MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100723_020CDK6-CyclinD1.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100723_020CDK6-CyclinD1.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	228-UNIMOD:510	0.09	43.0	3	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	203-UNIMOD:510,221-UNIMOD:510,270-UNIMOD:510,272-UNIMOD:21,280-UNIMOD:21,281-UNIMOD:510	0.08	39.0	2	2	2
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	230-UNIMOD:510,232-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	16-UNIMOD:510,35-UNIMOD:21,47-UNIMOD:4,48-UNIMOD:510	0.05	37.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	264-UNIMOD:510,271-UNIMOD:21,264-UNIMOD:21	0.04	37.0	2	1	0
PRT	sp|Q00534|CDK6_HUMAN	Cyclin-dependent kinase 6 OS=Homo sapiens OX=9606 GN=CDK6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	308-UNIMOD:510,312-UNIMOD:21,325-UNIMOD:21,317-UNIMOD:21,9-UNIMOD:510,15-UNIMOD:4,24-UNIMOD:21,26-UNIMOD:510,47-UNIMOD:510,57-UNIMOD:21,321-UNIMOD:21,320-UNIMOD:21,265-UNIMOD:510,267-UNIMOD:21,274-UNIMOD:510,49-UNIMOD:21	0.20	37.0	23	4	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	180-UNIMOD:510,186-UNIMOD:21,182-UNIMOD:21,183-UNIMOD:21	0.02	36.0	4	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	239-UNIMOD:510,360-UNIMOD:510,216-UNIMOD:510,217-UNIMOD:4,235-UNIMOD:21,238-UNIMOD:510	0.14	36.0	3	3	3
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	null	108-UNIMOD:510,113-UNIMOD:21	0.10	34.0	1	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	33.0	1	1	0
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	606-UNIMOD:510,612-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	207-UNIMOD:510,86-UNIMOD:510,91-UNIMOD:510,102-UNIMOD:21	0.26	33.0	2	2	2
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	null	463-UNIMOD:510,473-UNIMOD:21,482-UNIMOD:510	0.01	32.0	1	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	32.0	1	1	0
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	463-UNIMOD:510,475-UNIMOD:21,482-UNIMOD:510	0.01	31.0	1	1	0
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	257-UNIMOD:510,267-UNIMOD:21,280-UNIMOD:510	0.06	31.0	1	1	1
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	608-UNIMOD:510,621-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	228-UNIMOD:510	0.08	30.0	1	1	1
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	75-UNIMOD:510,84-UNIMOD:35,80-UNIMOD:21	0.13	30.0	2	1	0
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	418-UNIMOD:510,435-UNIMOD:21,441-UNIMOD:510,420-UNIMOD:35	0.05	30.0	2	1	0
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	30.0	2	1	0
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,466-UNIMOD:35,446-UNIMOD:510	0.03	30.0	2	2	2
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	43-UNIMOD:510,57-UNIMOD:510	0.06	29.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	29.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	4-UNIMOD:510,14-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	69-UNIMOD:510,74-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4	0.20	28.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	539-UNIMOD:510,550-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,292-UNIMOD:510,306-UNIMOD:510,379-UNIMOD:510,187-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510	0.11	28.0	6	6	6
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	466-UNIMOD:510,475-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:510,9-UNIMOD:21	0.13	27.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	86-UNIMOD:510,87-UNIMOD:21,86-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	null	424-UNIMOD:510,443-UNIMOD:21,447-UNIMOD:510,426-UNIMOD:35	0.05	27.0	2	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	26.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	469-UNIMOD:510,502-UNIMOD:510	0.07	26.0	1	1	1
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	74-UNIMOD:510,76-UNIMOD:21,80-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	223-UNIMOD:510	0.09	25.0	1	1	1
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	97-UNIMOD:510,113-UNIMOD:21	0.03	25.0	1	1	0
PRT	sp|Q86TC9-2|MYPN_HUMAN	Isoform 2 of Myopalladin OS=Homo sapiens OX=9606 GN=MYPN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	648-UNIMOD:510,653-UNIMOD:21,666-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	114-UNIMOD:510	0.13	25.0	1	1	1
