MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100715_001CSK.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100715_001CSK.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	228-UNIMOD:510	0.09	40.0	6	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	180-UNIMOD:510,188-UNIMOD:21,179-UNIMOD:510	0.06	39.0	2	2	2
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	19-UNIMOD:21	0.08	36.0	2	1	0
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	431-UNIMOD:510,432-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	396-UNIMOD:510,397-UNIMOD:21	0.05	33.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	300-UNIMOD:510,309-UNIMOD:21,314-UNIMOD:510,313-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	34-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	239-UNIMOD:510,240-UNIMOD:21	0.05	33.0	2	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	472-UNIMOD:510,481-UNIMOD:21,493-UNIMOD:510	0.04	32.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	82-UNIMOD:510,94-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P41240|CSK_HUMAN	Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	172-UNIMOD:510,173-UNIMOD:35,184-UNIMOD:21	0.03	32.0	2	1	0
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	223-UNIMOD:510	0.09	31.0	1	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	292-UNIMOD:510,305-UNIMOD:21,306-UNIMOD:510,301-UNIMOD:21,457-UNIMOD:510,472-UNIMOD:21,482-UNIMOD:510,484-UNIMOD:21,485-UNIMOD:21,491-UNIMOD:510	0.06	31.0	4	3	2
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	142-UNIMOD:510,142-UNIMOD:21,153-UNIMOD:4,157-UNIMOD:510	0.07	31.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	140-UNIMOD:510,149-UNIMOD:21,157-UNIMOD:510	0.18	30.0	2	2	2
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	205-UNIMOD:510,209-UNIMOD:21,208-UNIMOD:21	0.10	30.0	3	2	1
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	114-UNIMOD:510,120-UNIMOD:21,127-UNIMOD:510	0.07	30.0	1	1	1
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	177-UNIMOD:510,177-UNIMOD:21,188-UNIMOD:510,187-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	null		0.09	30.0	1	1	0
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	112-UNIMOD:510,121-UNIMOD:21,125-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|O60664-4|PLIN3_HUMAN	Isoform 4 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	85-UNIMOD:510,95-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	63-UNIMOD:510,64-UNIMOD:21	0.08	28.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	114-UNIMOD:510	0.13	28.0	1	1	1
PRT	sp|Q8NI22-2|MCFD2_HUMAN	Isoform 2 of Multiple coagulation factor deficiency protein 2 OS=Homo sapiens OX=9606 GN=MCFD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	79-UNIMOD:510,83-UNIMOD:21,91-UNIMOD:510	0.15	27.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	253-UNIMOD:510,258-UNIMOD:21,265-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	237-UNIMOD:510,241-UNIMOD:21,246-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	328-UNIMOD:510,330-UNIMOD:21,340-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	140-UNIMOD:510,149-UNIMOD:21,157-UNIMOD:510,158-UNIMOD:510,237-UNIMOD:4	0.18	26.0	2	2	2
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	232-UNIMOD:510,242-UNIMOD:21,245-UNIMOD:510	0.06	26.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	108-UNIMOD:510,125-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	398-UNIMOD:510,409-UNIMOD:21,411-UNIMOD:35,381-UNIMOD:21	0.07	25.0	2	2	2
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	268-UNIMOD:510,272-UNIMOD:21,278-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q15427|SF3B4_HUMAN	Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	10-UNIMOD:510,16-UNIMOD:21,23-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	37-UNIMOD:510,41-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9UMX5|NENF_HUMAN	Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	55-UNIMOD:510,65-UNIMOD:21,69-UNIMOD:510	0.09	25.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	95-UNIMOD:510,95-UNIMOD:21,106-UNIMOD:510	0.09	25.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	158-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P20618|PSB1_HUMAN	Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	147-UNIMOD:510,150-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|P27816-7|MAP4_HUMAN	Isoform 7 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	45-UNIMOD:510,47-UNIMOD:21,56-UNIMOD:510	0.13	24.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	250-UNIMOD:510,256-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	101-UNIMOD:21,104-UNIMOD:21	0.15	24.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	44-UNIMOD:510,48-UNIMOD:21	0.10	23.0	1	1	1
