MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100511_029DDR1.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100511_029DDR1.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	45.0	null	228-UNIMOD:510,29-UNIMOD:510	0.15	45.0	6	2	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	204-UNIMOD:510,222-UNIMOD:510	0.09	40.0	2	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	223-UNIMOD:510,28-UNIMOD:510	0.16	40.0	2	2	2
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	221-UNIMOD:510,37-UNIMOD:510,41-UNIMOD:21	0.06	40.0	2	2	2
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	40.0	null	431-UNIMOD:510,432-UNIMOD:21	0.05	40.0	1	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	203-UNIMOD:510,221-UNIMOD:510	0.05	38.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	292-UNIMOD:510,305-UNIMOD:21,306-UNIMOD:510,301-UNIMOD:21,379-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,492-UNIMOD:510,482-UNIMOD:510,484-UNIMOD:21,491-UNIMOD:510	0.11	38.0	8	6	5
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	180-UNIMOD:510,182-UNIMOD:21,183-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	396-UNIMOD:510,397-UNIMOD:21	0.05	36.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	239-UNIMOD:510,360-UNIMOD:510	0.08	35.0	2	2	2
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	null	225-UNIMOD:510	0.09	35.0	1	1	0
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	228-UNIMOD:510	0.08	33.0	1	1	1
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	75-UNIMOD:510,84-UNIMOD:35	0.13	32.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	325-UNIMOD:510,336-UNIMOD:510,330-UNIMOD:35,47-UNIMOD:510,50-UNIMOD:21,58-UNIMOD:510	0.06	31.0	3	2	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	39-UNIMOD:510,40-UNIMOD:21,42-UNIMOD:21	0.06	31.0	2	1	0
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	44-UNIMOD:510,48-UNIMOD:21,54-UNIMOD:21,55-UNIMOD:21	0.10	30.0	2	1	0
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	null	431-UNIMOD:510,432-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	223-UNIMOD:510	0.05	29.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	39-UNIMOD:510,43-UNIMOD:21	0.09	29.0	1	1	0
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	29.0	1	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	142-UNIMOD:510,142-UNIMOD:21,153-UNIMOD:4,157-UNIMOD:510,11-UNIMOD:510,14-UNIMOD:21	0.11	29.0	3	2	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	98-UNIMOD:510,108-UNIMOD:35	0.16	29.0	1	1	0
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	129-UNIMOD:510,130-UNIMOD:21,144-UNIMOD:510,133-UNIMOD:21	0.07	28.0	2	1	0
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	193-UNIMOD:510	0.12	28.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	223-UNIMOD:510	0.09	28.0	1	1	0
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	1153-UNIMOD:510	0.02	28.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	237-UNIMOD:510,237-UNIMOD:4,243-UNIMOD:21,249-UNIMOD:510	0.02	27.0	1	1	1
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	446-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	70-UNIMOD:510,76-UNIMOD:21,78-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|Q8NC51-2|PAIRB_HUMAN	Isoform 2 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	235-UNIMOD:510,246-UNIMOD:21,267-UNIMOD:510	0.08	27.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	494-UNIMOD:510,495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21,521-UNIMOD:510	0.05	27.0	1	1	1
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	1573-UNIMOD:510,1576-UNIMOD:21,1584-UNIMOD:510	0.01	26.0	1	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	47-UNIMOD:510,58-UNIMOD:510,300-UNIMOD:510,309-UNIMOD:21,313-UNIMOD:21,314-UNIMOD:510,500-UNIMOD:510	0.06	26.0	3	3	3
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	14-UNIMOD:510	0.06	26.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	8-UNIMOD:510,23-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	95-UNIMOD:510,95-UNIMOD:21,106-UNIMOD:510	0.09	26.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	125-UNIMOD:510	0.01	25.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	200-UNIMOD:510,213-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	110-UNIMOD:510,116-UNIMOD:21,120-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	1573-UNIMOD:510,1575-UNIMOD:21,1584-UNIMOD:510	0.00	25.0	1	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	104-UNIMOD:510,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:510	0.12	24.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	140-UNIMOD:510,144-UNIMOD:21,152-UNIMOD:510	0.09	24.0	1	1	1