PRT	sp|Q86YP4|P66A_HUMAN	Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	97-UNIMOD:510,114-UNIMOD:21	0.03	25.0	1	1	0
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	44-UNIMOD:510,54-UNIMOD:21,8-UNIMOD:510	0.17	24.0	2	2	2
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	221-UNIMOD:510,160-UNIMOD:510,163-UNIMOD:21	0.06	24.0	2	2	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	28-UNIMOD:510,28-UNIMOD:21,223-UNIMOD:510	0.16	24.0	2	2	2
PRT	sp|Q9NWW6-2|NRK1_HUMAN	Isoform 2 of Nicotinamide riboside kinase 1 OS=Homo sapiens OX=9606 GN=NMRK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	3-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:21,18-UNIMOD:21	0.11	24.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510,67-UNIMOD:21,222-UNIMOD:510,225-UNIMOD:21,233-UNIMOD:510	0.05	24.0	3	2	1
PRT	sp|Q9C0C2-2|TB182_HUMAN	Isoform 2 of 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	550-UNIMOD:510,554-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	20-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	282-UNIMOD:510,290-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	8-UNIMOD:510,23-UNIMOD:510,320-UNIMOD:510,323-UNIMOD:21,329-UNIMOD:510	0.08	23.0	2	2	2
PRT	sp|Q9H910-2|JUPI2_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	75-UNIMOD:510,81-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	45-UNIMOD:510,57-UNIMOD:21,62-UNIMOD:21,63-UNIMOD:35,65-UNIMOD:510	0.08	23.0	1	1	0
PRT	sp|P24385|CCND1_HUMAN	G1/S-specific cyclin-D1 OS=Homo sapiens OX=9606 GN=CCND1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	270-UNIMOD:510,285-UNIMOD:4,288-UNIMOD:21	0.09	22.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	701-UNIMOD:510,722-UNIMOD:21,724-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	82-UNIMOD:510	0.09	22.0	1	1	1
PRT	sp|P26358-3|DNMT1_HUMAN	Isoform 3 of DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	362-UNIMOD:510,378-UNIMOD:21,380-UNIMOD:510,381-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	871-UNIMOD:510,885-UNIMOD:21,886-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:510,7-UNIMOD:21	0.21	22.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510	0.08	22.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	172-UNIMOD:510,180-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	223-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	204-UNIMOD:510,222-UNIMOD:510,121-UNIMOD:510,131-UNIMOD:510	0.14	21.0	2	2	2
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	74-UNIMOD:510	0.11	21.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	14-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	120-UNIMOD:510,138-UNIMOD:21,145-UNIMOD:510	0.11	21.0	1	1	1
PRT	sp|Q15021|CND1_HUMAN	Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1325-UNIMOD:510,1339-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	26-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	9-UNIMOD:510,16-UNIMOD:21,27-UNIMOD:510,31-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	96-UNIMOD:510	0.09	20.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	1153-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	80-UNIMOD:510,82-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	62-UNIMOD:510,76-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	846-UNIMOD:510,848-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	20.0	null	87-UNIMOD:510,98-UNIMOD:21,104-UNIMOD:21,105-UNIMOD:35,107-UNIMOD:510,103-UNIMOD:21	0.07	20.0	2	1	0
PRT	sp|P22492|H1T_HUMAN	Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	69-UNIMOD:510,79-UNIMOD:510	0.06	19.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	55-UNIMOD:510,70-UNIMOD:21,73-UNIMOD:510,33-UNIMOD:510,65-UNIMOD:35	0.13	19.0	3	2	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	85-UNIMOD:510,91-UNIMOD:4,97-UNIMOD:510	0.06	19.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510,595-UNIMOD:21,598-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	142-UNIMOD:510,176-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	235-UNIMOD:510,244-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q15052-2|ARHG6_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	333-UNIMOD:510,334-UNIMOD:21,341-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|Q9BTL3|RAMAC_HUMAN	RNA guanine-N7 methyltransferase activating subunit OS=Homo sapiens OX=9606 GN=RAMAC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	32-UNIMOD:510,36-UNIMOD:21	0.14	19.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	154-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	58-UNIMOD:510,65-UNIMOD:21	0.09	19.0	1	1	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	19.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21,272-UNIMOD:21	0.04	19.0	2	1	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	830-UNIMOD:510	0.01	18.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	30-UNIMOD:510,45-UNIMOD:21,47-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	189-UNIMOD:510,202-UNIMOD:21,206-UNIMOD:510	0.04	18.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	18.0	1	1	1