PRT	sp|P50990-2|TCPQ_HUMAN	Isoform 2 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:510,11-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	247-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	70-UNIMOD:510,76-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	106-UNIMOD:21	0.17	23.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	20-UNIMOD:510,22-UNIMOD:21,30-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	320-UNIMOD:510,334-UNIMOD:21,336-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	271-UNIMOD:510,278-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	54-UNIMOD:510,68-UNIMOD:21,73-UNIMOD:510,70-UNIMOD:21	0.13	22.0	2	1	0
PRT	sp|P62191-2|PRS4_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	106-UNIMOD:510,110-UNIMOD:21,125-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	46-UNIMOD:510,48-UNIMOD:21,54-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	222-UNIMOD:510,223-UNIMOD:21,227-UNIMOD:21,233-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	140-UNIMOD:510,144-UNIMOD:21,152-UNIMOD:510	0.09	21.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	129-UNIMOD:510,133-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	241-UNIMOD:510,244-UNIMOD:21,273-UNIMOD:510,202-UNIMOD:510,208-UNIMOD:21,211-UNIMOD:510,243-UNIMOD:21	0.11	21.0	3	2	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	598-UNIMOD:510,614-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P61353|RL27_HUMAN	60S ribosomal protein L27 OS=Homo sapiens OX=9606 GN=RPL27 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	85-UNIMOD:510,85-UNIMOD:21,93-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	143-UNIMOD:510,152-UNIMOD:21,153-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	129-UNIMOD:510,130-UNIMOD:21,144-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	143-UNIMOD:510,146-UNIMOD:21,152-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	668-UNIMOD:510,671-UNIMOD:21,676-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	175-UNIMOD:510,181-UNIMOD:21,185-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	70-UNIMOD:510,75-UNIMOD:21	0.11	20.0	1	1	1
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	385-UNIMOD:510,398-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	95-UNIMOD:510,95-UNIMOD:21,99-UNIMOD:21,105-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	16-UNIMOD:510,19-UNIMOD:21,31-UNIMOD:510	0.09	20.0	1	1	1
PRT	sp|Q8NHW5|RLA0L_HUMAN	60S acidic ribosomal protein P0-like OS=Homo sapiens OX=9606 GN=RPLP0P6 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	304-UNIMOD:21,307-UNIMOD:21,311-UNIMOD:35	0.05	20.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=3480	49.075	2	2226.9361	2226.9361	R	-	228	248
PSM	AEDGSVIDYELIDQDAR	2	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3411	48.203	2	2021.9043	2021.9043	R	D	180	197
PSM	DNLTLWTSDQQDDDGGEGNN	3	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=3575	50.123	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	4	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=3397	48.057	2	2192.873	2192.8730	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	5	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=3486	49.123	3	2226.9361	2226.9361	R	-	228	248
PSM	VVDYSQFQESDDADEDYGR	6	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:21	ms_run[2]:scan=2692	38.878	2	2316.8696	2316.8696	K	D	10	29
PSM	DYEEVGADSADGEDEGEEY	7	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2670	38.59	2	2191.7691	2191.7691	K	-	431	450
PSM	DYEEVGVDSVEGEGEEEGEEY	8	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3454	48.797	2	2461.927	2461.9270	K	-	396	417
PSM	NPDDITNEEYGEFYK	9	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2797	40.37	2	1980.8667	1980.8667	R	S	300	315
PSM	PVSSAASVYAGAGGSGSR	10	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	7-UNIMOD:21	ms_run[2]:scan=1837	27.184	2	1659.7254	1659.7254	R	I	28	46
PSM	SYELPDGQVITIGNER	11	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3170	45.193	2	1903.9141	1903.9141	K	F	239	255
PSM	NPDDITNEEYGEFYK	12	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2803	40.45	2	2060.833	2060.8330	R	S	300	315
PSM	TSRPENAIIYNNNEDFQVGQAK	13	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=2545	37.002	3	2655.2966	2655.2966	R	V	472	494
PSM	VDATEESDLAQQYGVR	14	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2348	34.191	2	1893.857	1893.8570	K	G	82	98
PSM	VMEGTVAAQDEFYR	15	sp|P41240|CSK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=2202	31.901	2	1744.7592	1744.7592	K	S	172	186
PSM	DNLTLWTSENQGDEGDAGEGEN	16	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=3474	49.012	2	2384.01	2384.0100	R	-	223	245
PSM	NPDDITQEEYGEFYK	17	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2949	42.301	2	1994.8823	1994.8823	R	S	292	307
PSM	VMEGTVAAQDEFYR	18	sp|P41240|CSK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2479	36.116	2	1728.7643	1728.7643	K	S	172	186
PSM	YADLTEDQLPSCESLK	19	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2858	41.19	2	2015.9435	2015.9435	R	D	142	158
PSM	DNLTLWTSDTQGDEAEAGEGGEN	20	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3521	49.502	2	2407.9888	2407.9888	R	-	223	246
