MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100715_017WNK3.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100715_017WNK3.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	46.0	null	228-UNIMOD:510,29-UNIMOD:510,31-UNIMOD:21	0.15	46.0	3	2	1
PRT	sp|Q9BYP7-3|WNK3_HUMAN	Isoform 3 of Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	413-UNIMOD:510,421-UNIMOD:4,425-UNIMOD:21,424-UNIMOD:21,422-UNIMOD:21,41-UNIMOD:510,42-UNIMOD:510,44-UNIMOD:21,49-UNIMOD:21,43-UNIMOD:510,47-UNIMOD:21,52-UNIMOD:21	0.02	43.0	7	3	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	39-UNIMOD:510,42-UNIMOD:21	0.09	39.0	1	1	0
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	43-UNIMOD:510,57-UNIMOD:510	0.05	38.0	1	1	1
PRT	sp|Q15185-4|TEBP_HUMAN	Isoform 4 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	108-UNIMOD:510,117-UNIMOD:35	0.12	38.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	203-UNIMOD:510,221-UNIMOD:510,33-UNIMOD:510,37-UNIMOD:21,41-UNIMOD:21,40-UNIMOD:21,16-UNIMOD:510,19-UNIMOD:21,26-UNIMOD:21,28-UNIMOD:510,27-UNIMOD:21	0.12	37.0	5	3	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	180-UNIMOD:510,182-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	373-UNIMOD:510,375-UNIMOD:510,377-UNIMOD:21	0.06	36.0	1	1	0
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q9BYP7|WNK3_HUMAN	Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	36.0	null	413-UNIMOD:510,421-UNIMOD:4,422-UNIMOD:21,424-UNIMOD:21	0.01	36.0	1	1	0
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	98-UNIMOD:510,105-UNIMOD:21,108-UNIMOD:4	0.13	35.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	189-UNIMOD:510,202-UNIMOD:21,205-UNIMOD:21,206-UNIMOD:510	0.04	35.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	35.0	1	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	2207-UNIMOD:510,2215-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	null	388-UNIMOD:510,388-UNIMOD:21,390-UNIMOD:510	0.05	33.0	1	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,88-UNIMOD:510,90-UNIMOD:21,98-UNIMOD:35,99-UNIMOD:21,100-UNIMOD:510,387-UNIMOD:510,391-UNIMOD:21,547-UNIMOD:510,558-UNIMOD:510,47-UNIMOD:510,52-UNIMOD:21,58-UNIMOD:510,192-UNIMOD:510,535-UNIMOD:510,539-UNIMOD:510,540-UNIMOD:21,543-UNIMOD:21,546-UNIMOD:510	0.13	32.0	10	7	5
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	82-UNIMOD:510,86-UNIMOD:21,91-UNIMOD:21,96-UNIMOD:510,354-UNIMOD:510,365-UNIMOD:21,61-UNIMOD:510,64-UNIMOD:21,65-UNIMOD:21	0.07	32.0	4	3	2
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	322-UNIMOD:510,325-UNIMOD:21,328-UNIMOD:4,334-UNIMOD:510	0.03	32.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510	0.04	32.0	2	1	0
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	135-UNIMOD:510,142-UNIMOD:21,149-UNIMOD:510	0.10	31.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	58-UNIMOD:510,65-UNIMOD:21,112-UNIMOD:510,115-UNIMOD:21	0.17	31.0	2	2	2
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	221-UNIMOD:510,37-UNIMOD:510,45-UNIMOD:21,57-UNIMOD:510,61-UNIMOD:35,64-UNIMOD:21,66-UNIMOD:21,71-UNIMOD:510	0.07	31.0	3	3	3
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	31.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	325-UNIMOD:510,336-UNIMOD:510,330-UNIMOD:35	0.03	30.0	2	1	0
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	30.0	1	1	1
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	392-UNIMOD:510,396-UNIMOD:21	0.03	30.0	1	1	0
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	138-UNIMOD:510,143-UNIMOD:21,150-UNIMOD:510	0.05	30.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	239-UNIMOD:510,249-UNIMOD:21	0.05	30.0	2	1	0
PRT	sp|Q9Y4E1-5|WAC2C_HUMAN	Isoform 5 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	452-UNIMOD:510,454-UNIMOD:21,468-UNIMOD:510	0.01	30.0	1	1	1
PRT	sp|P30622-2|CLIP1_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	381-UNIMOD:510,383-UNIMOD:21,376-UNIMOD:510,380-UNIMOD:510,382-UNIMOD:21	0.02	29.0	2	2	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	204-UNIMOD:510,206-UNIMOD:21,210-UNIMOD:35,215-UNIMOD:35,211-UNIMOD:21	0.07	29.0	2	1	0