PRT	sp|Q08AD1-2|CAMP2_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1284-UNIMOD:510,1292-UNIMOD:21	0.01	18.0	1	1	0
PRT	sp|P24941|CDK2_HUMAN	Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	158-UNIMOD:510,158-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	98-UNIMOD:510,107-UNIMOD:510	0.04	18.0	1	1	1
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	80-UNIMOD:35,81-UNIMOD:21,82-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	null	1311-UNIMOD:510,1321-UNIMOD:21	0.01	18.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=4181	48.255	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:510	ms_run[1]:scan=4076	47.25794	2	2226.9306	2226.9356	R	-	228	248
PSM	DATNVGDEGGFAPNILENK	3	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3909	45.369	2	2028.0436	2028.0436	K	E	203	222
PSM	SSSPAPADIAQTVQEDLR	4	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4520	52.306	2	1997.9519	1997.9519	K	T	230	248
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	5	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,20-UNIMOD:21,32-UNIMOD:4,33-UNIMOD:510	ms_run[2]:scan=3484	40.921	3	3881.5895	3881.5895	R	G	16	49
PSM	TPEELDDSDFETEDFDVR	6	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4259	49.048	2	2271.9157	2271.9157	R	S	264	282
PSM	ENLDSHLPPSQNTSELNTA	7	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3080	36.975685	2	2179.9784	2179.9842	K	-	308	327
PSM	INSSGESGDESDEFLQSR	8	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2851	35.004	2	2069.8639	2069.8639	R	K	180	198
PSM	SYELPDGQVITIGNER	9	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=4188	48.316	2	1823.9478	1823.9478	K	F	239	255
PSM	ENLDSHLPPSQNTSELNTA	10	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=2715	33.804718333333334	2	2179.9774	2179.9842	K	-	308	327
PSM	ENLDSHLPPSQNTSELNTA	11	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=2599	32.779705	2	2179.977852	2179.984690	K	-	308	327
PSM	ENLDSHLPPSQNTSELNTA	12	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3080	36.976	2	2179.9847	2179.9847	K	-	308	327
PSM	DWEDDSDEDMSNFDR	13	sp|Q15185|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=3795	43.99614833333333	2	1989.6832	1988.6822	K	F	108	123
PSM	ADQQYECVAEIGEGAYGK	14	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,7-UNIMOD:4,16-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3187	37.983	2	2134.9555	2134.9555	R	V	9	27
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	15	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=2905	35.436	3	3112.2782	3112.2782	K	L	595	622
PSM	DSSTSPGDYVLSVSENSR	16	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3964	45.954	2	2012.8788	2012.8788	R	V	39	57
PSM	NSDVLQSPLDSAARDEL	17	sp|Q8NBJ5|GT251_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4128	47.737	2	1942.9097	1942.9097	K	-	606	623
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	18	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4116	47.611	3	3490.5054	3490.5054	R	-	207	238
PSM	ENLDSHLPPSQNTSELNTA	19	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3189	38	2	2179.9847	2179.9847	K	-	308	327
PSM	ENLDSHLPPSQNTSELNTA	20	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=3335	39.499	2	2259.951	2259.9510	K	-	308	327
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	21	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=3768	43.691	3	3461.4719	3461.4719	K	F	86	114
PSM	AGEEDEGEEDSDSDYEISAK	22	sp|A2RRP1|NBAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=2122	28.719109999999997	2	2321.9102	2321.9212	R	A	463	483
PSM	DSSTSPGDYVLSVSENSR	23	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3964	45.954005	2	2012.8748	2012.8783	R	V	39	57
PSM	AGEEDEGEEDSDSDYEISAK	24	sp|A2RRP1-2|NBAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2122	28.719	2	2321.9221	2321.9221	R	A	463	483