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGR	21	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1948	28.47	3	2984.3296	2984.3296	R	P	205	232
PSM	SPASDTYIVFGEAK	22	sp|Q13765|NACA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3034	43.473	2	1631.812	1631.8120	K	I	114	128
PSM	YISPDQLADLYK	23	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3697	51.5	2	1572.8113	1572.8113	R	S	177	189
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGR	24	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=1948	28.470301666666668	3	2984.3201	2984.3291	R	P	205	232
PSM	DNLTLWTSENQGDEGDAGEGEN	25	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0		ms_run[1]:scan=3375	47.82179	2	2349.9378	2349.9464	R	-	225	247
PSM	DNLTLWTSDQQDDDGGEGNN	26	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3404	48.131	3	2192.873	2192.8730	R	-	228	248
PSM	IDFYFDENPYFENK	27	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4196	57.889	2	1987.8917	1987.8917	R	V	112	126
PSM	LEPQIASASEYAHR	28	sp|O60664-4|PLIN3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1936	28.329	3	1684.8034	1684.8034	K	G	85	99
PSM	LYTLVLTDPDAPSR	29	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3373	47.804	2	1673.849	1673.8490	K	K	63	77
PSM	YFQINQDEEEEEDED	30	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=2515	36.568	2	1964.786	1964.7860	R	-	114	129
PSM	DYEEVGVDSVEGEGEEEGEEY	31	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3458	48.833	3	2461.927	2461.9270	K	-	396	417
PSM	NNDGYIDYAEFAK	32	sp|Q8NI22-2|MCFD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3082	44.109	2	1666.7553	1666.7553	K	S	79	92
PSM	EEASDYLELDTIK	33	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3191	45.449	2	1672.8121	1672.8121	K	N	253	266
PSM	GYFEYIEENK	34	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2885	41.592	2	1438.6694	1438.6694	R	Y	237	247
PSM	LAYINPDLALEEK	35	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3409	48.186	2	1635.8797	1635.8797	R	N	328	341
PSM	QTIDNSQGAYQEAFDISKK	36	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=2423	35.314	3	2324.1786	2324.1786	K	E	140	159
PSM	SSGPYGGGGQYFAK	37	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1968	28.742	2	1522.713	1522.7130	R	P	232	246
PSM	TDLNPDNLQGGDDLDPNYVLSSR	38	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=3890	53.922381666666666	3	2631.1856	2631.1909	K	V	108	131
PSM	DNLTLWTSDQQDEEAGEGN	39	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3434	48.526	2	2120.8771	2120.8771	R	-	228	247
PSM	GPVSGTEPEPVYSMEAADYR	40	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=2283	33.19	3	2283.9819	2283.9819	R	E	398	418
PSM	LISWYDNEFGYSNR	41	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3765	52.301	2	1876.8245	1876.8245	K	V	268	282
PSM	LPSSPVYEDAASFK	42	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:21	ms_run[2]:scan=2866	41.268	2	1589.7015	1589.7015	R	A	378	392
PSM	NPDDITQEEYGEFYK	43	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2839	41.019	2	2074.8486	2074.8486	R	S	292	307
PSM	NQDATVYVGGLDEK	44	sp|Q15427|SF3B4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2338	34.057	2	1655.808	1655.8080	R	V	10	24
PSM	SGGGGGGGLGSGGSIR	45	sp|P35527|K1C9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1170	19.188	2	1231.5905	1231.5905	R	S	14	30
PSM	TTPSYVAFTDTER	46	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2419	35.268	2	1600.7234	1600.7234	R	L	37	50
PSM	YGGEEEDQPIYLAVK	47	sp|Q9UMX5|NENF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3142	44.91	2	1857.9074	1857.9074	R	G	55	70
PSM	YSQVLANGLDNK	48	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2130	30.999	2	1468.7599	1468.7599	K	L	95	107
PSM	AGDLLEDSPK	49	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:21	ms_run[2]:scan=1859	27.392	2	1123.4798	1123.4798	R	R	151	161
PSM	DNLTLWTSDSAGEECDAAEGAEN	50	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:4	ms_run[2]:scan=3615	50.503	2	2453.9765	2453.9765	R	-	223	246
PSM	GAVYSFDPVGSYQR	51	sp|P20618|PSB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2850	41.125	2	1658.7554	1658.7554	K	D	147	161
PSM	LISWYDNEFGYSNR	52	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3981	54.971	2	1956.7909	1956.7909	K	V	268	282
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	53	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1882	27.718	3	3336.5519	3336.5519	R	Q	205	235
PSM	TDYIPLLDVDEK	54	sp|P27816-7|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3996	55.142	2	1567.8059	1567.8059	K	T	45	57
PSM	VERADGYEPPVQESV	55	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2028	29.513	2	1787.8191	1787.8191	K	-	250	265
PSM	VVDYSQFQESDDADEDYGR	56	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:21	ms_run[2]:scan=2689	38.853	3	2316.8696	2316.8696	K	D	10	29
PSM	YISPDQLADLYK	57	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3572	50.083	2	1652.7776	1652.7776	R	S	177	189
PSM	EESEESDDDMGFGLFD	58	sp|P05386|RLA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=5438	77.85118166666666	2	1981.5872	1980.5892	K	-	99	115