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	99-UNIMOD:510,109-UNIMOD:35,105-UNIMOD:21	0.16	29.0	2	1	0
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	328-UNIMOD:510,330-UNIMOD:21,340-UNIMOD:510	0.03	29.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	292-UNIMOD:510,306-UNIMOD:510,42-UNIMOD:510,48-UNIMOD:21,53-UNIMOD:510,45-UNIMOD:21,492-UNIMOD:510	0.06	29.0	4	3	2
PRT	sp|P35241-2|RADI_HUMAN	Isoform 2 of Radixin OS=Homo sapiens OX=9606 GN=RDX	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	180-UNIMOD:510,185-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	28-UNIMOD:510	0.06	29.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	81-UNIMOD:510,83-UNIMOD:21,86-UNIMOD:21,93-UNIMOD:510,91-UNIMOD:35	0.09	29.0	2	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	28.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	8-UNIMOD:510,23-UNIMOD:510	0.05	28.0	1	1	1
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	43-UNIMOD:510,45-UNIMOD:21,56-UNIMOD:510	0.13	28.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	43-UNIMOD:510,50-UNIMOD:21,51-UNIMOD:21,55-UNIMOD:510	0.03	27.0	1	1	1
PRT	sp|P26373-2|RL13_HUMAN	Isoform 2 of 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	99-UNIMOD:510,101-UNIMOD:21,104-UNIMOD:21,108-UNIMOD:35	0.09	27.0	2	1	0
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	109-UNIMOD:510,111-UNIMOD:21,116-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|P30622|CLIP1_HUMAN	CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	381-UNIMOD:510,382-UNIMOD:21	0.01	27.0	1	1	0
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	392-UNIMOD:510,395-UNIMOD:21	0.03	27.0	1	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	578-UNIMOD:510,580-UNIMOD:21,589-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	139-UNIMOD:510,146-UNIMOD:21	0.10	26.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	65-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,72-UNIMOD:21,77-UNIMOD:510	0.09	26.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:21,121-UNIMOD:510,86-UNIMOD:510,89-UNIMOD:21,94-UNIMOD:21,207-UNIMOD:510,212-UNIMOD:21	0.06	26.0	3	3	3
PRT	sp|Q14847-3|LASP1_HUMAN	Isoform 3 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	41-UNIMOD:510,43-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:510,7-UNIMOD:21	0.13	25.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	205-UNIMOD:510,209-UNIMOD:21	0.10	25.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	221-UNIMOD:510,223-UNIMOD:21,231-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	300-UNIMOD:510,308-UNIMOD:21,309-UNIMOD:510,310-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	698-UNIMOD:510,702-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	72-UNIMOD:510,73-UNIMOD:21	0.07	24.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:510	ms_run[2]:scan=4455	49.88	2	2226.9361	2226.9361	R	-	228	248
PSM	VELAEEDDCSNSSLALR	2	sp|Q9BYP7-3|WNK3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,9-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=3418	38.83	2	2020.8873	2020.8873	R	L	413	430
PSM	VELAEEDDCSNSSLALR	3	sp|Q9BYP7-3|WNK3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,9-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=3516	39.841	2	2020.8873	2020.8873	R	L	413	430
PSM	DNLTLWTSDQQDDDGGEGNN	4	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510	ms_run[2]:scan=4354	48.836	2	2226.9361	2226.9361	R	-	228	248
PSM	VELAEEDDCSNSSLALR	5	sp|Q9BYP7-3|WNK3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,9-UNIMOD:4,12-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=3787	42.606	2	2100.8536	2100.8536	R	L	413	430
PSM	VELAEEDDCSNSSLALR	6	sp|Q9BYP7-3|WNK3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,9-UNIMOD:4,10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3934	44.055	2	2100.8536	2100.8536	R	L	413	430
PSM	DSSTSPGDYVLSVSENSR	7	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4234	47.489	2	2012.8788	2012.8788	R	V	39	57