PSM	ENLDSHLPPSQNTSELNTA	25	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=2832	34.841	2	2179.9847	2179.9847	K	-	308	327
PSM	RSLAALDALNTDDENDEEEYEAWK	26	sp|P55081|MFAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=4233	48.793	3	2944.3288	2944.3288	K	V	257	281
PSM	TQPDGTSVPGEPASPISQR	27	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2249	29.803	2	2036.9628	2036.9628	R	L	608	627
PSM	DNLTLWTSDQQDEEAGEGN	28	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=4150	47.928	2	2154.9402	2154.9402	R	-	228	247
PSM	DWEDDSDEDMSNFDR	29	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2694	33.604	2	1924.7117	1924.7117	K	F	75	90
PSM	ENLDSHLPPSQNTSELNTA	30	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=3236	38.485	2	2259.951	2259.9510	K	-	308	327
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	31	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2318	30.369	3	2810.1902	2810.1902	R	E	418	442
PSM	KEESEESDDDMGFGLFD	32	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=3837	44.504	2	2032.8732	2032.8732	K	-	73	90
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	33	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=1603	24.606	3	2863.2161	2863.2161	K	M	445	470
PSM	DLADELALVDVIEDK	34	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=5493	68.123	2	1724.972	1724.9720	K	L	43	58
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	35	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4330	49.92	3	2995.386	2995.3860	R	G	2913	2938
PSM	NQYDNDVTVWSPQGR	36	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3176	37.89	2	1891.8314	1891.8314	R	I	4	19
PSM	AFGESSTESDEEEEEGCGHTHCVR	37	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=1342	22.556	3	2852.0751	2852.0751	R	G	69	93
PSM	EGLELPEDEEEK	38	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2533	32.211	2	1483.7566	1483.7566	K	K	539	551
PSM	ELISNASDALDK	39	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2454	31.486	2	1342.7616	1342.7616	R	I	42	54
PSM	AEEDEILNRSPR	40	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1614	24.695	2	1541.7299	1541.7299	K	N	466	478
PSM	DNLTLWTSDQQDDDGGEGNN	41	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4213	48.542	3	2226.9361	2226.9361	R	-	228	248
PSM	GVQVETISPGDGR	42	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2008	27.799	2	1427.687	1427.6870	M	T	2	15
PSM	KEESEESDDDMGFGLFD	43	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4448	51.39	2	2016.8783	2016.8783	K	-	73	90
PSM	TTPSVVAFTADGER	44	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3453	40.675623333333334	2	1563.7370	1563.7389	R	L	86	100
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	45	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,20-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=2318	30.369015	3	2810.183230	2810.190250	R	E	424	448
PSM	AFLAELEQNSPK	46	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3623	42.243	2	1493.7803	1493.7803	K	I	2424	2436
PSM	DWEDDSDEDMSNFDR	47	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=2999	36.238	2	2004.6781	2004.6781	K	F	75	90
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	48	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,34-UNIMOD:510	ms_run[2]:scan=4349	50.107	4	3824.5651	3824.5651	K	A	469	503
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	49	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=1897	26.912	3	2826.1852	2826.1852	R	E	418	442
PSM	NPDDITQEEYGEFYK	50	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3463	40.757	2	1914.916	1914.9160	R	S	292	307
PSM	TQSPGGCSAEAVLAR	51	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2300	30.21	2	1616.7442	1616.7442	R	K	74	89
PSM	VQTGEEGMPLSTIR	52	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3104	37.168	2	1630.785	1630.7850	R	E	47	61
PSM	ENLDSHLPPSQNTSELNTA	53	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=2964	35.96581	2	2179.9775	2179.9842	K	-	308	327
PSM	ENLDSHLPPSQNTSELNTA	54	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=2715	33.804718333333334	2	2179.977852	2179.984690	K	-	308	327
PSM	DNLTLWTSENQGDEGDAGEGEN	55	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=4070	47.208	3	2384.01	2384.0100	R	-	223	245
PSM	ENLDSHLPPSQNTSELNTA	56	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,14-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=3007	36.3	2	2259.951	2259.9510	K	-	308	327