PSM	ELAPYDENWFYTR	59	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3838	53.213	2	1816.7922	1816.7922	K	A	44	57
PSM	HFSGLEEAVYR	60	sp|P50990-2|TCPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2319	33.806	2	1420.66	1420.6600	M	N	2	13
PSM	KVEEEQEADEEDVSEEEAESK	61	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:21	ms_run[2]:scan=1550	23.581	3	2516.9803	2516.9803	K	E	234	255
PSM	NVDGVNYASITR	62	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2134	31.061	2	1421.6764	1421.6764	R	N	70	82
PSM	YGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAK	63	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	28-UNIMOD:21	ms_run[2]:scan=3537	49.676	3	4103.5812	4103.5812	K	R	79	117
PSM	YHTSQSGDEMTSLSEYVSR	64	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=2556	37.132	3	2289.9673	2289.9673	R	M	457	476
PSM	DNLTLWTSDQQDDDGGEGNN	65	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3581	50.203	3	2226.9361	2226.9361	R	-	228	248
PSM	EVYELLDSPGK	66	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2595	37.536	2	1396.7163	1396.7163	K	V	20	31
PSM	SYELPDGQVITIGNER	67	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3393	48.026	2	1903.9141	1903.9141	K	F	239	255
PSM	SIYYITGESK	68	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=2404	35.04870833333333	2	1387.6328	1387.6345	K	E	482	492
PSM	NASTFEDVTQVSSAYQK	69	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,15-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=2571	37.324268333333336	3	2021.9584	2021.9614	K	T	320	337
PSM	HWILPQDYDHAQAEAR	70	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=2420	35.275255	3	2062.9440	2062.9469	R	H	271	287
PSM	EILVGDVGQTVDDPYATFVK	71	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,15-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=3899	53.999475	3	2313.1775	2313.1813	K	M	54	74
PSM	APQETYADIGGLDNQIQEIK	72	sp|P62191-2|PRS4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=3431	48.486	3	2350.173	2350.1730	K	E	106	126
PSM	EILVGDVGQTVDDPYATFVK	73	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,17-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=3899	53.999	3	2313.1818	2313.1818	K	M	54	74
PSM	GIYAYGFEK	74	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2708	39.081	2	1194.5999	1194.5999	R	P	46	55
PSM	GYISPYFINTSK	75	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3295	46.845	2	1616.7565	1616.7565	R	G	222	234
PSM	LAPDYDALDVANK	76	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2731	39.459	2	1551.7858	1551.7858	R	I	140	153
PSM	LGDVYVNDAFGTAHR	77	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2736	39.516	3	1747.8143	1747.8143	K	A	129	144
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	78	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,33-UNIMOD:510	ms_run[2]:scan=2454	35.763	4	3922.7331	3922.7331	K	E	241	274
PSM	TDGSISGDRQPVTVADYISR	79	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=2610	37.75	3	2250.0742	2250.0742	R	A	598	618
PSM	YSVDIPLDK	80	sp|P61353|RL27_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2509	36.516	2	1196.6366	1196.6366	R	T	85	94
PSM	EAAENSLVAYK	81	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=1779	26.45	2	1341.683704	1341.685383	K	A	143	154
PSM	ASGNYATVISHNPETK	82	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=1612	24.19067833333333	3	1835.9060	1835.9086	R	K	129	145
PSM	NLQYYDISAK	83	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=2590	37.494841666666666	2	1361.689013	1361.690468	K	S	143	153
PSM	GIVDQSQQAYQEAFEISK	84	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3080	44.092	3	2188.0726	2188.0726	K	K	140	158
PSM	GVQYLNEIK	85	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2235	32.504	2	1210.6635	1210.6635	K	D	668	677
PSM	QVVESAYEVIK	86	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2416	35.231	2	1411.7636	1411.7636	K	L	175	186
PSM	RAEDGSVIDYELIDQDAR	87	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2965	42.52	3	2178.0054	2178.0054	R	D	179	197
PSM	RLEAAYLDLQR	88	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2488	36.201	2	1460.7601	1460.7601	R	I	70	81
PSM	VPSPLEGSEGDGDTD	89	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2469	35.937	2	1587.6402	1587.6402	K	-	385	400
PSM	YAALYQPLFDK	90	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3525	49.533	2	1555.7401	1555.7401	K	R	95	106
PSM	QYTSPEEIDAQLQAEK	91	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=2841	41.03587	3	1996.9638	1996.9662	R	Q	16	32
PSM	SSFSHYSGLK	92	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=1581	23.900313333333333	2	1259.6211	1259.6219	R	H	202	212
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	93	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,33-UNIMOD:510	ms_run[1]:scan=2454	35.76283833333333	4	3922.7222	3922.7322	K	E	241	274
PSM	EESEESDEDMGFGLFD	94	sp|Q8NHW5|RLA0L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	3-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=4671	65.06548333333333	2	2010.5945	2010.5998	K	-	302	318