sp|Q15369|ELOC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=2473	31.573	2	1694.7358	1694.7358	K	L	7	21
PSM	VADWTGATYQDK	156	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2228	29.703	2	1501.7127	1501.7127	K	R	42	54
PSM	VDSTTCLFPVEEK	157	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=3968	44.52	2	1671.8103	1671.8103	R	A	241	254
PSM	VYAPASTLVDQPYANEGTVVVTER	158	sp|Q14126|DSG2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4242	47.308	3	2692.3209	2692.3209	R	V	967	991
PSM	YISPDQLADLYK	159	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4503	50.02	2	1572.8113	1572.8113	R	S	270	282
PSM	YISPDQLADLYK	160	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4373	48.642	2	1652.7776	1652.7776	R	S	270	282
PSM	GVVDSEDLPLNISR	161	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510	ms_run[1]:scan=3726	42.26719833333333	2	1546.8476	1546.8410	R	E	379	393
PSM	HGESAWNLENR	162	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510	ms_run[1]:scan=1659	25.10469666666667	2	1346.6672	1345.6582	R	F	11	22
PSM	NVDGVNYASITR	163	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=2362	30.736661666666663	2	1421.6820	1421.6759	R	N	70	82
PSM	SEDSTIYDLLK	164	sp|O15013|ARHGA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=4743	52.635915000000004	2	1430.7276	1430.7213	R	D	1301	1312
PSM	DSSTSPGDYVLSVSENSR	165	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4174	46.617895000000004	2	2012.8882	2012.8782	R	V	39	57
PSM	LASEYNWGGPESSDK	166	sp|Q96KG9|SCYL1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=2623	32.733493333333335	2	1786.8158	1786.8082	R	G	721	736
PSM	SSGPYGGGGQYFAK	167	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=1964	27.692936666666665	2	1602.686852	1602.679326	R	P	285	299
PSM	TYGGCEGPDAMYVK	168	sp|Q15369|ELOC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:510	ms_run[1]:scan=2473	31.57336333333333	2	1694.742076	1694.735781	K	L	7	21
PSM	APQETYADIGGLDNQIQEIK	169	sp|P62191-2|PRS4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4240	47.291	3	2350.173	2350.1730	K	E	106	126
PSM	ATAGDTHLGGEDFDNR	170	sp|P48741|HSP77_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1646	25.01	3	1708.7865	1708.7865	K	L	223	239
PSM	CECQDGENQSVYQNLCR	171	sp|P18084|ITB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:4,12-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=1991	27.894	3	2272.8761	2272.8761	R	E	498	515
PSM	DSVFLSCSEDNR	172	sp|Q9BQA1-2|MEP50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2607	32.612	2	1461.6618	1461.6618	K	I	116	128
PSM	DYEEVGVDSVEGEGEEEGEEY	173	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4553	50.565	2	2461.927	2461.9270	K	-	396	417
PSM	EEFASTCPDDEEIELAYEQVAK	174	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:4,17-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4561	50.631	3	2720.2089	2720.2089	R	A	217	239
PSM	EFHLNESGDPSSK	175	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=1655	25.076	3	1513.7685	1513.7685	K	S	130	143
PSM	GPVSGTEPEPVYSMEAADYR	176	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=2600	32.559	3	2283.9819	2283.9819	R	E	398	418
PSM	HELQANCYEEVK	177	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:4,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1227	21.815	2	1666.7699	1666.7699	K	D	133	145
PSM	NNASTDYDLSDK	178	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1416	23.261	2	1409.6947	1409.6947	K	S	301	313
PSM	SCFESSPDPELK	179	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:4,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2426	31.218	2	1542.695	1542.6950	R	S	871	883
PSM	SRSFTLDDESLK	180	sp|Q86WR7-2|PRSR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2788	33.99	2	1544.776	1544.7760	R	Y	41	53
PSM	TDIQIALPSGCYGR	181	sp|P33316-2|DUT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=3890	43.751	2	1663.7853	1663.7853	K	V	68	82
PSM	VRYSLDPENPTK	182	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2292	30.209	2	1565.8127	1565.8127	M	S	2	14
PSM	YLRSVGDGETVEFDVVEGEK	183	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=3934	44.242	3	2375.157	2375.1570	K	G	99	119
PSM	RTIAQDYGVLK	184	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=1907	27.267898333333335	2	1410.7950	1410.7903	K	A	110	121
PSM	SSGPYGGGGQYFAK	185	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2051	28.342126666666665	2	1522.7189	1522.7125	R	P	285	299
PSM	QSDDEVYAPGLDIESSLK	186	sp|Q15459|SF3A1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=4434	49.322720000000004	3	2113.0225	2113.0135	K	Q	450	468
PSM	SGAMSPMSWNSDASTSEAS	187	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,4-UNIMOD:35,7-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=2491	31.711343333333335	2	2047.7675	2047.7595	R	-	190	209
PSM	SEGTYCCGPVPVR	188	sp|P21980|TGM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1809	26.3936	2	1594.6801	1594.6728	K	A	365	378
PSM	GILAADESTGSIAK	189	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2579	32.398340000000005	2	1479.792197	1479.785825	K	R	29	43
PSM	YISPDQLADLYK	190	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=4503	50.01951833333334	2	1572.818399	1572.811312	R	S	270	282
PSM	SRTHSTSSSLGSGESPFSR	191	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=1614	24.7666	3	2079.952380	2079.943494	R	S	327	346
PSM	VYAPASTLVDQPYANEGTVVVTER	192	sp|Q14126|DSG2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=4242	47.30831499999999	3	2692.332779	2692.320946	R	V	967	991
PSM	CLTTDEYDGHSTYPSHQYQ	193	sp|P30043|BLVRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=2075	28.522	3	2414.9575	2414.9575	R	-	188	207
PSM	DLYANTVLSGGTTMYPGIADR	194	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=4417	49.143	3	2424.0534	2424.0534	K	M	292	313
PSM	EYVDPNNIFGNR	195	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4007	44.873	2	1550.6979	1550.6979	K	N	644	656
PSM	GPVSGTEPEPVYSMEAADYR	196	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,13-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=2616	32.68	2	2283.9819	2283.9819	R	E	398	418
PSM	IIYGGSVTGATCK	197	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1755	25.987	2	1473.7575	1473.7575	R	E	244	257
PSM	INPDGSQSVVEVPYAR	198	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3436	39.373	2	1843.893	1843.8930	R	S	58	74
PSM	LGDVYVNDAFGTAHR	199	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3365	38.757	3	1747.8143	1747.8143	K	A	129	144
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	200	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2321	30.426	3	2302.9275	2302.9275	R	S	314	339
PSM	NPDDITQEEYGEFYK	201	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3651	41.576	3	1994.8823	1994.8823	R	S	292	307