PSM	RPPSPDVIVLSDNEQPSSPR	57	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=2932	35.717	3	2303.1371	2303.1371	R	V	97	117
PSM	TPVDESDDEIQHDEIPTGK	58	sp|Q86TC9-2|MYPN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2428	31.224	3	2272.0421	2272.0421	R	C	648	667
PSM	YFQINQDEEEEEDED	59	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=2893	35.33	2	1964.786	1964.7860	R	-	114	129
PSM	ENLDSHLPPSQNTSELNTA	60	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=3335	39.498931666666664	2	2259.944001	2259.951021	K	-	308	327
PSM	ENLDSHLPPSQNTSELNTA	61	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=3236	38.485234999999996	2	2259.9435	2259.9505	K	-	308	327
PSM	RPPSPDVIVLSDNEQPSSPR	62	sp|Q86YP4|P66A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=2932	35.71661666666667	3	2303.1336	2303.1366	R	V	97	117
PSM	ELAPYDENWFYTR	63	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=4569	52.991	2	1816.7922	1816.7922	K	A	44	57
PSM	ENLDSHLPPSQNTSELNTA	64	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2964	35.966	2	2179.9847	2179.9847	K	-	308	327
PSM	STAGDTHLGGEDFDNR	65	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1482	23.667	2	1724.7814	1724.7814	K	M	221	237
PSM	SVTEQGAELSNEER	66	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1694	25.322	2	1661.7358	1661.7358	K	N	28	42
PSM	TFIIGISGVTNSGKTTLAK	67	sp|Q9NWW6-2|NRK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:21,7-UNIMOD:21,15-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=4076	47.258	2	2226.9381	2226.9381	K	N	3	22
PSM	TTPSVVAFTADGER	68	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3453	40.676	2	1563.7394	1563.7394	R	L	86	100
PSM	TVIIEQSWGSPK	69	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3424	40.374	2	1491.8011	1491.8011	R	V	61	73
PSM	EAAFSPGQQDWSR	70	sp|Q9C0C2-2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3017	36.376	2	1591.6881	1591.6881	R	D	550	563
PSM	EVYELLDSPGK	71	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3375	39.901	2	1396.7163	1396.7163	K	V	20	31
PSM	FVTDIDELGK	72	sp|Q00534|CDK6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3653	42.51	2	1283.6687	1283.6687	K	D	265	275
PSM	GWLRDPSASPGDAGEQAIR	73	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2929	35.692	3	2095.99	2095.9900	K	Q	282	301
PSM	LIAPVAEEEATVPNNK	74	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2623	32.967	2	1762.0149	1762.0149	K	I	8	24
PSM	QEYDESGPSIVHR	75	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1381	22.853	3	1549.7585	1549.7585	K	K	360	373
PSM	TSDIFGSPVTATSR	76	sp|Q9H910-2|JUPI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3212	38.242	2	1551.7394	1551.7394	K	L	75	89
PSM	WGDAGAEYVVESTGVFTTMEK	77	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,13-UNIMOD:21,18-UNIMOD:21,19-UNIMOD:35,21-UNIMOD:510	ms_run[2]:scan=4531	52.497	3	2520.0845	2520.0845	K	A	45	66
PSM	TVIIEQSWGSPK	78	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=3424	40.37361833333333	2	1491.799784	1491.801081	R	V	61	73
PSM	AAEEEEEEEEEVDLACTPTDVRDVDI	79	sp|P24385|CCND1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,16-UNIMOD:4,19-UNIMOD:21	ms_run[2]:scan=4248	48.958	3	3105.2957	3105.2957	K	-	270	296
PSM	ADQQYECVAEIGEGAYGK	80	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:4,16-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3178	37.907	3	2134.9555	2134.9555	R	V	9	27
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	81	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,22-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=4056	47.065	3	2949.2212	2949.2212	K	T	701	725
PSM	DQGTYEDYVEGLR	82	sp|P60660-2|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3743	43.401	2	1577.7422	1577.7422	K	V	82	95
PSM	EADDDEEVDDNIPEMPSPKK	83	sp|P26358-3|DNMT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,17-UNIMOD:21,19-UNIMOD:510,20-UNIMOD:510	ms_run[2]:scan=3008	36.308	3	2454.1246	2454.1246	K	M	362	382
PSM	ENLDSHLPPSQNTSELNTA	84	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3339	39.533	2	2179.9847	2179.9847	K	-	308	327
PSM	ENLDSHLPPSQNTSELNTA	85	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=3435	40.515	2	2259.951	2259.9510	K	-	308	327
PSM	EYIPGQPPLSQSSDSSPTR	86	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=2956	35.902	2	2158.9996	2158.9996	K	N	871	890
PSM	GHQQLYWSHPR	87	sp|P62273|RS29_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1352	22.632	3	1521.7091	1521.7091	M	K	2	13
