MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100625_029SPHK2.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100625_029SPHK2.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	431-UNIMOD:510	0.04	43.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	228-UNIMOD:510	0.09	42.0	2	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	167-UNIMOD:510,168-UNIMOD:510,181-UNIMOD:21,182-UNIMOD:510	0.05	41.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	239-UNIMOD:510	0.05	40.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	22-UNIMOD:510,29-UNIMOD:21	0.09	40.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	203-UNIMOD:510,205-UNIMOD:21,221-UNIMOD:510	0.05	39.0	1	1	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	151-UNIMOD:510,158-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	180-UNIMOD:510,186-UNIMOD:21,182-UNIMOD:21	0.02	38.0	2	1	0
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	463-UNIMOD:510,473-UNIMOD:21,482-UNIMOD:510	0.01	37.0	1	1	1
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	75-UNIMOD:510,84-UNIMOD:35,80-UNIMOD:21	0.13	37.0	2	1	0
PRT	sp|Q9NRA0-4|SPHK2_HUMAN	Isoform 4 of Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	30-UNIMOD:510,39-UNIMOD:21,41-UNIMOD:4,42-UNIMOD:4,43-UNIMOD:21,48-UNIMOD:510,52-UNIMOD:21,57-UNIMOD:4,338-UNIMOD:510,339-UNIMOD:510,340-UNIMOD:21,343-UNIMOD:21,355-UNIMOD:21,421-UNIMOD:510,425-UNIMOD:21,444-UNIMOD:21,317-UNIMOD:510,328-UNIMOD:21,330-UNIMOD:21,334-UNIMOD:21	0.18	37.0	7	5	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	36.0	1	1	0
PRT	sp|Q8N9Q2|SR1IP_HUMAN	Protein SREK1IP1 OS=Homo sapiens OX=9606 GN=SREK1IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	38-UNIMOD:510,45-UNIMOD:21,61-UNIMOD:510	0.16	36.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	204-UNIMOD:510,213-UNIMOD:35,222-UNIMOD:510,121-UNIMOD:510,126-UNIMOD:21,131-UNIMOD:510	0.14	35.0	3	2	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	292-UNIMOD:510,306-UNIMOD:510	0.02	35.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	34.0	1	1	0
PRT	sp|Q9NRA0|SPHK2_HUMAN	Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	480-UNIMOD:510,484-UNIMOD:21,487-UNIMOD:21,503-UNIMOD:21,376-UNIMOD:510,387-UNIMOD:21,389-UNIMOD:21,397-UNIMOD:510,398-UNIMOD:510,399-UNIMOD:21,404-UNIMOD:21,414-UNIMOD:21	0.11	34.0	4	3	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	34.0	1	1	0
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	489-UNIMOD:510,499-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	137-UNIMOD:510,143-UNIMOD:21,150-UNIMOD:510	0.03	33.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	32.0	1	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	28-UNIMOD:510,223-UNIMOD:510	0.16	32.0	2	2	2
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	null	98-UNIMOD:510,104-UNIMOD:21,108-UNIMOD:35	0.16	32.0	1	1	0
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	228-UNIMOD:510	0.08	31.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	29-UNIMOD:510,36-UNIMOD:21,42-UNIMOD:510	0.04	31.0	1	1	1
PRT	sp|Q27J81-2|INF2_HUMAN	Isoform 2 of Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	1192-UNIMOD:510,1192-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q9NVR5-2|KTU_HUMAN	Isoform 2 of Protein kintoun OS=Homo sapiens OX=9606 GN=DNAAF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	720-UNIMOD:510,725-UNIMOD:21,731-UNIMOD:510	0.02	30.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510	0.02	30.0	1	1	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	208-UNIMOD:510,210-UNIMOD:21,220-UNIMOD:510	0.05	30.0	1	1	1
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	269-UNIMOD:510,295-UNIMOD:21,298-UNIMOD:510	0.06	30.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	221-UNIMOD:510	0.03	30.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	44-UNIMOD:510,64-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,500-UNIMOD:510	0.04	29.0	2	2	2
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	158-UNIMOD:510,166-UNIMOD:21,169-UNIMOD:510	0.03	28.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	28.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	82-UNIMOD:510,92-UNIMOD:510	0.07	28.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	43-UNIMOD:510,57-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|Q8NC51-2|PAIRB_HUMAN	Isoform 2 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	235-UNIMOD:510,246-UNIMOD:21,267-UNIMOD:510	0.08	27.0	1	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	235-UNIMOD:510,241-UNIMOD:21,247-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	null	97-UNIMOD:510,101-UNIMOD:4,104-UNIMOD:21	0.05	27.0	1	1	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	219-UNIMOD:510,223-UNIMOD:4,229-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	241-UNIMOD:510,243-UNIMOD:21,252-UNIMOD:21,273-UNIMOD:510	0.08	25.0	1	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	232-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	154-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	237-UNIMOD:510,241-UNIMOD:21,248-UNIMOD:35	0.05	24.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	402-UNIMOD:510	0.03	24.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DYEEVGADSADGEDEGEEY	1	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=3421	38.557	2	2111.8027	2111.8027	K	-	431	450
