MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100709_015CDC1L6-CycC.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100709_015CDC1L6-CycC.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	204-UNIMOD:510,222-UNIMOD:510,213-UNIMOD:35	0.09	42.0	2	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	223-UNIMOD:510,28-UNIMOD:510	0.16	40.0	3	2	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	228-UNIMOD:510	0.09	39.0	5	1	0
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	36.0	1	1	0
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	75-UNIMOD:510,84-UNIMOD:35	0.13	36.0	2	1	0
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	16-UNIMOD:510,35-UNIMOD:21,47-UNIMOD:4,48-UNIMOD:510	0.05	36.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	203-UNIMOD:510,221-UNIMOD:510	0.05	35.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	180-UNIMOD:510,186-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	431-UNIMOD:510	0.04	34.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	292-UNIMOD:510,306-UNIMOD:510	0.02	34.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	34.0	1	1	0
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	223-UNIMOD:510	0.09	33.0	2	1	0
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,446-UNIMOD:510	0.03	32.0	2	2	2
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	207-UNIMOD:510,86-UNIMOD:510,91-UNIMOD:510,102-UNIMOD:21	0.26	32.0	2	2	2
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510	0.03	31.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	8-UNIMOD:510,23-UNIMOD:510	0.05	30.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	268-UNIMOD:510,270-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	257-UNIMOD:510,260-UNIMOD:4,272-UNIMOD:21	0.05	30.0	1	1	0
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.04	30.0	1	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	29.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	114-UNIMOD:510	0.13	29.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	221-UNIMOD:510,37-UNIMOD:510	0.06	28.0	2	2	2
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	28.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	14-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	47-UNIMOD:510,58-UNIMOD:510,192-UNIMOD:510,251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510	0.06	26.0	3	3	3
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	1928-UNIMOD:510,1944-UNIMOD:21,2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510,1942-UNIMOD:21	0.01	26.0	3	2	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	239-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	63-UNIMOD:510,64-UNIMOD:21,66-UNIMOD:4,74-UNIMOD:4,78-UNIMOD:510	0.08	25.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	25.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	140-UNIMOD:510,152-UNIMOD:510	0.09	25.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	28-UNIMOD:510	0.06	24.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	323-UNIMOD:510	0.06	24.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDMQGDGEEQNK	1	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3906	49.578	2	2248.059	2248.0590	R	E	204	223
PSM	DNLTLWTSDTQGDEAEAGEGGEN	2	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=4187	52.677	3	2442.0519	2442.0519	R	-	223	246
PSM	DNLTLWTSDQQDDDGGEGNN	3	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:510	ms_run[1]:scan=4031	50.95585666666666	2	2226.932012	2226.936145	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	4	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:510	ms_run[1]:scan=4123	51.99002166666667	2	2226.9301	2226.9356	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	5	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=4373	55.085	2	2226.9361	2226.9361	R	-	228	248
PSM	DSSTSPGDYVLSVSENSR	6	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3874	49.142	2	2012.8788	2012.8788	R	V	39	57
PSM	DWEDDSDEDMSNFDR	7	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=3434	44.32	2	1908.7168	1908.7168	K	F	75	90
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	8	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,20-UNIMOD:21,32-UNIMOD:4,33-UNIMOD:510	ms_run[2]:scan=3385	43.693	3	3881.5895	3881.5895	R	G	16	49
PSM	DATNVGDEGGFAPNILENK	9	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3788	48.168	2	2028.0436	2028.0436	K	E	203	222
PSM	INSSGESGDESDEFLQSR	10	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2796	37.396	2	2069.8639	2069.8639	R	K	180	198
PSM	DYEEVGADSADGEDEGEEY	11	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=3086	40.244	2	2111.8027	2111.8027	K	-	431	450
PSM	NPDDITQEEYGEFYK	12	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3313	43.034	2	1914.916	1914.9160	R	S	292	307
PSM	TPEELDDSDFETEDFDVR	13	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4172	52.554	2	2271.9157	2271.9157	R	S	264	282
PSM	DNLTLWTSDQQDDDGGEGNN	14	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510	ms_run[1]:scan=4217	53.07657	2	2226.9301	2226.9356	R	-	228	248
PSM	DSSTSPGDYVLSVSENSR	15	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3874	49.14195	2	2012.8748	2012.8783	R	V	39	57