PSM	NQDATVYVGGLDEK	202	sp|Q15427|SF3B4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2708	33.381	2	1655.808	1655.8080	R	V	10	24
PSM	QEYDESGPSIVHR	203	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1510	23.984	2	1549.7585	1549.7585	K	K	360	373
PSM	QTIDNSQGAYQEAFDISKK	204	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=2838	34.376	3	2324.1786	2324.1786	K	E	140	159
PSM	RLEAAYLDLQR	205	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2957	35.337	2	1460.7601	1460.7601	R	I	70	81
PSM	RSTQGVTLTDLQEAEK	206	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2824	34.27	2	1922.9987	1922.9987	R	T	607	623
PSM	SAGAPASVSGQDADGSTSPRSQEP	207	sp|P42679|MATK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=1495	23.873	3	2372.0342	2372.0342	R	-	484	508
PSM	SCYEDGWLIK	208	sp|P23434|GCSH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:4,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3927	44.184	2	1417.6625	1417.6625	K	M	137	147
PSM	SEGTYCCGPVPVR	209	sp|P21980-2|TGM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=1809	26.394	2	1594.6733	1594.6733	K	A	365	378
PSM	TDYNASVSVPDSSGPER	210	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2458	31.462	2	1893.8206	1893.8206	R	I	70	87
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	211	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=4332	48.311	4	3490.5054	3490.5054	R	-	207	238
PSM	YLRSVGDGETVEFDVVEGEK	212	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,1-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=3934	44.24151833333333	3	2375.1672	2375.1562	K	G	99	119
PSM	GYFEYIEENK	213	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=3582	40.92794166666667	2	1438.6752	1438.6689	R	Y	256	266
PSM	GITINAAHVEYSTAAR	214	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=2435	31.28503	3	1786.8893	1786.8822	R	H	105	121
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	215	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=2321	30.426346666666667	3	2302.9363	2302.9270	R	S	326	351
PSM	HFSGLEEAVYR	216	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=2657	32.992506666666664	2	1420.6654	1420.6595	K	N	21	32
PSM	EVYELLDSPGK	217	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=3118	36.619240000000005	2	1396.7218	1396.7158	K	V	20	31
PSM	TRSPSPDDILER	218	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=2724	33.504081666666664	2	1578.6965	1578.6899	R	V	576	588
PSM	EHSEMSNNVSDPKGPPAKIAR	219	sp|Q01826|SATB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:35,6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=4486	49.85946833333333	3	2442.062465	2439.029106	K	L	12	33
PSM	ASSLGEIDESSELR	220	sp|Q16513-5|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3174	37.093	2	1605.7347	1605.7347	R	V	255	269
PSM	CSVLAAANPVYGR	221	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=3154	36.922	2	1490.7165	1490.7165	R	Y	446	459
PSM	DSYLILETLPTEYDSR	222	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=5249	59.882	2	2027.9553	2027.9553	K	V	156	172
PSM	DVTPPPETEVVLIK	223	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4291	47.896	2	1683.9372	1683.9372	K	N	519	533
PSM	EQFLDGDGWTSR	224	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=3525	40.166	2	1443.6843	1443.6843	K	W	25	37
PSM	EVEIAYSDVAK	225	sp|Q9Y696|CLIC4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2476	31.597	2	1370.7007	1370.7007	K	R	239	250
PSM	GHQQLYWSHPR	226	sp|P62273|RS29_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1493	23.858	2	1521.7091	1521.7091	M	K	2	13
PSM	HGESAWNLENR	227	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1665	25.148	2	1345.6587	1345.6587	R	F	11	22
PSM	HTGCCGDNDPIDVCEIGSK	228	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4,19-UNIMOD:510	ms_run[2]:scan=2425	31.21	3	2200.9824	2200.9824	K	V	110	129
PSM	NPDDITQEEYGEFYK	229	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3515	40.073	2	1994.8823	1994.8823	R	S	292	307
PSM	NPDSQYGELIEK	230	sp|P30085|KCY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2316	30.388	2	1539.7494	1539.7494	K	Y	44	56
PSM	QSGEYWIDPNQGSVEDAIK	231	sp|P05997|CO5A2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=4324	48.248	3	2283.0733	2283.0733	K	V	1307	1326
PSM	QTTVSNSQQAYQEAFEISK	232	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3089	36.395	3	2306.1104	2306.1104	K	K	139	158
PSM	QVVESAYEVIK	233	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2841	34.4	2	1411.7636	1411.7636	K	L	175	186
PSM	SLYESFVSSSDR	234	sp|P18615-3|NELFE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3433	39.351	2	1489.655	1489.6550	K	L	138	150
PSM	SRTHSTSSSLGSGESPFSR	235	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1614	24.767	3	2079.9435	2079.9435	R	S	238	257
PSM	YINVGDLAR	236	sp|Q9Y3D8-2|KAD6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3411	39.185	2	1133.5694	1133.5694	K	E	28	37
PSM	YQEVTNNLEFAK	237	sp|Q14444-2|CAPR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2906	34.951	2	1602.7967	1602.7967	K	E	99	111
PSM	YIDQEELNK	238	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,9-UNIMOD:510	ms_run[1]:scan=1697	25.387768333333334	2	1298.6483	1298.6427	K	T	276	285
PSM	YKLDEDEDEDDADLSK	239	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,2-UNIMOD:510,16-UNIMOD:510	ms_run[1]:scan=1918	27.34868833333333	3	2080.953447	2080.946209	K	Y	167	183
PSM	SRTHSTSSSLGSGESPFSR	240	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=1614	24.7666	3	2079.9519	2079.9430	R	S	327	346
PSM	GEPNVSYICSR	241	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=2182	29.33312	2	1394.6168	1394.6109	R	Y	273	284
PSM	QQLSAEELDAQLDAYNAR	242	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=4267	47.59757166666667	3	2148.003906	2147.994861	K	M	236	254
PSM	HWILPQDYDHAQAEAR	243	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=2850	34.468756666666664	3	2062.955713	2062.947457	R	H	271	287
PSM	SRSFTLDDESLK	244	sp|Q86WR7|PRSR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2788	33.9896	2	1544.7822	1544.7755	R	Y	41	53
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	245	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:4,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=2742	33.64	3	2487.0381	2487.0381	R	R	42	68
PSM	CYEMASHLR	246	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=1499	23.902	3	1199.564	1199.5640	K	R	128	137
PSM	DLYANTVLSGGTTMYPGIADR	247	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=4859	54.193	3	2408.0585	2408.0585	K	M	292	313
PSM	DWEDDSDEDMSNFDR	248	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3804	42.929	2	1908.7168	1908.7168	K	F	75	90
PSM	DYLDFLDDEEDQGIYQSK	249	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,15-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=5476	63.192	3	2340.0359	2340.0359	R	V	18	36