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:510	ms_run[1]:scan=4354	48.50025333333333	2	2226.933318	2226.936145	R	-	228	248
PSM	YKLDEDEDEDDADLSK	3	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,2-UNIMOD:510,15-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2466	30.554	2	2080.9462	2080.9462	K	Y	167	183
PSM	SYELPDGQVITIGNER	4	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=4458	49.616	2	1823.9478	1823.9478	K	F	239	255
PSM	VWLDPNETNEIANANSR	5	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3833	42.895	2	2055.9475	2055.9475	K	Q	22	39
PSM	DATNVGDEGGFAPNILENK	6	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,3-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=4472	49.747	2	2108.01	2108.0100	K	E	203	222
PSM	GAEAANVTGPDGVPVEGSR	7	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2373	29.742	2	1895.8839	1895.8839	K	Y	151	170
PSM	DNLTLWTSDQQDDDGGEGNN	8	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=4449	49.535	2	2226.9361	2226.9361	R	-	228	248
PSM	INSSGESGDESDEFLQSR	9	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=3097	35.93996833333333	2	2069.8599	2069.8634	R	K	180	198
PSM	AGEEDEGEEDSDSDYEISAK	10	sp|A2RRP1-2|NBAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2362	29.66	2	2321.9221	2321.9221	R	A	463	483
PSM	DWEDDSDEDMSNFDR	11	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2959	34.732	2	1924.7117	1924.7117	K	F	75	90
PSM	GGLVPLAEVSGCCTLR	12	sp|Q9NRA0-4|SPHK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4243	47.162	2	1801.868	1801.8680	R	S	30	46
PSM	GGLVPLAEVSGCCTLR	13	sp|Q9NRA0-4|SPHK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=4652	51.928	2	1881.8343	1881.8343	R	S	30	46
PSM	DSSTSPGDYVLSVSENSR	14	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4204	46.793	2	2012.8788	2012.8788	R	V	39	57
PSM	RDIVLDVSSTSSEDSDEENEELNK	15	sp|Q8N9Q2|SR1IP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,8-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=3375	38.176	3	2857.3026	2857.3026	K	L	38	62
PSM	DNLTLWTSDMQGDGEEQNK	16	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3709	41.512	2	2264.0539	2264.0539	R	E	204	223
PSM	INSSGESGDESDEFLQSR	17	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3097	35.94	2	2069.8639	2069.8639	R	K	180	198
PSM	NPDDITQEEYGEFYK	18	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3728	41.721	2	1914.916	1914.9160	R	S	292	307
PSM	RVSVCAETYNPDEEEEDTDPR	19	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2595	31.617	3	2624.0798	2624.0798	R	V	97	118
PSM	AALHSPVSEGAPVIPPSSGLPLPTPDAR	20	sp|Q9NRA0|SPHK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=4896	55.15278833333333	3	3006.4094	3006.4113	K	V	480	508
PSM	DSSTSPGDYVLSVSENSR	21	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4204	46.792654999999996	2	2012.877424	2012.878828	R	V	39	57
PSM	FADQDDIGNVSFDR	22	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3775	42.293	2	1711.7303	1711.7303	K	V	489	503
PSM	LGAVDESLSEETQK	23	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2717	32.619	2	1652.8182	1652.8182	R	A	137	151
PSM	AALHSPVSEGAPVIPPSSGLPLPTPDAR	24	sp|Q9NRA0|SPHK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=4822	54.10057666666666	3	3006.409915	3006.411840	K	V	480	508
PSM	DNLTLWTSDMQGDGEEQNK	25	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3696	41.388	3	2264.0539	2264.0539	R	E	204	223
PSM	KEESEESDDDMGFGLFD	26	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4141	46.095	2	2032.8732	2032.8732	K	-	73	90
PSM	SVTEQGAELSNEER	27	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=1546	23.444	2	1581.7695	1581.7695	K	N	28	42
PSM	KEESEESDDDMGFGLFD	28	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=4628	51.62850666666667	2	2112.8377	2112.8390	K	-	98	115
PSM	DNLTLWTSDQQDEEAGEGN	29	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=4414	49.127	2	2154.9402	2154.9402	R	-	228	247
PSM	DWEDDSDEDMSNFDR	30	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3278	37.369	2	2004.6781	2004.6781	K	F	75	90
PSM	GILAADESTGSIAK	31	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2902	34.196	2	1479.7858	1479.7858	K	R	29	43
PSM	SFSEDAVTDSSGSGTLPR	32	sp|Q27J81-2|INF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3374	38.169	2	1925.8468	1925.8468	K	A	1192	1210
PSM	TDYNASVSVPDSSGPER	33	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2576	31.476	2	1893.8206	1893.8206	R	I	70	87