PSM	HELQANCYEEVK	88	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1222	21.6	2	1586.8035	1586.8035	K	D	133	145
PSM	NVIGLQMGTNR	89	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3062	36.818	2	1315.6532	1315.6532	K	G	172	183
PSM	VQTGEEGMPLSTIR	90	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3548	41.587	2	1710.7513	1710.7513	R	E	47	61
PSM	ENLDSHLPPSQNTSELNTA	91	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=3007	36.300290000000004	2	2259.9428	2259.9505	K	-	308	327
PSM	EYIPGQPPLSQSSDSSPTR	92	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=2956	35.901898333333335	2	2158.9908	2158.9991	K	N	871	890
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	93	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,3-UNIMOD:35,20-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=1897	26.91201	3	2826.174941	2826.185165	R	E	424	448
PSM	ATAGDTHLGGEDFDNR	94	sp|P48741|HSP77_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1512	23.896	3	1708.7865	1708.7865	K	L	223	239
PSM	DNLTLWTSDMQGDGEEQNK	95	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4009	46.567	3	2248.059	2248.0590	R	E	204	223
PSM	DVIELTDDSFDK	96	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3928	45.591	2	1463.7668	1463.7668	K	N	158	170
PSM	EGMNIVEAMER	97	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3524	41.363	2	1311.6375	1311.6375	K	F	74	85
PSM	IQALQQQADEAEDR	98	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1681	25.22	2	1647.8276	1647.8276	K	A	14	28
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	99	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,19-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3593	41.984	3	3090.3451	3090.3451	K	E	120	146
PSM	LCYVALDFEQEMATAASSSSLEK	100	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:4,20-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=5223	63.159	3	2697.2591	2697.2591	K	S	216	239
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	101	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2487	31.77	3	2685.0632	2685.0632	K	M	446	470
PSM	SADTLWDIQK	102	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3739	43.371	2	1323.6748	1323.6748	K	D	320	330
PSM	YISPDQLADLYK	103	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4289	49.452	2	1652.7776	1652.7776	R	S	270	282
PSM	YQPLASTASDNDFVTPEPR	104	sp|Q15021|CND1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3371	39.854	3	2221.0153	2221.0153	R	R	1325	1344
PSM	GVVDSEDLPLNISR	105	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=3594	41.991978333333336	2	1546.8400	1546.8410	R	E	379	393
PSM	VEIIANDQGNR	106	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=1380	22.846465	2	1261.6823	1261.6834	K	T	26	37
PSM	APVQPQQSPAAAPGGTDEKPSGK	107	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,19-UNIMOD:510,23-UNIMOD:510	ms_run[2]:scan=1020	19.973	3	2399.2583	2399.2583	K	E	9	32
PSM	DGNGYISAAELR	108	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2817	34.723	2	1298.6679	1298.6679	K	H	96	108
PSM	EAAENSLVAYK	109	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1832	26.405	2	1261.7191	1261.7191	K	A	121	132
PSM	EDQTEYLEER	110	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1686	25.259	2	1344.6258	1344.6258	K	R	187	197
PSM	GYISPYFINTSK	111	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4033	46.79	2	1536.7902	1536.7902	R	G	222	234
PSM	IAQLEEELEEEQGNTELINDR	112	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4073	47.233	3	2505.2295	2505.2295	R	L	1153	1174
PSM	QLSSGVSEIR	113	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1959	27.414	2	1188.5964	1188.5964	R	H	80	90
PSM	RADLNQGIGEPQSPSR	114	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=1410	23.092	2	1837.8896	1837.8896	R	R	62	78
PSM	SIYYITGESK	115	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2445	31.399	2	1227.7023	1227.7023	K	E	482	492
PSM	SGTPPRQGSITSPQANEQSVTPQR	116	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1595	24.546321666666667	3	2636.2689	2636.2763	K	R	846	870
PSM	WGDAGAEYVVESTGVFTTMEK	117	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,12-UNIMOD:21,18-UNIMOD:21,19-UNIMOD:35,21-UNIMOD:510	ms_run[1]:scan=4531	52.497125	3	2520.0817	2520.0840	K	A	87	108
PSM	ALAAAGYDVEK	118	sp|P22492|H1T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1818	26.296	2	1174.687	1174.6870	K	N	69	80
PSM	DAGTIAGLNVLR	119	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4337	50.007	2	1312.6964	1312.6964	K	I	160	172