PSM	DNLTLWTSENQGDEGDAGEGEN	16	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4005	50.744	3	2384.01	2384.0100	R	-	223	245
PSM	DNLTLWTSDQQDDDGGEGNN	17	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=4041	51.034	3	2226.9361	2226.9361	R	-	228	248
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	18	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2034	30.192	3	2847.2212	2847.2212	K	M	445	470
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	19	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=4011	50.793	3	3490.5054	3490.5054	R	-	207	238
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	20	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,6-UNIMOD:510,17-UNIMOD:21	ms_run[1]:scan=3652	46.612766666666666	3	3461.4602	3461.4712	K	F	86	114
PSM	EVDEQMLNVQNK	21	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1443	25.024	2	1529.8032	1529.8032	K	N	325	337
PSM	LIAPVAEEEATVPNNK	22	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2512	34.598	2	1762.0149	1762.0149	K	I	8	24
PSM	LISWYDNEFGYSNR	23	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4513	57.04	2	1876.8245	1876.8245	K	V	268	282
PSM	QENCGAQQVPAGPGTSTPPSSPVR	24	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,4-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=2082	30.619	3	2535.1637	2535.1637	R	T	257	281
PSM	SVTEQGAELSNEER	25	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=1300	23.726	2	1581.7695	1581.7695	K	N	28	42
PSM	QENCGAQQVPAGPGTSTPPSSPVR	26	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=2082	30.618873333333333	3	2535.1605	2535.1632	R	T	257	281
PSM	AFLAELEQNSPK	27	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3467	44.666	2	1493.7803	1493.7803	K	I	2424	2436
PSM	DNLTLWTSENQGDEGDAGEGEN	28	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=4010	50.786	2	2384.01	2384.0100	R	-	223	245
PSM	YFQINQDEEEEEDED	29	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510	ms_run[1]:scan=2813	37.535740000000004	2	1964.7839	1964.7854	R	-	114	129
PSM	DWEDDSDEDMSNFDR	30	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2644	36.103	2	1924.7117	1924.7117	K	F	75	90
PSM	STAGDTHLGGEDFDNR	31	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=1410	24.73	2	1724.7814	1724.7814	K	M	221	237
PSM	TAFQEALDAAGDK	32	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2782	37.287	2	1403.7569	1403.7569	K	L	9	22
PSM	IQALQQQADEAEDR	33	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=1636	26.657	2	1647.8276	1647.8276	K	A	14	28
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	34	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2468	34.208	3	2685.0632	2685.0632	K	M	446	470
PSM	DNLTLWTSDTQGDEAEAGEGGEN	35	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510	ms_run[1]:scan=4176	52.58638166666667	2	2442.0433	2442.0514	R	-	223	246
PSM	DNLTLWTSDMQGDGEEQNK	36	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3318	43.09	2	2264.0539	2264.0539	R	E	204	223
PSM	ELISNSSDALDK	37	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1904	28.904	2	1358.7566	1358.7566	R	I	47	59
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	38	sp|O95714|HERC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=2943	38.758	3	3088.3094	3088.3094	K	N	1928	1956
PSM	SYELPDGQVITIGNER	39	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4018	50.849	2	1823.9478	1823.9478	K	F	239	255
PSM	FSVCVLGDQQHCDEAK	40	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,4-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=3176	41.287	3	2039.9118	2039.9118	K	A	63	79
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	41	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=1874	28.65	3	2826.1852	2826.1852	R	E	418	442
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	42	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4226	53.209	3	2995.386	2995.3860	R	G	2913	2938
PSM	KEESEESDDDMGFGLFD	43	sp|P05386-2|RLA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=3707	47.258	2	2032.8732	2032.8732	K	-	73	90
PSM	LAPDYDALDVANK	44	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3104	40.42	2	1471.8195	1471.8195	R	I	140	153
PSM	AVTEQGAELSNEER	45	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1200	22.746	2	1565.7745	1565.7745	K	N	28	42
PSM	EDQTEYLEER	46	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1651	26.77	2	1344.6258	1344.6258	K	R	192	202
PSM	ESEDKPEIEDVGSDEEEEK	47	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=1736	27.517	3	2294.1022	2294.1022	K	K	251	270
PSM	NNSGEEFDCAFR	48	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2383	33.276	2	1478.6309	1478.6309	R	L	355	367
PSM	RVSVCAETYNPDEEEEDTDPR	49	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2317	32.652	3	2624.0798	2624.0798	R	V	97	118
PSM	TAENATSGETLEENEAGD	50	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1625	26.569	2	1870.8128	1870.8128	K	-	323	341
PSM	TTPSYVAFTDTER	51	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2759	37.099	2	1520.7571	1520.7571	R	L	37	50
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	52	sp|O95714|HERC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[1]:scan=2943	38.75793833333333	3	3088.3006	3088.3089	K	N	1928	1956