PSM	EDQTEYLEER	250	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1817	26.481	2	1344.6258	1344.6258	K	R	192	202
PSM	EKYIDQEELNK	251	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1517	24.036	2	1589.8439	1589.8439	K	T	282	293
PSM	ELAPYDENWFYTR	252	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4996	56.094	2	1896.7585	1896.7585	K	A	44	57
PSM	ETWDTAEEDSGTDSEYDESGK	253	sp|Q96K76-2|UBP47_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,16-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=2487	31.68	3	2497.9806	2497.9806	K	S	916	937
PSM	GDFCIQVGR	254	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=2684	33.196	2	1084.5548	1084.5548	R	N	91	100
PSM	GIYAYGFEK	255	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3329	38.43	2	1194.5999	1194.5999	R	P	46	55
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	256	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,32-UNIMOD:510	ms_run[2]:scan=2918	35.041	3	3790.3213	3790.3213	K	A	158	190
PSM	LAYINPDLALEEK	257	sp|P31948-3|STIP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4211	46.999	2	1635.8797	1635.8797	R	N	328	341
PSM	LGDVYVNDAFGTAHR	258	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3148	36.863	3	1667.848	1667.8480	K	A	129	144
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	259	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	ms_run[2]:scan=1405	23.175	4	3241.4532	3241.4532	K	E	269	299
PSM	NGQYAEASALYGR	260	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2284	30.146	2	1512.6822	1512.6822	R	A	22	35
PSM	NPDDITNEEYGEFYK	261	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3581	40.92	3	1980.8667	1980.8667	R	S	300	315
PSM	QLVRGEPNVSYICSR	262	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=2539	32.077	3	1890.9235	1890.9236	K	Y	206	221
PSM	SIYYITGESK	263	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2868	34.624	2	1387.635	1387.6350	K	E	482	492
PSM	TAENATSGETLEENEAGD	264	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1770	26.1	2	1870.8128	1870.8128	K	-	323	341
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	265	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:35	ms_run[2]:scan=3909	43.956	4	3506.5004	3506.5004	R	-	207	238
PSM	VERADGYEPPVQESV	266	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2172	29.257	2	1787.8191	1787.8191	K	-	250	265
PSM	YALYDATYETK	267	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2831	34.324	2	1404.7449	1404.7449	R	E	82	93
PSM	YMACCLLYR	268	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,4-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=3414	39.208	2	1362.5748	1362.5748	K	G	277	286
PSM	GPVSGTEPEPVYSMEAADYR	269	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=2616	32.680076666666665	2	2283.9912	2283.9812	R	E	435	455
PSM	TDMDNQIVVSDYAQMDR	270	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:35,12-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=2361	30.729011666666665	3	2145.8895	2145.8803	K	V	258	275
PSM	TEAQDLCRASPEPPGPESSSR	271	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1735	25.834713333333333	3	2384.0622	2384.0522	R	W	663	684
PSM	SCAHDWVYE	272	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,2-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=2386	30.91936666666667	2	1279.484527	1279.479307	K	-	129	138
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	273	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=2742	33.640211666666666	3	2487.0476	2487.0376	R	R	42	68
PSM	THSVNGITEEADPTIYSGK	274	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,16-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=2249	29.86311666666667	3	2166.0605	2166.0513	K	V	582	601
PSM	GDRSEDFGVNEDLADSDAR	275	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510	ms_run[1]:scan=2681	33.17328	3	2100.9483	2100.9403	K	A	186	205
PSM	EASRSSPVEFECINEK	276	sp|O75131|CPNE3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[1]:scan=2443	31.34403833333333	3	2028.958525	2028.950007	K	K	238	254
PSM	CLTTDEYDGHSTYPSHQYQ	277	sp|P30043|BLVRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,1-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=2075	28.52228333333333	3	2414.9668	2414.9570	R	-	188	207
PSM	VADWTGATYQDK	278	sp|O15371|EIF3D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2228	29.703236666666665	2	1501.718720	1501.712660	K	R	42	54
PSM	ADRDESSPYAAMLAAQDVAQR	279	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3633	41.4	3	2378.0786	2378.0786	K	C	64	85
PSM	ASPEPQRENASPAPGTTAEEAMSR	280	sp|P46379-5|BAG6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1878	27.058	3	2597.1641	2597.1641	R	G	957	981
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	281	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=3275	37.94	4	3527.556	3527.5560	K	L	104	135
PSM	DNLTLWTSDQQDDDGGEGNN	282	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=4352	48.477	3	2226.9361	2226.9361	R	-	228	248
PSM	DNSTMGYMMAK	283	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2778	33.912	2	1315.6247	1315.6247	R	K	613	624
PSM	DVIELTDDSFDK	284	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=4143	46.26	2	1463.7668	1463.7668	K	N	158	170
PSM	DYEEVGVDSVEGEGEEEGEEY	285	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=4223	47.11	3	2381.9607	2381.9607	K	-	396	417
PSM	EDMAALEKDYEEVGADSADGEDEGEEY	286	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=4186	46.729	3	3113.238	3113.2380	R	-	423	450
PSM	EILVGDVGQTVDDPYATFVK	287	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,15-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4739	52.602	3	2313.1818	2313.1818	K	M	54	74
PSM	ELISNSSDALDK	288	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2037	28.239	2	1358.7566	1358.7566	R	I	47	59
PSM	FLDGIYVSEK	289	sp|P32969|RL9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3812	43.02	2	1317.6894	1317.6894	K	G	175	185
PSM	GGIVDEGALLR	290	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3192	37.236	2	1132.6664	1132.6664	R	A	237	248
PSM	GITINAAHVEYSTAAR	291	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2435	31.285	3	1786.8827	1786.8827	R	H	105	121
PSM	LGDVYVNDAFGTAHR	292	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3377	38.88	2	1747.8143	1747.8143	K	A	129	144
PSM	LPQPPEGQCYSN	293	sp|Q13404-6|UB2V1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=1927	27.416	2	1502.6325	1502.6325	K	-	92	104
PSM	MNVSPDVNYEELAR	294	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3392	39.01	2	1749.7857	1749.7857	K	C	373	387
PSM	NEQDAYAINSYTR	295	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2315	30.381	2	1657.7197	1657.7197	R	S	209	222
