MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100723_035MAPkinase2-Erk2.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100723_035MAPkinase2-Erk2.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	46.0	null	227-UNIMOD:510,247-UNIMOD:21	0.09	46.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	228-UNIMOD:510	0.09	43.0	3	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	590-UNIMOD:510,601-UNIMOD:21,684-UNIMOD:510,691-UNIMOD:21,695-UNIMOD:21,1099-UNIMOD:510,1103-UNIMOD:21	0.03	43.0	3	3	3
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	230-UNIMOD:510,232-UNIMOD:21,230-UNIMOD:21	0.04	40.0	3	1	0
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	10-UNIMOD:510,11-UNIMOD:4,25-UNIMOD:4,29-UNIMOD:21,33-UNIMOD:21	0.03	39.0	2	1	0
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	39.0	1	1	1
PRT	sp|P17544-5|ATF7_HUMAN	Isoform 5 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	42-UNIMOD:510,53-UNIMOD:21	0.14	38.0	1	1	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	88-UNIMOD:510,101-UNIMOD:21,105-UNIMOD:510	0.06	36.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	418-UNIMOD:510,435-UNIMOD:21,441-UNIMOD:510,420-UNIMOD:35	0.05	36.0	2	1	0
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	606-UNIMOD:510,612-UNIMOD:21,616-UNIMOD:21	0.03	36.0	3	2	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	70-UNIMOD:510,81-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	207-UNIMOD:510,218-UNIMOD:35,222-UNIMOD:21,223-UNIMOD:21,86-UNIMOD:510,91-UNIMOD:510,102-UNIMOD:21	0.26	36.0	5	2	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	29-UNIMOD:510,37-UNIMOD:21,42-UNIMOD:510,36-UNIMOD:21	0.04	36.0	2	1	0
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	52-UNIMOD:510,62-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	239-UNIMOD:510,316-UNIMOD:510,318-UNIMOD:21,323-UNIMOD:21,325-UNIMOD:35,326-UNIMOD:510	0.08	35.0	2	2	2
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	2146-UNIMOD:510,2155-UNIMOD:21	0.01	35.0	2	1	0
PRT	sp|Q99081|HTF4_HUMAN	Transcription factor 12 OS=Homo sapiens OX=9606 GN=TCF12 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	55-UNIMOD:510,67-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q8N1F7-2|NUP93_HUMAN	Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	295-UNIMOD:510,299-UNIMOD:4,307-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P13807-2|GYS1_HUMAN	Isoform 2 of Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	644-UNIMOD:510,663-UNIMOD:21,657-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	257-UNIMOD:510,267-UNIMOD:21,280-UNIMOD:510	0.06	34.0	1	1	1
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	175-UNIMOD:510,181-UNIMOD:21,192-UNIMOD:510	0.01	34.0	1	1	1
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	null	77-UNIMOD:510,88-UNIMOD:21,95-UNIMOD:510	0.06	34.0	1	1	1
PRT	sp|Q9BTK6|PAGR1_HUMAN	PAXIP1-associated glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=PAGR1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	224-UNIMOD:510,237-UNIMOD:21,234-UNIMOD:21	0.07	33.0	2	1	0
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	99-UNIMOD:510,104-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|P08651-4|NFIC_HUMAN	Isoform 3 of Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	279-UNIMOD:510,290-UNIMOD:21,293-UNIMOD:510,300-UNIMOD:510,310-UNIMOD:21	0.07	33.0	2	2	1
PRT	sp|Q7Z417-2|NUFP2_HUMAN	Isoform 2 of Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	107-UNIMOD:510,117-UNIMOD:21,115-UNIMOD:35	0.13	33.0	2	1	0
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	173-UNIMOD:510,185-UNIMOD:21,187-UNIMOD:21	0.06	33.0	3	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	871-UNIMOD:510,886-UNIMOD:21,885-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	null	1203-UNIMOD:510,1211-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	29-UNIMOD:510,41-UNIMOD:21	0.00	32.0	1	1	1
PRT	sp|Q96E09|PBIR1_HUMAN	PPP2R1A-PPP2R2A-interacting phosphatase regulator 1 OS=Homo sapiens OX=9606 GN=PABIR1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	136-UNIMOD:510,143-UNIMOD:21,147-UNIMOD:21,149-UNIMOD:21	0.06	32.0	2	1	0
PRT	sp|Q96B36-2|AKTS1_HUMAN	Isoform 2 of Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	72-UNIMOD:510,82-UNIMOD:21	0.13	32.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	28-UNIMOD:510,28-UNIMOD:21	0.06	32.0	1	1	1
