MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100628_005MAP2K3.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100628_005MAP2K3.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	228-UNIMOD:510	0.09	43.0	4	1	0
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	40.0	1	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	230-UNIMOD:510,232-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	204-UNIMOD:510,213-UNIMOD:35,222-UNIMOD:510,223-UNIMOD:510	0.13	39.0	4	2	1
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	75-UNIMOD:510,84-UNIMOD:35	0.13	39.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	221-UNIMOD:510,37-UNIMOD:510,41-UNIMOD:21	0.06	39.0	2	2	2
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,446-UNIMOD:510,466-UNIMOD:35	0.03	38.0	2	2	2
PRT	sp|Q96S44|PRPK_HUMAN	EKC/KEOPS complex subunit TP53RK OS=Homo sapiens OX=9606 GN=TP53RK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	6-UNIMOD:510,8-UNIMOD:21,7-UNIMOD:21	0.09	38.0	4	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	38.0	null	39-UNIMOD:510,40-UNIMOD:21,43-UNIMOD:21	0.06	38.0	3	1	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	120-UNIMOD:510,123-UNIMOD:21,145-UNIMOD:510	0.11	37.0	2	1	0
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	463-UNIMOD:510,473-UNIMOD:21,482-UNIMOD:510	0.01	35.0	1	1	0
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	496-UNIMOD:510,498-UNIMOD:21,500-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,36-UNIMOD:21	0.04	34.0	2	1	0
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	14-UNIMOD:510	0.06	34.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	34.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	12-UNIMOD:510,27-UNIMOD:510,55-UNIMOD:510,63-UNIMOD:510	0.21	34.0	3	2	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	8-UNIMOD:510,23-UNIMOD:510,320-UNIMOD:510,320-UNIMOD:21,329-UNIMOD:510	0.08	33.0	2	2	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	28-UNIMOD:510	0.06	33.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	82-UNIMOD:510,94-UNIMOD:21,376-UNIMOD:510,385-UNIMOD:510	0.06	33.0	2	2	2
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	239-UNIMOD:510,19-UNIMOD:510	0.07	32.0	2	2	2
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	null	463-UNIMOD:510,475-UNIMOD:21,482-UNIMOD:510	0.01	32.0	1	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	292-UNIMOD:510,301-UNIMOD:21,306-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510,613-UNIMOD:510,617-UNIMOD:35,620-UNIMOD:35,621-UNIMOD:35,623-UNIMOD:510,492-UNIMOD:510	0.09	31.0	5	5	5
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	257-UNIMOD:510,260-UNIMOD:4,272-UNIMOD:21	0.05	31.0	1	1	0
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	31.0	1	1	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21,271-UNIMOD:21	0.04	31.0	2	1	0
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	69-UNIMOD:510,74-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4	0.20	30.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	30.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	43-UNIMOD:510,57-UNIMOD:510,175-UNIMOD:510,181-UNIMOD:21,185-UNIMOD:510,100-UNIMOD:510,105-UNIMOD:4	0.15	29.0	3	3	3
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	155-UNIMOD:510,156-UNIMOD:35,161-UNIMOD:35,164-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	29.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510	0.03	29.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	431-UNIMOD:510,113-UNIMOD:510	0.07	28.0	2	2	2
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	27.0	1	1	1
PRT	sp|P10696|PPBN_HUMAN	Alkaline phosphatase, germ cell type OS=Homo sapiens OX=9606 GN=ALPG PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510	0.03	27.0	1	1	1
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	14-UNIMOD:510	0.06	27.0	2	1	0
PRT	sp|Q13158|FADD_HUMAN	FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	190-UNIMOD:510,193-UNIMOD:35,194-UNIMOD:21,196-UNIMOD:35	0.10	27.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	33-UNIMOD:510,40-UNIMOD:21,54-UNIMOD:510,44-UNIMOD:21	0.05	27.0	2	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	26.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	47-UNIMOD:510,53-UNIMOD:21,58-UNIMOD:510,547-UNIMOD:510,558-UNIMOD:510,192-UNIMOD:510	0.05	26.0	3	3	3
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	172-UNIMOD:510,180-UNIMOD:21,161-UNIMOD:510,171-UNIMOD:510	0.12	26.0	2	2	2