PSM	NLTEQNSYSNIPHEGK	296	sp|Q5T035|CI129_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1640	24.965	3	1977.947	1977.9470	K	H	60	76
PSM	QTIDNSQGAYQEAFDISK	297	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3340	38.518	3	2162.0205	2162.0205	K	K	140	158
PSM	RTGYESGEYEMLGEGLGVK	298	sp|Q13561|DCTN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3022	35.831	3	2238.0552	2238.0552	K	E	78	97
PSM	RTGYESGEYEMLGEGLGVK	299	sp|Q13561|DCTN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3686	41.88	3	2222.0603	2222.0603	K	E	78	97
PSM	SSTPLPTISSSAENTR	300	sp|P42167-3|LAP2B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2378	30.857	2	1760.8406	1760.8406	R	Q	158	174
PSM	TNQELQEINR	301	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1374	22.94	2	1277.6788	1277.6788	R	V	154	164
PSM	TRSPSPDDILER	302	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2724	33.504	2	1578.6904	1578.6904	R	V	576	588
PSM	VTLTSEEEAR	303	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1358	22.819	2	1167.6195	1167.6195	K	L	248	258
PSM	VYENVGLMQQQK	304	sp|Q06124|PTN11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2479	31.619	2	1583.8055	1583.8055	R	S	579	591
PSM	YFQINQDEEEEEDED	305	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3057	36.148	2	1964.786	1964.7860	R	-	114	129
PSM	YHTSQSGDEMTSLSEYVSR	306	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3095	36.442	3	2289.9673	2289.9673	R	M	457	476
PSM	YHTSQSGDEMTSLSEYVSR	307	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3764	42.592	3	2289.9673	2289.9673	R	M	457	476
PSM	DNLTLWTSDQQDDDGGEGNN	308	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=4816	53.64463666666667	3	2227.9482	2226.9352	R	-	228	248
PSM	ADRDESSPYAAMLAAQDVAQR	309	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=3633	41.399879999999996	3	2378.0882	2378.0782	K	C	64	85
PSM	NGRVEIIANDQGNR	310	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=1181	21.443376666666666	3	1588.8550	1588.8489	K	I	47	61
PSM	KQSFDDNDSEELEDK	311	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=1779	26.167456666666666	3	1979.9175	1979.9092	K	D	105	120
PSM	GSFKDDPQLYQEIQER	312	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,4-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=3046	36.06402833333333	3	2100.0274	2100.0196	K	G	207	223
PSM	SSTPLPTISSSAENTR	313	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2378	30.856665000000003	2	1760.8473	1760.8401	R	Q	158	174
PSM	DRSSPPPGYIPDELHQVAR	314	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3210	37.375440000000005	3	2247.0991	2247.0892	R	N	161	180
PSM	ETWDTAEEDSGTDSEYDESGK	315	sp|Q96K76|UBP47_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,19-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=2487	31.679771666666667	3	2497.9902	2497.9802	K	S	1004	1025
PSM	NGSEADIDEGLYSR	316	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=3091	36.411	2	1639.690227	1638.698678	K	Q	44	58
PSM	AEDGSVIDYELIDQDAR	317	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4231	47.202	3	2021.9043	2021.9043	R	D	198	215
PSM	ASSPSPLTIGTPESQR	318	sp|Q9NPI6-2|DCP1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2648	32.923	2	1740.8508	1740.8508	K	K	483	499
PSM	CRSPGMLEPLGSSR	319	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=1713	25.617	3	1675.7635	1675.7635	R	T	2130	2144
PSM	CRSPGMLEPLGSSR	320	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=2375	30.835	3	1659.7686	1659.7686	R	T	2130	2144
PSM	DHSPTPSVFNSDEER	321	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2507	31.832	2	1909.7345	1909.7345	R	Y	416	431
PSM	DINAYNCEEPTEK	322	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1943	27.534	2	1649.7879	1649.7879	K	L	85	98
PSM	DIVENYFMR	323	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4378	48.679	2	1299.5783	1299.5783	K	D	128	137
PSM	DLNYCFSGMSDHR	324	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=3163	36.994	3	1714.6693	1714.6693	R	Y	263	276
PSM	DLSLEEIQK	325	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=3198	37.282	2	1141.6867	1141.6867	K	K	44	53
PSM	DNNQFASASLDR	326	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2153	29.113	2	1370.6639	1370.6639	K	T	125	137
PSM	DVIEEYFK	327	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=3715	42.14	2	1189.5944	1189.5944	K	C	122	130
PSM	DVNQQEFVR	328	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1899	27.214	2	1167.6097	1167.6097	K	A	8	17
PSM	DWILPSDYDHAEAEAR	329	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3898	43.826	3	2000.873	2000.8730	K	H	256	272
PSM	EAAENSLVAYK	330	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1897	27.198	2	1261.7191	1261.7191	K	A	121	132
PSM	EEFTAFLHPEEYDYMK	331	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4760	52.916	3	2195.9799	2195.9799	K	D	174	190
PSM	EGLELPEDEEEK	332	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2637	32.841	2	1483.7566	1483.7566	K	K	547	559
PSM	EGLELPEDEEEKK	333	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2101	28.72	3	1645.9147	1645.9147	K	K	547	560
PSM	ESEDKPEIEDVGSDEEEEKK	334	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510,20-UNIMOD:510	ms_run[2]:scan=1613	24.759	4	2456.2603	2456.2603	K	D	251	271
PSM	EVGVYEALK	335	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2461	31.483	2	1154.6261	1154.6261	K	D	117	126
PSM	GGDEVYLLCDK	336	sp|Q00653|NFKB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=3424	39.283	2	1415.668	1415.6680	R	V	242	253
PSM	GIAAQPLYAGYCNHENM	337	sp|P07686|HEXB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=2886	34.768	3	2037.8538	2037.8538	R	-	540	557
PSM	GLSEDTTEETLK	338	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2438	31.307	2	1469.7175	1469.7175	K	E	578	590
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	339	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,20-UNIMOD:21,32-UNIMOD:4,33-UNIMOD:510	ms_run[2]:scan=3669	41.733	4	3881.5895	3881.5895	R	G	16	49
PSM	HGESAWNLENR	340	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2133	28.96	2	1425.6251	1425.6251	R	F	11	22
PSM	HGVVPLATYMR	341	sp|P46778|RL21_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2609	32.628	2	1356.6838	1356.6838	K	I	22	33
PSM	IEDVTPIPSDSTR	342	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2296	30.239	2	1542.7391	1542.7391	R	R	129	142
PSM	IFRDGEEAGAYDGPR	343	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1421	23.3	3	1765.7885	1765.7885	K	T	105	120
PSM	KDDEENYLDLFSHK	344	sp|Q07666-3|KHDR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3513	40.057	3	1933.9559	1933.9559	K	N	139	153
PSM	LIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGR	345	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=1088	20.696	4	3537.3473	3537.3473	R	A	81	114