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	608-UNIMOD:510,621-UNIMOD:21	0.02	32.0	1	1	0
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	1034-UNIMOD:510,1038-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P13807|GYS1_HUMAN	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	null	708-UNIMOD:510,723-UNIMOD:21,727-UNIMOD:21	0.04	32.0	1	1	0
PRT	sp|P08651|NFIC_HUMAN	Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	null	312-UNIMOD:510,322-UNIMOD:21,326-UNIMOD:510	0.03	32.0	1	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	2194-UNIMOD:510,2202-UNIMOD:4,2204-UNIMOD:21,2206-UNIMOD:510,968-UNIMOD:510,974-UNIMOD:21,992-UNIMOD:510,976-UNIMOD:21	0.02	31.0	3	2	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	63-UNIMOD:510,74-UNIMOD:21,62-UNIMOD:510,76-UNIMOD:21	0.08	31.0	3	3	3
PRT	sp|P52948-4|NUP98_HUMAN	Isoform 4 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	600-UNIMOD:510,606-UNIMOD:21,587-UNIMOD:510,595-UNIMOD:21	0.03	31.0	2	2	2
PRT	sp|Q9NWS0|PIHD1_HUMAN	PIH1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PIH1D1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	187-UNIMOD:510,195-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	505-UNIMOD:510,516-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	434-UNIMOD:510,443-UNIMOD:21,437-UNIMOD:21,445-UNIMOD:21,434-UNIMOD:35	0.03	31.0	5	1	0
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	128-UNIMOD:510,146-UNIMOD:21,150-UNIMOD:510	0.02	31.0	1	1	1
PRT	sp|Q7Z309-5|PBIR2_HUMAN	Isoform 5 of PABIR family member 2 OS=Homo sapiens OX=9606 GN=PABIR2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	55-UNIMOD:510,62-UNIMOD:21,66-UNIMOD:21	0.09	31.0	1	1	0
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	257-UNIMOD:510,270-UNIMOD:4,272-UNIMOD:21,240-UNIMOD:510,252-UNIMOD:21	0.14	31.0	3	2	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	108-UNIMOD:510,128-UNIMOD:21,125-UNIMOD:21	0.06	31.0	3	1	0
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	63-UNIMOD:510,71-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	549-UNIMOD:510,559-UNIMOD:21,563-UNIMOD:510	0.02	30.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	225-UNIMOD:510,232-UNIMOD:21,245-UNIMOD:510	0.08	30.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	411-UNIMOD:510,415-UNIMOD:4,417-UNIMOD:4,423-UNIMOD:21,431-UNIMOD:510,1363-UNIMOD:510,1367-UNIMOD:21	0.03	30.0	2	2	2
PRT	sp|Q96K76-2|UBP47_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	811-UNIMOD:510,822-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	86-UNIMOD:510,87-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	98-UNIMOD:510,107-UNIMOD:510,108-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	null	39-UNIMOD:510,41-UNIMOD:21	0.06	30.0	1	1	0
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	492-UNIMOD:510,506-UNIMOD:21,497-UNIMOD:21,187-UNIMOD:510,195-UNIMOD:21,197-UNIMOD:510	0.06	29.0	3	2	1
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	466-UNIMOD:510,475-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	135-UNIMOD:510,142-UNIMOD:21,149-UNIMOD:510	0.10	29.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	1516-UNIMOD:510,1533-UNIMOD:21,1536-UNIMOD:510,2303-UNIMOD:510,2311-UNIMOD:21,1622-UNIMOD:510,1630-UNIMOD:21	0.02	29.0	3	3	3
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	16-UNIMOD:510,27-UNIMOD:21,28-UNIMOD:510,26-UNIMOD:21,270-UNIMOD:510,272-UNIMOD:21,281-UNIMOD:510,19-UNIMOD:21,33-UNIMOD:510,37-UNIMOD:21,41-UNIMOD:21,40-UNIMOD:21	0.11	29.0	6	3	1
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	401-UNIMOD:510,409-UNIMOD:21,413-UNIMOD:510	0.01	29.0	1	1	1
PRT	sp|Q96S55-2|WRIP1_HUMAN	Isoform 2 of ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	82-UNIMOD:510,85-UNIMOD:21,109-UNIMOD:510,116-UNIMOD:21	0.06	29.0	2	2	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	372-UNIMOD:510,380-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|O75369-8|FLNB_HUMAN	Isoform 8 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	1619-UNIMOD:510,1633-UNIMOD:21,1528-UNIMOD:510,1536-UNIMOD:21,1539-UNIMOD:510	0.01	29.0	2	2	2
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	379-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,492-UNIMOD:510,497-UNIMOD:21,42-UNIMOD:510,53-UNIMOD:510	0.07	29.0	4	4	4