PRT	sp|O60266|ADCY3_HUMAN	Adenylate cyclase type 3 OS=Homo sapiens OX=9606 GN=ADCY3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	309-UNIMOD:21,310-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|P55786-2|PSA_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	753-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	82-UNIMOD:510,89-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|O00469-3|PLOD2_HUMAN	Isoform 3 of Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	101-UNIMOD:510,104-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	100-UNIMOD:510,105-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	223-UNIMOD:510,237-UNIMOD:4	0.10	22.0	1	1	1
PRT	sp|Q9BQA1-2|MEP50_HUMAN	Isoform 2 of Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	116-UNIMOD:510,122-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	40-UNIMOD:510,53-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	137-UNIMOD:510,143-UNIMOD:21,150-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	301-UNIMOD:510,312-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	22.0	1	1	1
PRT	sp|Q15375-2|EPHA7_HUMAN	Isoform 2 of Ephrin type-A receptor 7 OS=Homo sapiens OX=9606 GN=EPHA7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	602-UNIMOD:510,603-UNIMOD:21,608-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	50-UNIMOD:510,61-UNIMOD:510,64-UNIMOD:21	0.04	22.0	2	2	2

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	45.0	1-UNIMOD:510	ms_run[1]:scan=3550	48.305748333333334	2	2226.934351	2226.936145	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	2	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3402	46.385	2	2248.059	2248.0590	R	E	204	223
PSM	DNLTLWTSDTQGDEAEAGEGGEN	3	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=3585	48.75	2	2442.0519	2442.0519	R	-	223	246
PSM	STAGDTHLGGEDFDNR	4	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=1340	24.496	2	1724.7814	1724.7814	K	M	221	237
PSM	DYEEVGVDSVEGEGEEEGEEY	5	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3465	47.263684999999995	2	2461.9233	2461.9265	K	-	431	452
PSM	DNLTLWTSDQQDDDGGEGNN	6	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:510	ms_run[1]:scan=3469	47.295964999999995	2	2226.9331	2226.9356	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	7	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=3735	50.859	2	2226.9361	2226.9361	R	-	228	248
PSM	DATNVGDEGGFAPNILENK	8	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3286	44.822	2	2028.0436	2028.0436	K	E	203	222
PSM	NPDDITQEEYGEFYK	9	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2969	40.952	2	1994.8823	1994.8823	R	S	292	307
PSM	INSSGESGDESDEFLQSR	10	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2466	35.263	2	2069.8639	2069.8639	R	K	180	198
PSM	DNLTLWTSDQQDDDGGEGNN	11	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:510	ms_run[1]:scan=3632	49.387025	2	2226.934351	2226.936145	R	-	228	248
PSM	DYEEVGVDSVEGEGEEEGEEY	12	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=3381	46.114	2	2381.9607	2381.9607	K	-	396	417
PSM	INSSGESGDESDEFLQSR	13	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=2466	35.26347833333333	2	2069.8626	2069.8634	R	K	180	198
PSM	SVTEQGAELSNEER	14	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=1212	23.424	2	1581.7695	1581.7695	K	N	28	42
PSM	SYELPDGQVITIGNER	15	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=3529	48.046	2	1823.9478	1823.9478	K	F	239	255
PSM	DNLTLWTSENQGDEGDAGEGEN	16	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:510	ms_run[1]:scan=3446	47.053023333333336	2	2384.0068	2384.0095	R	-	225	247
PSM	NPDDITQEEYGEFYK	17	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2883	39.841	2	2074.8486	2074.8486	R	S	292	307
PSM	DNLTLWTSDQQDDDGGEGNN	18	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:510	ms_run[1]:scan=3552	48.320945	3	2226.936401	2226.936145	R	-	228	248
PSM	DNLTLWTSDQQDEEAGEGN	19	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=3512	47.849	2	2154.9402	2154.9402	R	-	228	247
PSM	DWEDDSDEDMSNFDR	20	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2372	34.34	2	1924.7117	1924.7117	K	F	75	90