PSM	DLADELALVDVIEDK	8	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=5902	70.205	2	1724.972	1724.9720	K	L	43	58
PSM	DWEDDSDEDMSNFDR	9	sp|Q15185-4|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2996	35.059	2	1924.7117	1924.7117	K	F	108	123
PSM	DATNVGDEGGFAPNILENK	10	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4177	46.834	2	2028.0436	2028.0436	K	E	203	222
PSM	INSSGESGDESDEFLQSR	11	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3111	36.161	2	2069.8639	2069.8639	R	K	180	198
PSM	TDKSSASAPDVDDPEAFPALA	12	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,3-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4437	49.68	2	2251.057	2251.0570	R	-	373	394
PSM	TPEELDDSDFETEDFDVR	13	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4550	50.871	2	2271.9157	2271.9157	R	S	264	282
PSM	VELAEEDDCSNSSLALR	14	sp|Q9BYP7|WNK3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:510,9-UNIMOD:4,10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=3787	42.605918333333335	2	2100.850062	2100.853615	R	L	413	430
PSM	EILGTAQSVGCNVDGR	15	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=2951	34.701	2	1788.829	1788.8290	K	H	98	114
PSM	GADFLVTEVENGGSLGSK	16	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,14-UNIMOD:21,17-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4998	56.753	2	2006.9276	2006.9276	K	K	189	207
PSM	DSSTSPGDYVLSVSENSR	17	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4234	47.48878166666667	2	2012.8757	2012.8783	R	V	39	57
PSM	EDGLAQQQTQLNLR	18	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2920	34.427	2	1726.8463	1726.8463	K	S	2207	2221
PSM	TDKSSASAPDVDDPEAFPALA	19	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,1-UNIMOD:21,3-UNIMOD:510	ms_run[1]:scan=4437	49.67961	2	2251.0526	2251.0564	R	-	388	409
PSM	ESEDKPEIEDVGSDEEEEK	20	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=2042	27.287	3	2294.1022	2294.1022	K	K	251	270
PSM	NQLTSNPENTVFDAK	21	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3610	40.64	2	1904.8595	1904.8595	K	R	82	97
PSM	QVQSLTCEVDALK	22	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=4094	45.823	2	1637.8372	1637.8372	R	G	322	335
PSM	TLTIVDTGIGMTK	23	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:35,12-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4083	45.72879666666667	2	1592.7799	1592.7805	R	A	88	101
PSM	GVVDSEDLPLNISR	24	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=4283	48.03751833333334	2	1626.8070	1626.8073	R	E	387	401
PSM	GILAADESTGSIAK	25	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2742	32.937331666666665	2	1479.7838	1479.7853	K	R	29	43
PSM	AQAAAPASVPAQAPK	26	sp|P47914|RL29_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1566	23.64	2	1524.8338	1524.8338	K	R	135	150
PSM	INPDGSQSVVEVPYAR	27	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3552	40.158	2	1843.893	1843.8930	R	S	58	74
PSM	STAGDTHLGGEDFDNR	28	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=1733	24.913	2	1724.7814	1724.7814	K	M	221	237
PSM	TAFQEALDAAGDK	29	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3207	36.967	2	1403.7569	1403.7569	K	L	9	22
PSM	AAVPSGASTGIYEALELR	30	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=5453	63.602	2	1997.9325	1997.9325	R	D	33	51
PSM	EVDEQMLNVQNK	31	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2647	32.235	2	1513.8083	1513.8083	K	N	325	337
PSM	EVDEQMLNVQNK	32	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1720	24.818	2	1529.8032	1529.8032	K	N	325	337
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	33	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2150	28.202	3	2826.1852	2826.1852	R	E	418	442
PSM	GPPSSSDSEPEAELER	34	sp|Q7Z4V5-2|HDGR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2310	29.452	2	1799.7675	1799.7675	R	E	392	408
PSM	HVFGESDELIGQK	35	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3081	35.9	2	1605.8076	1605.8076	R	V	138	151
PSM	NQLTSNPENTVFDAK	36	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3003	35.126	2	1744.9268	1744.9268	K	R	82	97