PRT	sp|Q96S55|WRIP1_HUMAN	ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	82-UNIMOD:510,87-UNIMOD:21	0.04	29.0	1	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	287-UNIMOD:510,300-UNIMOD:21,25-UNIMOD:510,34-UNIMOD:21,35-UNIMOD:21	0.07	29.0	4	2	1
PRT	sp|O94966-2|UBP19_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	202-UNIMOD:510,202-UNIMOD:4,210-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	141-UNIMOD:510,152-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	43-UNIMOD:510,57-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|P61916-2|NPC2_HUMAN	Isoform 2 of NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	36-UNIMOD:510,40-UNIMOD:21,42-UNIMOD:4,47-UNIMOD:4,51-UNIMOD:510	0.14	28.0	1	1	1
PRT	sp|Q8NBJ7-5|SUMF2_HUMAN	Isoform 5 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	191-UNIMOD:510,191-UNIMOD:35,199-UNIMOD:21,197-UNIMOD:21	0.07	28.0	2	1	0
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	4-UNIMOD:510,14-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	342-UNIMOD:510,345-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510,447-UNIMOD:510,447-UNIMOD:4,455-UNIMOD:21,462-UNIMOD:510,222-UNIMOD:510,225-UNIMOD:21,231-UNIMOD:21,233-UNIMOD:510	0.08	28.0	4	3	2
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	33-UNIMOD:510,39-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	70-UNIMOD:510,80-UNIMOD:21,85-UNIMOD:510,76-UNIMOD:21	0.07	28.0	2	1	0
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	195-UNIMOD:510,203-UNIMOD:21,208-UNIMOD:510	0.04	28.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	228-UNIMOD:510	0.08	27.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	39-UNIMOD:510,43-UNIMOD:21	0.09	27.0	1	1	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:510,9-UNIMOD:21	0.13	27.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	542-UNIMOD:510,551-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	99-UNIMOD:510,109-UNIMOD:35	0.16	27.0	2	1	0
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	37-UNIMOD:510,38-UNIMOD:21,221-UNIMOD:510	0.06	27.0	2	2	1
PRT	sp|Q04726-2|TLE3_HUMAN	Isoform 2 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	238-UNIMOD:510,244-UNIMOD:510,259-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	null	1744-UNIMOD:510,1760-UNIMOD:21	0.01	27.0	1	1	0
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	2071-UNIMOD:510,2083-UNIMOD:21,2089-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	502-UNIMOD:510,515-UNIMOD:21,522-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|O00115-2|DNS2A_HUMAN	Isoform 2 of Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	66-UNIMOD:510,70-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	216-UNIMOD:510,219-UNIMOD:21,228-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	292-UNIMOD:510,292-UNIMOD:4,304-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	841-UNIMOD:510,846-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	701-UNIMOD:510,717-UNIMOD:35,722-UNIMOD:21,724-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	98-UNIMOD:510,102-UNIMOD:21,108-UNIMOD:4	0.13	26.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	175-UNIMOD:510,178-UNIMOD:21,181-UNIMOD:21	0.00	26.0	2	1	0
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	16-UNIMOD:510,35-UNIMOD:21,47-UNIMOD:4,48-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	165-UNIMOD:510,174-UNIMOD:21,178-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	186-UNIMOD:510,186-UNIMOD:35,193-UNIMOD:21,204-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P15336-3|ATF2_HUMAN	Isoform 3 of Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	60-UNIMOD:510,71-UNIMOD:21	0.08	26.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	82-UNIMOD:510,85-UNIMOD:21,96-UNIMOD:510,50-UNIMOD:510,62-UNIMOD:21,69-UNIMOD:21,61-UNIMOD:510	0.06	26.0	5	4	3
PRT	sp|Q9UMR2-2|DD19B_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	68-UNIMOD:510,86-UNIMOD:21,92-UNIMOD:510	0.06	26.0	1	1	1
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	261-UNIMOD:510,265-UNIMOD:21,269-UNIMOD:21,273-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	27-UNIMOD:510,39-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	107-UNIMOD:510,111-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	129-UNIMOD:510,133-UNIMOD:21	0.09	25.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	436-UNIMOD:510,439-UNIMOD:21,456-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	139-UNIMOD:510,146-UNIMOD:21,166-UNIMOD:510	0.12	25.0	1	1	1