PSM	DELHIVEAEAMNYEGSPIK	120	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,16-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=4584	53.212	3	2292.1021	2292.1022	K	V	55	74
PSM	DINAYNCEEPTEK	121	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1855	26.58	2	1649.7879	1649.7879	K	L	85	98
PSM	DNLTLWTSDTQGDEAEAGEGGEN	122	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=4236	48.832	3	2442.0519	2442.0519	R	-	223	246
PSM	ETVSEESNVLCLSKSPNK	123	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510,15-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2803	34.617	3	2202.134	2202.1340	R	H	581	599
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	124	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,35-UNIMOD:510	ms_run[2]:scan=2706	33.7	4	4220.6251	4220.6251	K	A	142	177
PSM	LDQPVSAPPSPR	125	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1708	25.447	2	1376.6913	1376.6913	K	D	235	247
PSM	MSGFIYQGK	126	sp|Q15052-2|ARHG6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3122	37.31	2	1177.5879	1177.5879	R	I	333	342
PSM	RPPESPPIVEEWNSR	127	sp|Q9BTL3|RAMAC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3087	37.032	3	1905.9198	1905.9198	K	A	32	47
PSM	TNQELQEINR	128	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1259	21.89	2	1277.6788	1277.6788	R	V	154	164
PSM	TPEELDDSDFETEDFDVR	129	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4254	49.008	3	2271.9157	2271.9157	R	S	264	282
PSM	VDNDENEHQLSLR	130	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1286	22.105	3	1601.7858	1601.7858	K	T	33	46
PSM	VQTGEEGMPLSTIR	131	sp|Q00534|CDK6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2891	35.314	2	1630.785	1630.7850	R	E	47	61
PSM	INPDGSQSVVEVPYAR	132	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=3284	38.96399166666667	2	1843.8888	1843.8924	R	S	58	74
PSM	QENCGAQQVPAGPGTSTPPSSPVR	133	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=2117	28.678018333333334	3	2535.1573	2535.1632	R	T	257	281
PSM	QENCGAQQVPAGPGTSTPPSSPVR	134	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,4-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=2117	28.678018333333334	3	2535.157857	2535.163734	R	T	257	281
PSM	AENYDIPSADR	135	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=1653	24.995	2	1283.6206	1283.6206	R	H	830	841
PSM	AVFVDLEPTVIDEVRTGTYR	136	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,16-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=4782	56.317	3	2473.1755	2473.1755	R	Q	30	50
PSM	DELHIVEAEAMNYEGSPIK	137	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:35,16-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=4310	49.687	3	2308.0971	2308.0971	K	V	55	74
PSM	DVNQQEFVR	138	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=1820	26.31	2	1167.6097	1167.6097	K	A	8	17
PSM	GADFLVTEVENGGSLGSK	139	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,14-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4301	49.57	3	1926.9612	1926.9612	K	K	189	207
PSM	GPLQSVQVFGR	140	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3509	41.182	2	1300.6753	1300.6753	K	K	5	16
PSM	INSSGESGDESDEFLQSR	141	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2835	34.864	3	2069.8639	2069.8639	R	K	180	198
PSM	SESVEGFLSPSR	142	sp|Q08AD1-2|CAMP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3372	39.862	2	1407.6495	1407.6495	R	C	1284	1296
PSM	TYTHEVVTLWYR	143	sp|P24941|CDK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3789	43.933	3	1680.8125	1680.8125	R	A	158	170
PSM	VEVTEFEDIK	144	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3283	38.957	2	1275.7235	1275.7235	R	S	98	108
PSM	AVIPMSCITNGSGANRK	145	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	5-UNIMOD:35,6-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=4493	51.92548833333333	2	1870.8471	1870.8425	R	P	76	93
PSM	INSSGESGDESDEFLQSR	146	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=2835	34.86375	3	2069.8607	2069.8634	R	K	180	198
PSM	SESVEGFLSPSR	147	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=3372	39.86198833333333	2	1407.649018	1407.649543	R	C	1311	1323
PSM	INSSGESGDESDEFLQSR	148	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=2835	34.86375	3	2069.861246	2069.863906	R	K	180	198
PSM	WGDAGAEYVVESTGVFTTMEK	149	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,12-UNIMOD:21,17-UNIMOD:21,19-UNIMOD:35,21-UNIMOD:510	ms_run[1]:scan=4531	52.497125	3	2520.082185	2520.084526	K	A	87	108