PSM	DNLNESVITEEK	34	sp|Q9NVR5-2|KTU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2868	33.894	2	1537.7549	1537.7549	K	E	720	732
PSM	ETVSEESNVLCLSK	35	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3204	36.764	2	1661.8818	1661.8818	R	S	581	595
PSM	EVSFQSTGESEWK	36	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3461	38.931	2	1660.7658	1660.7658	R	D	208	221
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	37	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	ms_run[2]:scan=1468	22.873	3	3241.4532	3241.4532	K	E	269	299
PSM	SPSDSAAYFCIYTYPR	38	sp|Q9NRA0-4|SPHK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=4619	51.498	2	2010.8647	2010.8647	R	G	48	64
PSM	STAGDTHLGGEDFDNR	39	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=1735	24.851	2	1724.7814	1724.7814	K	M	221	237
PSM	TDDEVVQREEEAIQLDGLNASQIR	40	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=4568	50.851	3	2841.3606	2841.3606	R	E	44	68
PSM	LSYLPATVEPASPTPAHSLPR	41	sp|Q9NRA0|SPHK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=4197	46.74109666666667	3	2397.1580	2397.1590	R	A	376	397
PSM	AKSELTLTPDPAPPMAHSPLHR	42	sp|Q9NRA0-4|SPHK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=3274	37.339	3	2673.2465	2673.2465	R	S	338	360
PSM	DNLTLWTSDTQGDEAEAGEGGEN	43	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=4499	50.055	3	2442.0519	2442.0519	R	-	223	246
PSM	ESEDKPEIEDVGSDEEEEK	44	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=2028	27.033	3	2294.1022	2294.1022	K	K	251	270
PSM	DVIELTDDSFDK	45	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4367	48.596	2	1543.7331	1543.7331	K	N	158	170
PSM	TAFQEALDAAGDK	46	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3163	36.444	2	1403.7569	1403.7569	K	L	9	22
PSM	YALYDATYETK	47	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2976	34.885	2	1404.7449	1404.7449	R	E	82	93
PSM	DLADELALVDVIEDK	48	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=5812	68.824	2	1724.972	1724.9720	K	L	43	58
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	49	sp|Q8NC51-2|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:21,33-UNIMOD:510	ms_run[2]:scan=3336	37.839	4	3922.7331	3922.7331	K	E	235	268
PSM	VPTANVSVVDLTCR	50	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3702	41.433	2	1643.8166	1643.8166	R	L	235	249
PSM	RVSVCAETYNPDEEEEDTDPR	51	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=2595	31.6166	3	2624.076639	2624.079789	R	V	97	118
PSM	AALHSPVSEGAPVIPPSSGLPLPTPDAR	52	sp|Q9NRA0-4|SPHK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,24-UNIMOD:21	ms_run[2]:scan=4425	49.262	3	2926.4455	2926.4455	K	V	421	449
PSM	EAAENSLVAYK	53	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2295	29.152	2	1341.6854	1341.6854	K	A	121	132
PSM	LQIQCVVEDDK	54	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=3121	36.118	2	1413.781	1413.7810	K	V	219	230
PSM	LSYLPATVEPASPTPAHSLPR	55	sp|Q9NRA0-4|SPHK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3785	42.379	3	2317.1932	2317.1932	R	A	317	338
PSM	QENCGAQQVPAGPGTSTPPSSPVR	56	sp|Q96G46|DUS3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=2304	29.218478333333334	3	2535.1592	2535.1632	R	T	257	281
PSM	DQVANSAFVER	57	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=2065	27.3	2	1268.6573	1268.6573	K	L	500	511
PSM	AKSELTLTPDPAPPMAHSPLHR	58	sp|Q9NRA0|SPHK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=3274	37.339218333333335	3	2673.2431	2673.2460	R	S	397	419
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	59	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:21,33-UNIMOD:510	ms_run[1]:scan=3617	40.43250666666667	4	4002.6958	4002.6989	K	E	241	274
PSM	EVDEQMLNVQNK	60	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1688	24.497	2	1529.8032	1529.8032	K	N	325	337
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	61	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2137	27.888	3	2826.1852	2826.1852	R	E	418	442
PSM	LSYLPATVEPASPTPAHSLPR	62	sp|Q9NRA0-4|SPHK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=4574	50.909	2	2477.1258	2477.1258	R	A	317	338
PSM	SNVSDAVAQSTR	63	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1356	22.032	2	1267.6581	1267.6581	K	I	232	244
PSM	TNQELQEINR	64	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1451	22.752	2	1277.6788	1277.6788	R	V	154	164
PSM	YKLDEDEDEDDADLSK	65	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:510,15-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2464	30.54	3	2080.9462	2080.9462	K	Y	167	183
PSM	MLDQTLLDLNEM	66	sp|P06753-2|TPM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=4999	56.831918333333334	2	1564.6971	1564.6973	R	-	237	249
PSM	LDPGSEETQTLVR	67	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510	ms_run[1]:scan=2551	31.267281666666666	2	1478.7852	1477.7832	K	E	402	415