PSM	SYELPDGQVITIGNER	37	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=4478	50.118	2	1823.9478	1823.9478	K	F	239	255
PSM	SYELPDGQVITIGNER	38	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=4966	56.34	2	1903.9141	1903.9141	K	F	239	255
PSM	VQSTADIFGDEEGDLFK	39	sp|Q9Y4E1-5|WAC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=5131	58.777	2	2017.9558	2017.9558	K	E	452	469
PSM	AAVPSGASTGIYEALELR	40	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=5453	63.60168	2	1997.9290	1997.9319	R	D	33	51
PSM	ATSHVGEIEQELALAR	41	sp|P30622-2|CLIP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4037	45.245	2	1836.9195	1836.9195	K	D	381	397
PSM	EKNSTFSASGETVER	42	sp|Q9BYP7-3|WNK3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=1789	25.334	2	1868.8231	1868.8231	K	K	41	56
PSM	GASQAGMTGYGMPR	43	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=1224	20.866	2	1528.6264	1528.6264	R	Q	204	218
PSM	GASQAGMTGYGMPR	44	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35,8-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=1348	21.901	2	1608.5927	1608.5927	R	Q	204	218
PSM	GNPTVEVDLFTSK	45	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4637	51.885	2	1633.7678	1633.7678	R	G	16	29
PSM	KEESEESDDDMGFGLFD	46	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4123	46.247	2	2032.8732	2032.8732	K	-	99	116
PSM	LAYINPDLALEEK	47	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4305	48.278	2	1635.8797	1635.8797	R	N	328	341
PSM	NPDDITQEEYGEFYK	48	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3748	42.216	2	1914.916	1914.9160	R	S	292	307
PSM	QLQALSSELAQAR	49	sp|P35241-2|RADI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3643	40.939	2	1527.787	1527.7870	K	D	180	193
PSM	SVTEQGAELSNEER	50	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=1579	23.737	2	1581.7695	1581.7695	K	N	28	42
PSM	TLTIVDTGIGMTK	51	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:35,12-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4207	47.149278333333335	2	1592.7801	1592.7805	R	A	88	101
PSM	AITGASLADIMAK	52	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4897	55.38733833333333	2	1488.7327	1488.7331	R	R	81	94
PSM	AFLAELEQNSPK	53	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3914	43.869	2	1493.7803	1493.7803	K	I	2424	2436
PSM	EGLELPEDEEEK	54	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2802	33.497	2	1483.7566	1483.7566	K	K	547	559
PSM	GILAADESTGSIAK	55	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=2383	30.051	2	1399.8195	1399.8195	K	R	29	43
PSM	LIAPVAEEEATVPNNK	56	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2887	34.182	2	1762.0149	1762.0149	K	I	8	24
PSM	SDIDEIVLVGGSTR	57	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4317	48.419	2	1573.7813	1573.7813	K	I	354	368
PSM	TLTTVQGIADDYDK	58	sp|P41567|EIF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3930	44.025	2	1686.839	1686.8390	K	K	43	57
PSM	GVVDSEDLPLNISR	59	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510	ms_run[1]:scan=3858	43.363281666666666	2	1546.8409	1546.8410	R	E	387	401
PSM	AEVAKATSHVGEIEQELALAR	60	sp|P30622-2|CLIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4349	48.8	3	2449.2292	2449.2292	R	D	376	397
PSM	AVADAIRTSLGPK	61	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2518	31.185	2	1525.7943	1525.7943	K	G	43	56
PSM	ELISNASDALDK	62	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3031	35.44	2	1422.728	1422.7280	R	I	42	54
PSM	ELISNASDALDK	63	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3531	40.002	2	1422.728	1422.7280	R	I	42	54
PSM	LATQLTGPVMPVR	64	sp|P26373-2|RL13_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=4137	46.39	2	1575.7709	1575.7709	K	N	99	112
PSM	NGESSELDLQGIR	65	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3498	39.684	2	1530.7139	1530.7139	R	I	112	125
PSM	VLTEIIASRTPEELR	66	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4026	45.088	2	1919.9583	1919.9583	K	A	109	124