PSM	QEYDESGPSIVHR	346	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1492	23.851	3	1549.7585	1549.7585	K	K	360	373
PSM	QLSSGVSEIR	347	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2036	28.232	2	1188.5964	1188.5964	R	H	80	90
PSM	QVYEEEYGSSLEDDVVGDTSGYYQR	348	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4548	50.512	3	3001.2603	3001.2603	K	M	127	152
PSM	RLAPEYEAAATR	349	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1300	22.374	2	1460.7237	1460.7237	K	L	62	74
PSM	RLSQSDEDVIR	350	sp|Q9H7D7-3|WDR26_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1667	25.163	2	1430.6979	1430.6979	K	L	119	130
PSM	SGTSEFLNK	351	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=1969	27.73	2	1129.5693	1129.5693	K	M	169	178
PSM	SKPVFSESLSD	352	sp|O60220|TIM8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2783	33.952	2	1342.6694	1342.6694	K	-	87	98
PSM	SQECYFDPELYR	353	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=3871	43.563	2	1719.7064	1719.7064	R	S	348	360
PSM	SRSPESQVIGENTK	354	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1266	22.112	3	1678.8564	1678.8564	R	Q	305	319
PSM	SYCAEIAHNVSSK	355	sp|P62910|RL32_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1682	25.274	3	1532.793	1532.7930	K	N	94	107
PSM	VSRDTLYEAVR	356	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2098	28.696	2	1421.7128	1421.7128	K	E	5	16
PSM	YAALYQPLFDK	357	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4350	48.462	2	1555.7401	1555.7401	K	R	95	106
PSM	YHTSQSGDEMTSLSEYVSR	358	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=2059	28.402	3	2305.9622	2305.9622	R	M	457	476
PSM	YMACCLLYR	359	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,2-UNIMOD:35,4-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=2722	33.489	2	1378.5697	1378.5697	K	G	277	286
PSM	AFHGCDSAEELPR	360	sp|P42679|MATK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,5-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1830	26.629498333333334	3	1601.681981	1601.675775	R	V	12	25
PSM	VLTPELYAELR	361	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=4103	45.80187	2	1416.753924	1416.747801	K	A	33	44
PSM	ASSLGEIDESSELR	362	sp|Q16513|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3174	37.09332666666667	2	1605.7405	1605.7342	R	V	581	595
PSM	GEPNVSYICSR	363	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=2324	30.44863833333333	2	1394.6168	1394.6109	R	Y	273	284
PSM	CVAPYPSLLSSEDNADDEVDTRPASFWETS	364	sp|P08581|MET_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,1-UNIMOD:4,5-UNIMOD:21,21-UNIMOD:21,29-UNIMOD:21	ms_run[1]:scan=6023	72.43493166666667	3	3631.4362	3631.4232	K	-	1361	1391
PSM	NPDDITQEEYGEFYK	365	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3515	40.072875	2	1994.891046	1994.882305	R	S	292	307
PSM	ADLLLSTQPGREEGSPLELER	366	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=4043	45.204	3	2423.2158	2423.2158	K	L	492	513
PSM	AFQNTATACAPVSHYR	367	sp|Q9H814|PHAX_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=1626	24.856	3	1906.8609	1906.8609	R	A	43	59
PSM	ASGNYATVISHNPETK	368	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=1643	24.987	3	1755.9428	1755.9428	R	K	129	145
PSM	DFPEYTFAIADEEDYAGEVK	369	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5340	61.147	2	2536.0648	2536.0648	K	D	444	464
PSM	DGNGYISAAELR	370	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2951	35.293	2	1298.6679	1298.6679	K	H	96	108
PSM	DNLTLWTSDTQGDEAEAGEGGEN	371	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=4818	53.66	3	2442.0519	2442.0519	R	-	223	246
PSM	DNSTMGYMAAK	372	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1928	27.423	2	1255.6213	1255.6213	R	K	621	632
PSM	DRSSPPPGYIPDELHQVAR	373	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3210	37.375	3	2247.0898	2247.0898	R	N	161	180
PSM	DSLVYQYLQK	374	sp|Q8NBF2|NHLC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4227	47.157	2	1403.7374	1403.7374	K	V	35	45
PSM	EAIEGTYIDK	375	sp|P62280|RS11_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2150	29.089	2	1285.6479	1285.6479	K	K	49	59
PSM	ELASGEYFLK	376	sp|Q13601-2|KRR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3640	41.452	2	1303.6738	1303.6738	K	A	224	234
PSM	EQAIGEYEDLRAENQK	377	sp|A0MZ66-2|SHOT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1952	27.602	3	2039.9837	2039.9837	K	T	18	34
PSM	EQVANSAFVER	378	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1656	25.084	2	1282.673	1282.6730	K	V	492	503
PSM	ERSPSPLRGNVVPSPLPTR	379	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2969	35.429	3	2252.1292	2252.1292	R	R	28	47
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	380	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,34-UNIMOD:510	ms_run[2]:scan=4604	51.182	3	3824.5651	3824.5651	K	A	469	503
PSM	GDNIYEWR	381	sp|P51965-2|UB2E1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2646	32.909	2	1165.5018	1165.5018	K	S	40	48
PSM	GFSLEELR	382	sp|P26373-2|RL13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4105	45.818	2	1063.5163	1063.5163	R	V	75	83
PSM	GHQQLYWSHPR	383	sp|P62273|RS29_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1476	23.732	3	1521.7091	1521.7091	M	K	2	13
PSM	GPVSGTEPEPVYSMEAADYR	384	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3621	41.268	3	2267.987	2267.9870	R	E	398	418
PSM	GREDVSNFDDEFTSEAPILTPPREPR	385	sp|Q16513-5|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=4157	46.441	4	3087.4399	3087.4399	R	I	613	639
PSM	IHRASDPGLPAEEPK	386	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1264	22.095	3	1763.9244	1763.9244	R	E	1855	1870
PSM	INVYYNEATGGK	387	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2511	31.862	2	1475.7334	1475.7334	R	Y	47	59
PSM	IQALQQQADEAEDR	388	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1803	26.35	3	1647.8276	1647.8276	K	A	14	28
PSM	IVLDSDAAEYGGHQR	389	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1871	27.005	3	1743.8041	1743.8041	K	L	648	663
PSM	IYEPLDVK	390	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=2761	33.783	2	1123.6203	1123.6203	R	S	534	542
PSM	LEAAYLDLQR	391	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3451	39.489	2	1304.659	1304.6590	R	I	71	81
PSM	NGRVEIIANDQGNR	392	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1185	21.47	2	1588.8494	1588.8494	K	I	47	61
PSM	NQSFCPTVNLDK	393	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=3147	36.855	2	1569.7535	1569.7535	R	L	66	78
PSM	NSSLLSFDNEDENE	394	sp|Q96AT1|K1143_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4652	51.681	2	1725.6831	1725.6831	K	-	141	155
PSM	NVNIYRDSAIPVESDTDDEGAPR	395	sp|Q96D46|NMD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2974	35.47	3	2646.2023	2646.2023	K	I	455	478