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	100-UNIMOD:510,102-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	158-UNIMOD:510,160-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	25-UNIMOD:510,34-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|P46734-3|MP2K3_HUMAN	Isoform 2 of Dual specificity mitogen-activated protein kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP2K3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	285-UNIMOD:510,291-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	340-UNIMOD:510,344-UNIMOD:21,353-UNIMOD:510	0.04	25.0	1	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	235-UNIMOD:510,241-UNIMOD:21,247-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	250-UNIMOD:510,251-UNIMOD:510,252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4,281-UNIMOD:510,237-UNIMOD:510,241-UNIMOD:21,246-UNIMOD:510	0.05	24.0	2	2	2
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	30-UNIMOD:510,38-UNIMOD:21,41-UNIMOD:510	0.09	24.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	97-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|Q9BTA9-5|WAC_HUMAN	Isoform 4 of WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	420-UNIMOD:510,422-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	379-UNIMOD:510,387-UNIMOD:21,129-UNIMOD:510,133-UNIMOD:21	0.07	24.0	2	2	2
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	74-UNIMOD:510,76-UNIMOD:35	0.11	23.0	2	1	0
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	8-UNIMOD:510	0.07	22.0	1	1	1
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	414-UNIMOD:510,418-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	542-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q15052-2|ARHG6_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	333-UNIMOD:510,334-UNIMOD:21,341-UNIMOD:510,333-UNIMOD:35	0.02	22.0	2	1	0
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	576-UNIMOD:510,578-UNIMOD:21,580-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	301-UNIMOD:510,303-UNIMOD:21,311-UNIMOD:510	0.03	22.0	1	1	0
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	87-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	184-UNIMOD:510,194-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	58-UNIMOD:510,62-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	871-UNIMOD:510,885-UNIMOD:21,886-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	3-UNIMOD:510,8-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	186-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 3 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	125-UNIMOD:510,127-UNIMOD:21,136-UNIMOD:4,137-UNIMOD:510	0.08	21.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	165-UNIMOD:510,170-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q13247-3|SRSF6_HUMAN	Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	301-UNIMOD:510,303-UNIMOD:21,311-UNIMOD:510	0.04	21.0	2	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	305-UNIMOD:510,307-UNIMOD:21,318-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	815-UNIMOD:510,817-UNIMOD:21,819-UNIMOD:21,813-UNIMOD:510,813-UNIMOD:21	0.03	21.0	2	2	2
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	82-UNIMOD:510,92-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	462-UNIMOD:510,468-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	26-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	689-UNIMOD:510,693-UNIMOD:4,697-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	1644-UNIMOD:510,1648-UNIMOD:21,1664-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|Q99759|M3K3_HUMAN	Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	335-UNIMOD:510,337-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	107-UNIMOD:510,109-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	569-UNIMOD:510,576-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	571-UNIMOD:510,573-UNIMOD:21,584-UNIMOD:510	0.03	20.0	1	1	0
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	223-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|Q6PCE3|PGM2L_HUMAN	Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	166-UNIMOD:510,175-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	104-UNIMOD:510,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:510	0.12	19.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	96-UNIMOD:510	0.09	19.0	1	1	1
PRT	sp|P55786-2|PSA_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	753-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	76-UNIMOD:510,86-UNIMOD:35	0.11	19.0	1	1	1
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	519-UNIMOD:510,521-UNIMOD:21,532-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	130-UNIMOD:510,142-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	91-UNIMOD:510,94-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|Q6GYQ0-3|RGPA1_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	1047-UNIMOD:510,1051-UNIMOD:21,1060-UNIMOD:35,1063-UNIMOD:510	0.02	19.0	1	1	0