PSM	TLTIVDTGIGMTK	67	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:35,12-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4192	46.97387166666667	2	1592.7801	1592.7805	R	A	88	101
PSM	ATSHVGEIEQELALAR	68	sp|P30622|CLIP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4037	45.245354999999996	2	1836.9177	1836.9190	K	D	381	397
PSM	GPPSSSDSEPEAELER	69	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=2310	29.452309999999997	2	1799.7639	1799.7670	R	E	392	408
PSM	GLSEDTTEETLK	70	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2553	31.447	2	1469.7175	1469.7175	K	E	578	590
PSM	GNPTVEVDLFTSK	71	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4237	47.513	2	1553.8015	1553.8015	R	G	16	29
PSM	ITPSYVAFTPEGER	72	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=4078	45.665	2	1759.7684	1759.7684	R	L	61	75
PSM	KAEAGAGSATEFQFR	73	sp|P46783|RS10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2544	31.378	2	1716.8509	1716.8509	K	G	139	154
PSM	RNQSFCPTVNLDK	74	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2897	34.258	2	1805.8209	1805.8209	K	L	65	78
PSM	RQAVTNPNNTFYATK	75	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2163	28.298	3	1951.9231	1951.9231	K	R	107	122
PSM	TTPSVVAFTADGER	76	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=3622	40.73	2	1643.7058	1643.7058	R	L	86	100
PSM	TTPSYVAFTDTER	77	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3347	38.272	2	1600.7234	1600.7234	R	L	37	50
PSM	ELISNSSDALDK	78	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2615	31.958	2	1438.7229	1438.7229	R	I	47	59
PSM	GFSVVADTPELQR	79	sp|Q14847-3|LASP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4147	46.477	2	1531.7496	1531.7496	K	I	41	54
PSM	GVQVETISPGDGR	80	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2196	28.541	2	1427.687	1427.6870	M	T	2	15
PSM	KEESEESDDDMGFGLFD	81	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4644	51.951	2	2112.8395	2112.8395	K	-	99	116
PSM	LATQLTGPVMPVR	82	sp|P26373-2|RL13_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3393	38.633	2	1591.7658	1591.7659	K	N	99	112
PSM	NSTFSASGETVER	83	sp|Q9BYP7-3|WNK3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=2175	28.387	2	1577.6224	1577.6224	K	K	43	56
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	84	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2408	30.277	3	3336.5519	3336.5519	R	Q	205	235
PSM	SASWGSADQLK	85	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2837	33.76	2	1296.6388	1296.6388	R	E	221	232
PSM	TVPVEAVTSKTSNIR	86	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2898	34.265	2	1828.9373	1828.9373	K	A	300	315
PSM	ADVQSIIGLQR	87	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4323	48.5	2	1312.6964	1312.6964	K	F	698	709
PSM	AITGASLADIMAK	88	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,11-UNIMOD:35,13-UNIMOD:510	ms_run[2]:scan=3843	43.225	2	1504.7286	1504.7286	R	R	81	94
PSM	DAGQISGLNVLR	89	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4231	47.449	2	1355.7022	1355.7022	K	V	207	219
PSM	EDQTEYLEER	90	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1939	26.496	2	1344.6258	1344.6258	K	R	192	202
PSM	EFEGKTLVSVTK	91	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3253	37.407	2	1598.8458	1598.8458	K	E	535	547
PSM	EQVANSAFVER	92	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1785	25.305	2	1282.673	1282.6730	K	V	492	503
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	93	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2344	29.732	3	2847.2212	2847.2212	K	M	445	470
PSM	NQVAMNPTNTVFDAK	94	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:21,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2683	32.504	2	1892.8417	1892.8417	K	R	57	72
PSM	NSTFSASGETVER	95	sp|Q9BYP7-3|WNK3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=2329	29.622	2	1577.6224	1577.6224	K	K	43	56
PSM	NVTELNEPLSNEER	96	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3137	36.353	2	1756.8093	1756.8093	K	N	29	43
PSM	VTSFRDLIHDQDEDEEEEEGQR	97	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3657	41.044	3	2789.1878	2789.1878	R	F	72	94