PSM	QDSSTGSYSINFVQNPNNNR	396	sp|Q99614|TTC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=3146	36.848	3	2275.0678	2275.0678	K	-	273	293
PSM	RGPGLYYVDSEGNR	397	sp|P28074-3|PSB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1960	27.662	3	1615.8167	1615.8167	K	I	63	77
PSM	RLAAQESSEAEDMSVPR	398	sp|Q9Y4E1-5|WAC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=1406	23.183	3	2004.9036	2004.9036	R	G	951	968
PSM	RWIYEDVER	399	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2713	33.419	2	1378.6495	1378.6495	K	Q	103	112
PSM	SFTLDDESLK	400	sp|Q86WR7-2|PRSR2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3684	41.864	2	1301.6428	1301.6428	R	Y	43	53
PSM	SGQGAFGNMCR	401	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=881	18.806	2	1233.5443	1233.5443	R	G	87	98
PSM	SGSPAPETTNESVPFAQHSSLDSR	402	sp|O15047|SET1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2779	33.919	3	2614.1761	2614.1761	R	I	468	492
PSM	SIYYITGESK	403	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2527	31.983	2	1227.7023	1227.7023	K	E	482	492
PSM	SPASDTYIVFGEAK	404	sp|Q13765|NACA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3774	42.672	2	1631.812	1631.8120	K	I	114	128
PSM	SSFSHYSGLK	405	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1500	23.909	2	1259.6224	1259.6224	R	H	202	212
PSM	SSSPAPADIAQTVQEDLR	406	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4737	52.587	3	1997.9519	1997.9519	K	T	230	248
PSM	SYSFDEIRK	407	sp|P43490|NAMPT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2621	32.719	2	1291.6486	1291.6486	K	N	470	479
PSM	TDRVGVEASEETPQTSSSSARPGTPSDHQSQEASQFER	408	sp|Q6Y7W6|GGYF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,24-UNIMOD:21	ms_run[2]:scan=1932	27.453	5	4188.8682	4188.8682	K	K	359	397
PSM	YLDEDTIYHLQPSGR	409	sp|P31153|METK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3287	38.031	3	1919.8879	1919.8879	K	F	235	250
PSM	YSVDIPLDK	410	sp|P61353|RL27_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2996	35.636	2	1196.6366	1196.6366	R	T	85	94
PSM	YTPSGQAGAAASESLFVSNHAY	411	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,22-UNIMOD:21	ms_run[2]:scan=4168	46.556	3	2421.014	2421.0140	K	-	343	365
PSM	YYVTIIDAPGHR	412	sp|Q5VTE0|EF1A3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2760	33.776	3	1437.7829	1437.7829	K	D	85	97
PSM	HYGGLTGLNK	413	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=1338	22.664381666666664	2	1206.648389	1206.643458	R	A	91	101
PSM	YTPSGQAGAAASESLFVSNHAY	414	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=4168	46.55617	3	2421.0242	2421.0132	K	-	343	365
PSM	ITPSYVAFTPEGER	415	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=3397	39.049525	2	1679.8088	1679.8015	R	L	61	75
PSM	ISVYYNEATGGK	416	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2542	32.101040000000005	2	1448.7281	1448.7220	R	Y	47	59
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	417	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,2-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1745	25.911418333333334	3	2318.931796	2318.922441	R	S	326	351
PSM	NRPTSISWDGLDSGK	418	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3408	39.162690000000005	3	1779.8898	1779.8824	K	L	48	63
PSM	SSSPAPADIAQTVQEDLR	419	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=4737	52.58653833333333	3	1997.9602	1997.9514	K	T	230	248
PSM	ILNSPVSLAR	420	sp|P57058|HUNK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=2503	31.802668333333337	2	1148.5979	1148.5949	R	R	582	592
PSM	AEDSGEYHCVYHFVSAPK	421	sp|Q9Y639-3|NPTN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2593	32.507	3	2322.9694	2322.9694	R	A	94	112
PSM	AGFAGDDAPR	422	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=1117	20.937	2	1009.5041	1009.5041	K	A	19	29
PSM	ARPATDSFDDYPPR	423	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2394	30.981	3	1720.767	1720.7670	R	R	162	176
PSM	ARSVDALDDLTPPSTAESGSR	424	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3189	37.214	3	2258.064	2258.0640	R	S	335	356
PSM	ASGNYATVISHNPETK	425	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1497	23.89	3	1835.9091	1835.9091	R	K	129	145
PSM	ASPEPQRENASPAPGTTAEEAMSR	426	sp|P46379-5|BAG6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=1190	21.509	3	2613.159	2613.1590	R	G	957	981
PSM	DLEGTYLCR	427	sp|P05362|ICAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=2733	33.571	2	1239.5419	1239.5419	R	A	450	459
PSM	DNWEELYNR	428	sp|P55786-2|PSA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=3480	39.713	2	1271.5995	1271.5995	K	Y	753	762
PSM	DYLLCDYNR	429	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=3535	40.296	2	1344.5634	1344.5634	K	D	58	67
PSM	EAAGEGPALYEDPPDQK	430	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=2071	28.492	2	1933.8983	1933.8983	K	T	36	53
PSM	EAFQLFDR	431	sp|P60660-2|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=3667	41.716	2	1058.5609	1058.5609	K	T	14	22
PSM	EASRSSPVEFECINEK	432	sp|O75131|CPNE3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2443	31.344	3	2028.95	2028.9500	K	K	238	254
PSM	EFTNVYIK	433	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=2979	35.506	2	1160.6155	1160.6155	K	N	189	197
PSM	ERNVEDLSGGELQR	434	sp|P61221|ABCE1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=1806	26.371	3	1634.8436	1634.8436	K	F	211	225
PSM	FAFQAEVNR	435	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=2712	33.412	2	1114.5984	1114.5984	K	M	76	85
PSM	FAQHGTFEYEYSQR	436	sp|P23246-2|SFPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2263	29.984	3	1875.8041	1875.8041	R	W	480	494
PSM	FNAHGDANTIVCNSK	437	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,12-UNIMOD:4,15-UNIMOD:510	ms_run[2]:scan=1444	23.491	3	1714.8733	1714.8733	R	D	50	65
PSM	GGFDSPFYR	438	sp|Q92574-2|TSC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3511	40.04	2	1158.4959	1158.4959	R	D	450	459
PSM	GISPIVFDR	439	sp|Q96MU7-2|YTDC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3870	43.556	2	1116.5793	1116.5793	R	S	306	315
PSM	GPREEIVYLPCIYR	440	sp|Q13228-3|SBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=4430	49.289	3	1957.8987	1957.8987	K	N	21	35
PSM	GVAVDYLPER	441	sp|P13674-3|P4HA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2816	34.207	2	1231.6062	1231.6062	K	Q	277	287
PSM	HGYIGEFEIIDDHR	442	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=3385	38.956	3	1733.8586	1733.8586	K	A	44	58
PSM	HIYYITGETK	443	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=1761	26.031	2	1291.7449	1291.7449	K	D	490	500
PSM	IAQLEEELEEEQGNTELINDR	444	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=4276	47.724	3	2505.2295	2505.2295	R	L	1153	1174
PSM	LAAQESSETEDMSVPR	445	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2455	31.437	2	1862.8181	1862.8181	R	G	1027	1043