PSM	DYEEVGVDSVEGEGEEEGEEY	21	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3466	47.271	3	2461.927	2461.9270	K	-	396	417
PSM	EVDEQMLNVQNK	22	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2076	31.166	2	1513.8083	1513.8083	K	N	325	337
PSM	DSSTSPGDYVLSVSENSR	23	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3352	45.65451333333333	2	2012.8782	2012.8783	R	V	39	57
PSM	ELAPYDENWFYTR	24	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3982	54.798	2	1896.7585	1896.7585	K	A	44	57
PSM	EVDEQMLNVQNK	25	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1305	24.218	2	1529.8032	1529.8032	K	N	325	337
PSM	NNSGEEFDCAFR	26	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2182	32.231	2	1478.6309	1478.6309	R	L	355	367
PSM	DYEEVGADSADGEDEGEEY	27	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=2714	37.79353833333333	2	2191.767967	2191.769062	K	-	431	450
PSM	ATAGDTHLGGEDFDNR	28	sp|P48741|HSP77_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=1372	24.757	2	1708.7865	1708.7865	K	L	223	239
PSM	DSSTSPGDYVLSVSENSR	29	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3352	45.655	2	2012.8788	2012.8788	R	V	39	57
PSM	KEESEESDDDMGFGLFD	30	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=3281	44.779	2	2032.8732	2032.8732	K	-	73	90
PSM	NPDDITQEEYGEFYK	31	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=2952	40.739	2	1914.916	1914.9160	R	S	292	307
PSM	YADLTEDQLPSCESLK	32	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2876	39.785	2	2015.9435	2015.9435	R	D	142	158
PSM	KEESEESDDDMGFGLFD	33	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[1]:scan=3281	44.77924166666667	2	2032.8722	2032.8727	K	-	98	115
PSM	DSSTSPGDYVLSVSENSR	34	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=3352	45.65451333333333	2	2012.878733	2012.878828	R	V	39	57
PSM	ASGNYATVISHNPETK	35	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1238	23.631	2	1835.9091	1835.9091	R	K	129	145
PSM	DNLTLWTADNAGEEGGEAPQEPQS	36	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=3587	48.765	3	2562.157	2562.1570	R	-	193	217
PSM	DNLTLWTSENQGDEGDAGEGEN	37	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=3452	47.117	3	2384.01	2384.0100	R	-	223	245
PSM	IAQLEEELEEEQGNTELINDR	38	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=3434	46.882	3	2505.2295	2505.2295	R	L	1153	1174
PSM	GVVDSEDLPLNISR	39	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510	ms_run[1]:scan=3023	41.53270166666667	2	1546.8403	1546.8410	R	E	379	393
PSM	ASGNYATVISHNPETK	40	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=1238	23.630815	2	1835.9078	1835.9086	R	K	129	145
PSM	ELAPYDENWFYTR	41	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=3982	54.797880000000006	2	1896.758976	1896.758516	K	A	44	57
PSM	CEFQDAYVLLSEK	42	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3720	50.68	2	1748.8369	1748.8369	K	K	237	250
PSM	DNLTLWTSDMQGDGEEQNK	43	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3400	46.37	3	2248.059	2248.0590	R	E	204	223
PSM	EGLELPEDEEEK	44	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2204	32.483	2	1483.7566	1483.7566	K	K	539	551
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	45	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2191	32.346	3	2685.0632	2685.0632	K	M	446	470
PSM	NVDGVNYASITR	46	sp|Q9UBR2|CATZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1979	30.286	2	1421.6764	1421.6764	R	N	70	82
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	47	sp|Q8NC51-2|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:21,33-UNIMOD:510	ms_run[2]:scan=2628	36.896	4	3922.7331	3922.7331	K	E	235	268
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	48	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510	ms_run[2]:scan=909	20.529	4	3246.2875	3246.2875	R	K	494	522
PSM	TTPSYVAFTDTER	49	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2344	34.049	2	1600.7234	1600.7234	R	L	37	50
PSM	DGTYAVTYIPDK	50	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2570	36.232	2	1489.7378	1489.7378	K	T	1573	1585
PSM	ELISNASDALDK	51	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2125	31.676	2	1342.7616	1342.7616	R	I	42	54
PSM	ELISNSSDALDK	52	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1729	27.86	2	1358.7566	1358.7566	R	I	47	59
PSM	IQALQQQADEAEDR	53	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1521	26.04	2	1647.8276	1647.8276	K	A	14	28
PSM	LIAPVAEEEATVPNNK	54	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2212	32.561	2	1762.0149	1762.0149	K	I	8	24