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	63-UNIMOD:510,97-UNIMOD:510	0.06	19.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	9-UNIMOD:510	0.10	19.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	102-UNIMOD:510,113-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	273-UNIMOD:510,279-UNIMOD:21,281-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q6GYQ0|RGPA1_HUMAN	Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	1000-UNIMOD:510,1006-UNIMOD:21,1013-UNIMOD:35,1016-UNIMOD:510	0.01	19.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=4197	49.552	2	2226.9361	2226.9361	R	-	228	248
PSM	DSSTSPGDYVLSVSENSR	2	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3946	46.744	2	2012.8788	2012.8788	R	V	39	57
PSM	SSSPAPADIAQTVQEDLR	3	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4497	53.388	2	1997.9519	1997.9519	K	T	230	248
PSM	DNLTLWTSDMQGDGEEQNK	4	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3475	41.441	2	2264.0539	2264.0539	R	E	204	223
PSM	DWEDDSDEDMSNFDR	5	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2782	34.546	2	1924.7117	1924.7117	K	F	75	90
PSM	STAGDTHLGGEDFDNR	6	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=1678	24.822	2	1724.7814	1724.7814	K	M	221	237
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	7	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2240	29.438	3	2847.2212	2847.2212	K	M	445	470
PSM	ATTPADGEEPAPEAEALAAAR	8	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3392	40.42434	2	2150.9915	2150.9940	R	E	6	27
PSM	DSSTSPGDYVLSVSENSR	9	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3946	46.74437833333333	2	2012.8771	2012.8783	R	V	39	57
PSM	DNLTLWTSDQQDDDGGEGNN	10	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=4103	48.53	2	2226.9361	2226.9361	R	-	228	248
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	11	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3631	43.172	3	3090.3451	3090.3451	K	E	120	146
PSM	ATTPADGEEPAPEAEALAAAR	12	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3392	40.424	2	2150.9945	2150.9945	R	E	6	27
PSM	DSSTSPGDYVLSVSENSR	13	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3946	46.74437833333333	2	2012.877579	2012.878828	R	V	39	57
PSM	AGEEDEGEEDSDSDYEISAK	14	sp|A2RRP1-2|NBAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2251	29.517	2	2321.9221	2321.9221	R	A	463	483
PSM	QRSPSPAPAPAPAAAAGPPTR	15	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=1549	23.727	3	2161.0295	2161.0295	R	K	496	517
PSM	GILAADESTGSIAK	16	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2609	32.79	2	1479.7858	1479.7858	K	R	29	43
PSM	IQALQQQADEAEDR	17	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=1871	26.342	2	1647.8276	1647.8276	K	A	14	28
PSM	KEESEESDDDMGFGLFD	18	sp|P05386-2|RLA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=3886	46.035	2	2032.8732	2032.8732	K	-	73	90
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	19	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=2130	28.497	3	2701.0581	2701.0581	K	M	446	470
PSM	TITLEVEPSDTIENVK	20	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=3678	43.72	2	1855.0463	1855.0463	K	A	12	28
PSM	LIAPVAEEEATVPNNK	21	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2714	33.858	2	1762.0149	1762.0149	K	I	8	24
PSM	SVTEQGAELSNEER	22	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=1509	23.432	2	1581.7695	1581.7695	K	N	28	42
PSM	VDATEESDLAQQYGVR	23	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2677	33.492	2	1893.857	1893.8570	K	G	82	98
PSM	SYELPDGQVITIGNER	24	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=4207	49.628	2	1823.9478	1823.9478	K	F	239	255
PSM	AGEEDEGEEDSDSDYEISAK	25	sp|A2RRP1|NBAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=2251	29.517090000000003	2	2321.9158	2321.9215	R	A	463	483
PSM	NPDDITQEEYGEFYK	26	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3409	40.601	2	1994.8823	1994.8823	R	S	292	307
PSM	QENCGAQQVPAGPGTSTPPSSPVR	27	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,4-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=2218	29.274	3	2535.1637	2535.1637	R	T	257	281
PSM	TAFQEALDAAGDK	28	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2986	36.362	2	1403.7569	1403.7569	K	L	9	22
PSM	QENCGAQQVPAGPGTSTPPSSPVR	29	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=2218	29.274076666666666	3	2535.1598	2535.1632	R	T	257	281
PSM	GILAADESTGSIAK	30	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2609	32.789590000000004	2	1479.785376	1479.785825	K	R	29	43
PSM	AFGESSTESDEEEEEGCGHTHCVR	31	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=1532	23.603	3	2852.0751	2852.0751	R	G	69	93