PSM	LAYINPDLALEEK	446	sp|P31948-3|STIP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4214	47.023	3	1635.8797	1635.8797	R	N	328	341
PSM	LMIEMDGTENK	447	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2847	34.446	2	1347.7051	1347.7051	K	S	93	104
PSM	NSLESYAFNMK	448	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2860	34.562	2	1466.6789	1466.6789	K	A	540	551
PSM	NSLESYAFNMK	449	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3690	41.912	2	1450.684	1450.6840	K	A	540	551
PSM	QLLCGAAIGTHEDDK	450	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:4,15-UNIMOD:510	ms_run[2]:scan=1959	27.655	3	1694.8934	1694.8934	K	Y	243	258
PSM	QNLIAEVSTK	451	sp|P31327-3|CPSM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2441	31.329	2	1169.7292	1169.7292	K	D	204	214
PSM	SEEEFIHINNK	452	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2184	29.347	3	1426.7729	1426.7729	K	L	165	176
PSM	SKSEEAHAEDSVMDHHFR	453	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2012	28.049	3	2259.0052	2259.0052	K	K	313	331
PSM	SLEDLQDEYDFK	454	sp|P42224-2|STAT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3810	43.004	2	1648.7546	1648.7546	K	C	162	174
PSM	STTPPPAEPVSLPQEPPKPR	455	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2589	32.476	3	2272.2141	2272.2141	K	V	225	245
PSM	TDEYLLAR	456	sp|P98082-2|DAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2409	31.092	2	1093.5269	1093.5269	K	F	35	43
PSM	TIAQDYGVLK	457	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2419	31.167	2	1254.6897	1254.6897	R	A	111	121
PSM	TLEEVVMAEEEDEGTDRPGSPA	458	sp|A6NKF1|SAC31_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=3929	44.201	3	2474.062	2474.0620	R	-	383	405
PSM	TTPSVVAFTADGER	459	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3421	39.261	2	1563.7394	1563.7394	R	L	86	100
PSM	VKGEEIYSMDEGIR	460	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=1634	24.919	3	1788.8642	1788.8642	R	T	883	897
PSM	VTDSSVSVQLRE	461	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2766	33.82	2	1432.7023	1432.7023	R	-	264	276
PSM	DLYANTVLSGGTTMYPGIADR	462	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=4859	54.193394999999995	3	2408.0692	2408.0582	K	M	292	313
PSM	VEIIANDQGNR	463	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510	ms_run[1]:scan=1454	23.568273333333334	2	1262.6912	1261.6832	K	T	26	37
PSM	EALQDVEDENQ	464	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510	ms_run[1]:scan=2067	28.464378333333332	2	1322.6102	1322.6045	K	-	245	256
PSM	EDHGRGYFEYIEENK	465	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=2694	33.27140166666667	3	2112.8951	2112.8862	R	Y	251	266
PSM	AADEEAFEDNSEEYIRR	466	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[1]:scan=2452	31.415151666666667	3	2156.9190	2156.9107	R	D	356	373
PSM	DLEGTYLCR	467	sp|P05362|ICAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=2733	33.571415	2	1239.5467	1239.5414	R	A	450	459
PSM	KINEELESQYQQSMDSK	468	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,10-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=1879	27.06539	3	2239.0982	2238.0972	K	L	75	92
PSM	AFGESSTESDEEEEEGCGHTHCVR	469	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1486	23.805581666666665	4	2852.0852	2852.0742	R	G	69	93
PSM	STTPPPAEPVSLPQEPPKPR	470	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2589	32.475543333333334	3	2272.2231	2272.2136	K	V	225	245
PSM	SSFSHYSGLK	471	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=1500	23.908773333333333	2	1259.627719	1259.622389	R	H	202	212
PSM	STTPPPAEPVSLPQEPPKPR	472	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2589	32.475543333333334	3	2272.223599	2272.214084	K	V	225	245
PSM	ACDELVEEMEHYGK	473	sp|O00469-3|PLOD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,2-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3738	42.364	3	1856.7998	1856.7998	K	W	256	270
PSM	ADQQYECVAEIGEGAYGK	474	sp|Q00534|CDK6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4,18-UNIMOD:510	ms_run[2]:scan=3413	39.2	3	2134.9555	2134.9555	R	V	9	27
PSM	AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEK	475	sp|Q00653|NFKB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,14-UNIMOD:4,21-UNIMOD:21,33-UNIMOD:510	ms_run[2]:scan=3485	39.766	4	3595.5822	3595.5822	K	D	690	723
PSM	ALSRQEMQEVQSSR	476	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1669	25.177	3	1761.8293	1761.8293	K	S	175	189
PSM	AVAGVMITASHNR	477	sp|Q6PCE3|PGM2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,6-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=1385	23.021	3	1455.7118	1455.7118	K	K	166	179
PSM	CEFQDAYVLLSEK	478	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4654	51.697	2	1748.8369	1748.8369	K	K	237	250
PSM	DETVSDCSPHIANIGR	479	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2281	30.122	3	1803.8634	1803.8634	K	L	200	216
PSM	DLFDPIIEDR	480	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510	ms_run[2]:scan=4646	51.633	2	1265.6716	1265.6716	K	H	87	97
PSM	DLTDYLMK	481	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,8-UNIMOD:510	ms_run[2]:scan=4356	48.509	2	1065.6053	1065.6053	R	I	184	192
PSM	DNLTLWTSDMQGDGEEQNK	482	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3709	42.078	3	2264.0539	2264.0539	R	E	204	223
PSM	DNSTMGYMMAK	483	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,5-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=1294	22.326	2	1347.6145	1347.6145	R	K	613	624
PSM	DSFDDRGPSLNPVLDYDHGSR	484	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3493	39.857	4	2475.0916	2475.0916	R	S	187	208
PSM	DTLYEAVR	485	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2149	29.082	2	1079.5113	1079.5113	R	E	8	16
PSM	EATNPPVIQEEKPK	486	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=1403	23.158	3	1760.981	1760.9810	R	K	483	497
PSM	ECFYIPK	487	sp|Q16719-2|KYNU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,2-UNIMOD:4,7-UNIMOD:510	ms_run[2]:scan=2692	33.255	2	1023.5736	1023.5736	R	I	44	51
PSM	ELFDDPSYVNVQNLDK	488	sp|P29353-5|SHC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,8-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4443	49.408	3	2042.9874	2042.9874	R	A	206	222
PSM	ERLESLNIQR	489	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2538	32.07	3	1370.7131	1370.7131	K	E	546	556
PSM	FIHQQPQSSSPVYGSSAK	490	sp|P49023-2|PAXI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,16-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=1239	21.905	3	2095.0412	2095.0412	R	T	76	94
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	491	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,34-UNIMOD:510	ms_run[2]:scan=4600	51.136	4	3824.5651	3824.5651	K	A	469	503