PSM	YSQVLANGLDNK	55	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1974	30.228	2	1468.7599	1468.7599	K	L	95	107
PSM	DNNQFASASLDR	56	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1822	28.767	2	1370.6639	1370.6639	K	T	125	137
PSM	DVIELTDDSFDK	57	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3333	45.412	2	1463.7668	1463.7668	K	N	158	170
PSM	ESLKEEDESDDDNM	58	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=819	19.335	2	1738.7364	1738.7364	K	-	235	249
PSM	NPDDITNEEYGEFYK	59	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2826	39.082	2	2060.833	2060.8330	R	S	300	315
PSM	TLSNAEDYLDDEDSD	60	sp|Q92882|OSTF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=3245	44.206	2	1814.6831	1814.6831	R	-	200	215
PSM	RTIAQDYGVLK	61	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=1631	26.951048333333333	2	1410.7903	1410.7903	K	A	110	121
PSM	DGTYAVTYIPDK	62	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2570	36.23201666666667	2	1489.7375	1489.7373	K	T	1573	1585
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	63	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=2666	37.261	4	3527.556	3527.5560	K	L	104	135
PSM	EQVANSAFVER	64	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1370	24.744	2	1282.673	1282.6730	K	V	492	503
PSM	HGESAWNLENR	65	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1388	24.88	2	1345.6587	1345.6587	R	F	11	22
PSM	LAPDYDALDVANK	66	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2722	37.861	2	1551.7858	1551.7858	R	I	140	153
PSM	KDESQKDQQQFNTMYMYR	67	sp|O60266|ADCY3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	13-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=3578	48.68924333333334	3	2436.0202	2434.9922	K	H	297	315
PSM	DNWEELYNR	68	sp|P55786-2|PSA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2832	39.131	2	1271.5995	1271.5995	K	Y	753	762
PSM	DQGTYEDYVEGLR	69	sp|P60660-2|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2984	41.101	2	1657.7085	1657.7085	K	V	82	95
PSM	HGESAWNLENR	70	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1813	28.681	2	1425.6251	1425.6251	R	F	11	22
PSM	NVTELNEPLSNEER	71	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2051	30.937	2	1676.843	1676.8430	K	N	29	43
PSM	SEDYVDIVQGNR	72	sp|O00469-3|PLOD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2249	33.013	2	1507.6768	1507.6768	R	V	101	113
PSM	VIGSGCNLDSAR	73	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1098	22.408	2	1281.656	1281.6560	R	F	100	112
PSM	DATNVGDEGGFAPNILENK	74	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3292	44.87	3	2028.0436	2028.0436	K	E	203	222
PSM	DNLTLWTSDSAGEECDAAEGAEN	75	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=3643	49.572	2	2488.0396	2488.0396	R	-	223	246
PSM	DQVANSAFVER	76	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1614	26.818	2	1268.6573	1268.6573	K	L	500	511
PSM	DSVFLSCSEDNR	77	sp|Q9BQA1-2|MEP50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2159	32.028	2	1461.6618	1461.6618	K	I	116	128
PSM	ISVYYNEATGGK	78	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2119	31.612	2	1448.7225	1448.7225	R	Y	47	59
PSM	LAVDEEENADNNTK	79	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=1078	22.21	2	1628.8166	1628.8166	K	A	40	54
PSM	LGAVDESLSEETQK	80	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2151	31.948	2	1652.8182	1652.8182	R	A	137	151
PSM	NNASTDYDLSDK	81	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1157	22.96	2	1409.6947	1409.6947	K	S	301	313
PSM	QEYDESGPSIVHR	82	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1237	23.624	3	1549.7585	1549.7585	K	K	360	373
PSM	SIYYITGESK	83	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2316	33.7	2	1307.6687	1307.6687	K	E	482	492
PSM	TAFQEALDAAGDK	84	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2485	35.409	2	1403.7569	1403.7569	K	L	9	22
PSM	TYIDPETYEDPNR	85	sp|Q15375-2|EPHA7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=2385	34.459	2	1805.7011	1805.7011	K	A	602	615
PSM	VEIIANDQGNR	86	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510	ms_run[1]:scan=1196	23.30022	2	1261.683522	1261.683881	R	I	50	61
PSM	ITPSYVAFTPEGER	87	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=2758	38.278265000000005	2	1679.8015	1679.8015	R	L	61	75
PSM	NVDGVNYASITR	88	sp|Q9UBR2|CATZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=1979	30.286268333333336	2	1421.676631	1421.676427	R	N	70	82