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	32	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4350	51.437	3	2995.386	2995.3860	R	G	2913	2938
PSM	DLADELALVDVIEDK	33	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=5483	68.858	2	1724.972	1724.9720	K	L	43	58
PSM	EMNDAAMFYTNR	34	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:35,7-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=2052	27.874	2	1607.621	1607.6210	K	V	155	167
PSM	ESLKEEDESDDDNM	35	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=998	18.886	2	1738.7364	1738.7364	K	-	235	249
PSM	EVDEQMLNVQNK	36	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1630	24.426	2	1529.8032	1529.8032	K	N	325	337
PSM	DYEEVGADSADGEDEGEEY	37	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=3195	38.468	2	2111.8027	2111.8027	K	-	431	450
PSM	FASENDLPEWK	38	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3839	45.52	2	1482.7068	1482.7068	R	E	58	69
PSM	DVIELTDDSFDK	39	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3954	46.831	2	1463.7668	1463.7668	K	N	158	170
PSM	ELISNASDALDK	40	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2577	32.541	2	1342.7616	1342.7616	R	I	42	54
PSM	HVPDSGATATAYLCGVK	41	sp|P10696|PPBN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=3100	37.476	2	1893.9332	1893.9332	K	G	107	124
PSM	IQVLQQQADDAEER	42	sp|P06753-4|TPM3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=2184	28.979	2	1675.8589	1675.8589	K	A	14	28
PSM	SGAMSPMSWNSDASTSEAS	43	sp|Q13158|FADD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:35,5-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=2415	31.138	2	2047.76	2047.7600	R	-	190	209
PSM	AAVPSGASTGIYEALELRDNDK	44	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,8-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=3922	46.436575	3	2424.2198	2424.2205	R	T	33	55
PSM	QENCGAQQVPAGPGTSTPPSSPVR	45	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,4-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=2218	29.274076666666666	3	2535.160355	2535.163734	R	T	257	281
PSM	AFLAELEQNSPK	46	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3645	43.355	2	1493.7803	1493.7803	K	I	2424	2436
PSM	ELISNSSDALDK	47	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2500	31.833	2	1438.7229	1438.7229	R	I	47	59
PSM	NVIGLQMGTNR	48	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3134	37.811	2	1315.6532	1315.6532	K	G	172	183
PSM	SSSPVQVEEEPVR	49	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1952	26.977	2	1555.7343	1555.7343	R	L	100	113
PSM	SSTPLPTISSSAENTR	50	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2424	31.203	2	1760.8406	1760.8406	R	Q	158	174
PSM	EGLELPEDEEEK	51	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2648	33.252	2	1483.7566	1483.7566	K	K	547	559
PSM	EQFLDGDGWTSR	52	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3675	43.699	2	1523.6506	1523.6506	K	W	25	37
PSM	QVVEEPSPQLPADR	53	sp|P46734-3|MP2K3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2543	32.181	2	1677.8187	1677.8187	K	F	285	299
PSM	SGSSSPDSEITELK	54	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2755	34.233	2	1583.7604	1583.7604	R	F	340	354
PSM	VPTANVSVVDLTCR	55	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3480	41.478	2	1643.8166	1643.8166	R	L	235	249
PSM	DSSTSPGDYVLSVSENSR	56	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3951	46.807961666666664	3	2012.8782	2012.8783	R	V	39	57
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	57	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4,32-UNIMOD:510	ms_run[2]:scan=4329	51.115	4	4015.8382	4015.8382	R	I	250	282
PSM	DNLTLWTSDMQGDGEEQNK	58	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3467	41.354	3	2264.0539	2264.0539	R	E	204	223
PSM	EALQDVEDENQ	59	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2092	28.219	2	1322.605	1322.6050	K	-	223	234
PSM	ESVPEFPLSPPK	60	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3960	46.901	2	1473.7793	1473.7793	K	K	30	42
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	61	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,26-UNIMOD:510	ms_run[2]:scan=3373	40.231	3	3010.3787	3010.3787	K	E	120	146
PSM	LVQDVANNTNEEAGDGTTTATVLAR	62	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2749	34.174	3	2593.3044	2593.3044	K	S	97	122
PSM	SIYYITGESK	63	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2578	32.548	2	1227.7023	1227.7023	K	E	482	492
PSM	SPSPGPNHTSNSSNASNATVVPQNSSAR	64	sp|Q9BTA9-5|WAC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1205	20.868	3	2878.3055	2878.3055	R	S	420	448
PSM	TTPSYVAFTDTER	65	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2847	35.149	2	1600.7234	1600.7234	R	L	37	50