PSM	FNSESESGSEASSPDYFGPPAK	492	sp|Q9BW71|HIRP3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,9-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=3376	38.872	3	2437.0635	2437.0635	R	N	96	118
PSM	FPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG	493	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,33-UNIMOD:21	ms_run[2]:scan=3479	39.705	3	3333.3431	3333.3431	R	-	773	807
PSM	FYAELSDLK	494	sp|Q8NDI1-3|EHBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3734	42.331	2	1232.6366	1232.6366	K	R	549	558
PSM	GDLGIEIPAEK	495	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3267	37.88	2	1208.7289	1208.7289	R	V	295	306
PSM	GNSRPGTPSAEGGSTSSTLR	496	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1004	19.995	3	2031.9435	2031.9435	R	A	383	403
PSM	GYSFTTTAER	497	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510	ms_run[2]:scan=1832	26.645	2	1165.5828	1165.5828	R	E	197	207
PSM	HTGPNSPDTANDGFVR	498	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510	ms_run[2]:scan=1244	21.944	3	1717.8232	1717.8232	K	L	99	115
PSM	IRVDVADQAQDK	499	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1544	24.239	3	1424.826	1424.8260	R	D	127	139
PSM	LFNLSKEDDVR	500	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:510	ms_run[2]:scan=2917	35.034	2	1482.7756	1482.7756	K	Q	144	155
PSM	LFQECCPHSTDR	501	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,5-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=1073	20.58	3	1582.7081	1582.7081	K	V	156	168
PSM	NRPTSISWDGLDSGK	502	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3408	39.163	3	1779.8829	1779.8829	K	L	48	63
PSM	NTFTAWSDEESDYEIDDRDVNK	503	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,7-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4013	44.936	3	2796.2076	2796.2076	K	I	544	566
PSM	NYAAALETFTEGQK	504	sp|Q9Y2Z0-2|SGT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4046	45.228	3	1689.8288	1689.8288	K	L	94	108
PSM	QEYDESGPSIVHR	505	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1419	23.285	3	1629.7248	1629.7248	K	K	360	373
PSM	RLSQSDEDVIR	506	sp|Q9H7D7-3|WDR26_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1660	25.112	3	1430.6979	1430.6979	K	L	119	130
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	507	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=1515	24.021	4	3352.5468	3352.5468	R	Q	205	235
PSM	RTIAQDYGVLK	508	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1900	27.22	3	1410.7908	1410.7909	K	A	110	121
PSM	SADTLWDIQK	509	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3430	39.328	2	1243.7085	1243.7085	K	D	320	330
PSM	SADTLWDIQK	510	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4070	45.473	2	1323.6748	1323.6748	K	D	320	330
PSM	SGQVYSFGCNDEGALGR	511	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2930	35.133	3	1929.8141	1929.8141	K	D	85	102
PSM	SIYYITGESK	512	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2821	34.246	2	1307.6687	1307.6687	K	E	482	492
PSM	SPDDPSRYISPDQLADLYK	513	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,8-UNIMOD:21,18-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=4382	48.735	3	2407.1022	2407.1022	K	S	263	282
PSM	SQSSHSYDDSTLPLIDR	514	sp|O60716|CTND1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3333	38.461	3	2033.9155	2033.9155	R	N	859	876
PSM	SQTPSPSTLNIDHMEQK	515	sp|Q6GYQ0-3|RGPA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,1-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=2688	33.225	3	2059.9922	2059.9922	R	D	1047	1064
PSM	SRSPESQVIGENTKQP	516	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1534	24.162	3	1903.9677	1903.9677	R	-	305	321
PSM	VPSPLEGSEGDGDTD	517	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=3066	36.216	2	1587.6402	1587.6402	K	-	385	400
PSM	YADLPGIAR	518	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=2727	33.527	2	1088.548	1088.5480	K	N	6	15
PSM	YHTSQSGDEMTSLSEYVSR	519	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510	ms_run[2]:scan=3298	38.13	3	2210.001	2210.0010	R	M	457	476
PSM	YKPESEELTAER	520	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,2-UNIMOD:510	ms_run[2]:scan=1350	22.758	3	1518.8202	1518.8202	K	I	327	339
PSM	YLRYTPQP	521	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2114	28.819	2	1150.5636	1150.5636	K	-	217	225
PSM	YSQVLANGLDNK	522	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2351	30.656	3	1468.7599	1468.7599	K	L	95	107
PSM	YSVDIPLDK	523	sp|P61353|RL27_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3881	43.654	2	1196.6366	1196.6366	R	T	85	94
PSM	DNLTLWTSDQQDDDGGEGNN	524	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510	ms_run[1]:scan=4632	51.50786	3	2227.9492	2226.9352	R	-	228	248
PSM	RDSFDDRGPSLNPVLDYDHGSR	525	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3271	37.909868333333335	4	2631.2032	2631.1922	R	S	186	208
PSM	SGQVYSFGCNDEGALGR	526	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510,1-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=2930	35.13295	3	1929.8221	1929.8135	K	D	85	102
PSM	YSQVLANGLDNK	527	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2351	30.65589166666667	3	1468.765915	1468.759945	K	L	95	107
PSM	RHLTGEFEK	528	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[1]:scan=1001	19.973086666666667	3	1183.7033	1183.6981	K	K	29	38
PSM	SRSQSRSNSPLPVPPSK	529	sp|Q13247|SRSF6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=1881	27.079686666666664	3	2130.9988	2130.9897	R	A	295	312
PSM	QPESSPGGGSGGGGGSSPGEADTGRR	530	sp|P19622|HME2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	17-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=4738	52.594244999999994	3	2460.9312	2459.9332	R	R	20	46
PSM	GSTEGSESYEEDPYLVVNPNYLLED	531	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=5585	64.84271166666667	3	2932.2762	2932.2632	K	-	797	822
PSM	FNSESESGSEASSPDYFGPPAK	532	sp|Q9BW71|HIRP3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510,3-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=3376	38.87204833333333	3	2437.0732	2437.0632	R	N	96	118
PSM	EAIEGTYIDK	533	sp|P62280|RS11_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=2150	29.08926333333333	2	1285.6527	1285.6474	K	K	49	59
PSM	SQTPSPSTLNIDHMEQK	534	sp|Q6GYQ0|RGPA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=2688	33.225136666666664	3	2060.0010	2059.9917	R	D	1000	1017
PSM	HGSESRSRDHR	535	sp|Q86U06|RBM23_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:510	ms_run[1]:scan=2609	32.62789	2	1356.689531	1356.681924	R	R	109	120
PSM	TDMDNQIVVSDYAQMDR	536	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:510,3-UNIMOD:35,10-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=2361	30.729011666666665	3	2145.889974	2145.880819	K	V	258	275