PSM	VLPGVDALSNI	66	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4890	59.64	2	1210.6423	1210.6423	K	-	379	390
PSM	DNLTLWTSDMQGDGEEQNK	67	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4028	47.671	3	2248.059	2248.0590	R	E	204	223
PSM	EGMNIVEAMER	68	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=3588	42.763	2	1311.6375	1311.6375	K	F	74	85
PSM	LGDVYVNDAFGTAHR	69	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3281	39.369	3	1747.8143	1747.8143	K	A	129	144
PSM	NFSDNQLQEGK	70	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1689	24.905	2	1346.7103	1346.7103	R	N	161	172
PSM	DNLTLWTSDQQDDDGGEGNN	71	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4199	49.568	3	2226.9361	2226.9361	R	-	228	248
PSM	DVNQQEFVR	72	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1976	27.168	2	1167.6097	1167.6097	K	A	8	17
PSM	EIIDLVLDR	73	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4173	49.255	2	1118.6759	1118.6759	K	I	113	122
PSM	EQFLDGDGWTSR	74	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3400	40.534	2	1443.6843	1443.6843	K	W	25	37
PSM	ERDHSPTPSVFNSDEER	75	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1707	25.036	3	2114.9119	2114.9119	R	Y	414	431
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	76	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2042	27.785	3	2826.1852	2826.1852	R	E	418	442
PSM	GYFEYIEENK	77	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3451	41.128	2	1438.6694	1438.6694	R	Y	237	247
PSM	HGSYEDAVHSGALND	78	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1758	25.431	2	1604.7279	1604.7279	K	-	542	557
PSM	MSGFIYQGK	79	sp|Q15052-2|ARHG6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3187	38.397	2	1177.5879	1177.5879	R	I	333	342
PSM	RLSQSDEDVIR	80	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1733	25.231	2	1430.6979	1430.6979	K	L	119	130
PSM	TRSPSPDDILER	81	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2722	33.93	2	1578.6904	1578.6904	R	V	576	588
PSM	DNSTMGYMMAK	82	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:510	ms_run[1]:scan=857	17.140571666666666	2	1363.6074	1363.6089	R	K	613	624
PSM	SNSPLPVPPSK	83	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2157	28.69671333333333	2	1269.7000	1269.7001	R	A	301	312
PSM	AAVPSGASTGIYEALELRDNDK	84	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=3922	46.437	3	2424.221	2424.2210	R	T	33	55
PSM	ATTPADGEEPAPEAEALAAAR	85	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3389	40.402	3	2150.9945	2150.9945	R	E	6	27
PSM	DLFDPIIEDR	86	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=4433	52.561	2	1265.6716	1265.6716	K	H	87	97
PSM	DSSDSADGRATPSENLVPSSAR	87	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2221	29.296	3	2332.0392	2332.0392	R	V	184	206
PSM	DYLLCDYNR	88	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:4	ms_run[2]:scan=3354	40.053	2	1264.597	1264.5970	K	D	58	67
PSM	EGMNIVEAMER	89	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:35	ms_run[2]:scan=2726	33.96	2	1327.6324	1327.6324	K	F	74	85
PSM	EQVANSAFVER	90	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1715	25.096	2	1282.673	1282.6730	K	V	492	503
PSM	EYIPGQPPLSQSSDSSPTR	91	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3029	36.765	2	2158.9996	2158.9996	K	N	871	890
PSM	FNPFVTSDR	92	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3622	43.092	2	1195.5487	1195.5487	K	S	3	12
PSM	GDRSEDFGVNEDLADSDAR	93	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2683	33.562	3	2100.9408	2100.9408	K	A	186	205
PSM	IIYGGSVTGATCK	94	sp|P60174-4|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1830	25.994	2	1473.7575	1473.7575	R	E	125	138
PSM	NFEDVAFDEK	95	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3145	37.974	2	1280.6561	1280.6561	K	K	376	386
PSM	SADTLWDIQK	96	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3879	45.982	2	1323.6748	1323.6748	K	D	320	330
PSM	SFDWGYEER	97	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3390	40.41	2	1301.5178	1301.5178	R	S	165	174
PSM	SNSPLPVPPSK	98	sp|Q13247-3|SRSF6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1878	26.395	2	1269.7006	1269.7006	R	A	301	312
PSM	SRSPESQVIGENTK	99	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1321	21.884	2	1678.8564	1678.8564	R	Q	305	319
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	100	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2776	34.487	3	2528.1522	2528.1522	R	L	815	839
PSM	YALYDATYETK	101	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2805	34.768	2	1404.7449	1404.7449	R	E	82	93
PSM	YEQGTGCWQGPNR	102	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=1686	24.882	2	1585.7156	1585.7156	K	S	462	475
PSM	VEIIANDQGNR	103	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=1534	23.617528333333333	2	1261.6828	1261.6834	K	T	26	37
PSM	DNLTLWTSDQQDDDGGEGNN	104	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=4269	50.373668333333335	2	2227.933709	2226.936145	R	-	228	248
PSM	ATTPADGEEPAPEAEALAAAR	105	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3389	40.40224166666667	3	2150.9937	2150.9940	R	E	6	27
PSM	EYIPGQPPLSQSSDSSPTR	106	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=3029	36.765431666666665	2	2158.9965	2158.9991	K	N	871	890
PSM	AGFAGDDAPR	107	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1167	20.542	2	1009.5041	1009.5041	K	A	19	29
PSM	EGALCEENMR	108	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=936	18.144	2	1257.5542	1257.5542	K	G	689	699
PSM	GRGPSPEGSSSTESSPEHPPK	109	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=916	17.932	3	2254.054	2254.0540	K	S	1644	1665
PSM	LRSADSENALSVQER	110	sp|Q99759|M3K3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1768	25.504	3	1787.8627	1787.8627	R	N	335	350
PSM	QASTDAGTAGALTPQHVR	111	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1656	24.618	3	1893.9158	1893.9158	R	A	107	125
PSM	QRIDEFESM	112	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3202	38.547	2	1267.5368	1267.5368	K	-	569	578
PSM	TITLEVEPSDTIENVK	113	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=3681	43.743	3	1855.0463	1855.0463	K	A	12	28
PSM	TLSDYNIQK	114	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=1899	26.555	2	1148.6714	1148.6714	R	E	55	64
PSM	SGSSSPDSEITELK	115	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2755	34.23302833333333	2	1583.759811	1583.760398	R	F	571	585
PSM	ATAGDTHLGGEDFDNR	116	sp|P48741|HSP77_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1700	24.984	3	1708.7865	1708.7865	K	L	223	239
PSM	AVAGVMITASHNR	117	sp|Q6PCE3|PGM2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1860	26.259	3	1439.7169	1439.7169	K	K	166	179
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	118	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=3220	38.734	4	3527.556	3527.5560	K	L	104	135
PSM	DGNGYISAAELR	119	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2901	35.72	2	1298.6679	1298.6679	K	H	96	108
PSM	DNWEELYNR	120	sp|P55786-2|PSA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=3339	39.944	2	1271.5995	1271.5995	K	Y	753	762
PSM	DSLLQDGEFSMDLR	121	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=3977	47.054	2	1674.7983	1674.7983	R	T	76	90
PSM	DVTPPPETEVVLIK	122	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4144	48.936	2	1683.9372	1683.9372	K	N	519	533
PSM	EDQTEYLEER	123	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1859	26.252	2	1344.6258	1344.6258	K	R	192	202
PSM	EFHLNESGDPSSK	124	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=1726	25.179	3	1513.7685	1513.7685	K	S	130	143
PSM	GDFCIQVGR	125	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=2707	33.781	2	1084.5548	1084.5548	R	N	91	100
PSM	IQVLQQQADDAEER	126	sp|P06753-4|TPM3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1873	26.357	2	1641.7958	1641.7958	K	A	14	28
PSM	MSGFIYQGK	127	sp|Q15052-2|ARHG6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:35,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2430	31.247	2	1193.5828	1193.5828	R	I	333	342
PSM	QVVESAYEVIK	128	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2833	35.018	2	1411.7636	1411.7636	K	L	175	186
PSM	SNSPLPVPPSK	129	sp|Q13247-3|SRSF6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2197	29.089	2	1269.7006	1269.7006	R	A	301	312
PSM	SQTPSPSTLNIDHMEQK	130	sp|Q6GYQ0-3|RGPA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:35,17-UNIMOD:510	ms_run[2]:scan=1973	27.146	3	2075.9871	2075.9871	R	D	1047	1064
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK	131	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,35-UNIMOD:510	ms_run[2]:scan=910	17.859	4	3048.3215	3048.3215	K	T	63	98
PSM	TPVEPEVAIHR	132	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1741	25.291	3	1280.7301	1280.7301	K	I	9	20
PSM	TWNDPSVQQDIK	133	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2521	31.988	2	1497.81	1497.8100	R	F	102	114
PSM	VIGSGCNLDSAR	134	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1384	22.438	2	1281.656	1281.6560	R	F	100	112
PSM	SRSRSPTPPSSAGLGSNSAPPIPDSR	135	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=2725	33.95236166666666	3	2851.2481	2851.2511	R	L	813	839
PSM	GEPNVSYICSR	136	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=2334	30.402596666666668	2	1394.6101	1394.6109	R	Y	273	284
PSM	SQTPSPSTLNIDHMEQK	137	sp|Q6GYQ0|RGPA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:35,17-UNIMOD:510	ms_run[1]:scan=1973	27.14622	3	2075.9848	2075.9866	R	D	1000	1017