PRT	sp|Q9BTE3-2|MCMBP_HUMAN	Isoform 2 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	102-UNIMOD:510,108-UNIMOD:4,118-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q5T1V6-2|DDX59_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens OX=9606 GN=DDX59	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	154-UNIMOD:510,160-UNIMOD:21,169-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	140-UNIMOD:510,145-UNIMOD:21,153-UNIMOD:510	0.08	24.0	1	1	1
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	210-UNIMOD:510,211-UNIMOD:4,216-UNIMOD:21,220-UNIMOD:510	0.04	24.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	24.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	47-UNIMOD:510,55-UNIMOD:21,58-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P28715|ERCC5_HUMAN	DNA excision repair protein ERCC-5 OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	373-UNIMOD:510,384-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	219-UNIMOD:510,225-UNIMOD:21,228-UNIMOD:21,235-UNIMOD:510	0.05	24.0	2	1	0
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	340-UNIMOD:510,344-UNIMOD:21,353-UNIMOD:510	0.04	24.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	24.0	1	1	1
PRT	sp|P42892-3|ECE1_HUMAN	Isoform C of Endothelin-converting enzyme 1 OS=Homo sapiens OX=9606 GN=ECE1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	703-UNIMOD:510,717-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P16278-2|BGAL_HUMAN	Isoform 2 of Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	289-UNIMOD:510,295-UNIMOD:4,303-UNIMOD:21	0.04	24.0	1	1	0
PRT	sp|Q96G03-2|PGM2_HUMAN	Isoform 2 of Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	37-UNIMOD:510,47-UNIMOD:21,51-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	201-UNIMOD:510,210-UNIMOD:21,215-UNIMOD:510	0.05	24.0	1	1	0
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	37-UNIMOD:510,37-UNIMOD:21	0.02	24.0	1	1	0
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	69-UNIMOD:510,74-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4	0.20	23.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	42-UNIMOD:510,44-UNIMOD:21,47-UNIMOD:4,48-UNIMOD:21	0.06	23.0	2	1	0
PRT	sp|Q8N556|AFAP1_HUMAN	Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	246-UNIMOD:510,251-UNIMOD:4,259-UNIMOD:4,264-UNIMOD:21,269-UNIMOD:510,265-UNIMOD:21,661-UNIMOD:510,668-UNIMOD:21	0.05	23.0	3	2	1
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	75-UNIMOD:510,85-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	115-UNIMOD:510,118-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	58-UNIMOD:510,60-UNIMOD:35,62-UNIMOD:4,65-UNIMOD:21,69-UNIMOD:510	0.11	23.0	2	1	0
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	228-UNIMOD:510,230-UNIMOD:510,242-UNIMOD:21,215-UNIMOD:510,221-UNIMOD:21,227-UNIMOD:510	0.12	23.0	2	2	2
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|P41236|IPP2_HUMAN	Protein phosphatase inhibitor 2 OS=Homo sapiens OX=9606 GN=PPP1R2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	68-UNIMOD:510,72-UNIMOD:21,86-UNIMOD:4	0.18	23.0	1	1	1
PRT	sp|Q9NZN5-2|ARHGC_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	670-UNIMOD:510,684-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	97-UNIMOD:510,114-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q86WB0|NIPA_HUMAN	Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	329-UNIMOD:510,343-UNIMOD:510,344-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	75-UNIMOD:510,85-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	74-UNIMOD:510,76-UNIMOD:21,80-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	362-UNIMOD:510,368-UNIMOD:21,384-UNIMOD:21,391-UNIMOD:510	0.06	23.0	2	2	2
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	72-UNIMOD:510,78-UNIMOD:21,81-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	159-UNIMOD:510,164-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	425-UNIMOD:510,438-UNIMOD:21,110-UNIMOD:510,117-UNIMOD:21,123-UNIMOD:4,126-UNIMOD:510,114-UNIMOD:21	0.07	23.0	3	2	1
PRT	sp|O75410|TACC1_HUMAN	Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	262-UNIMOD:510,276-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P16278|BGAL_HUMAN	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	420-UNIMOD:510,426-UNIMOD:4,434-UNIMOD:21	0.04	23.0	1	1	0
PRT	sp|Q86UY5|FA83A_HUMAN	Protein FAM83A OS=Homo sapiens OX=9606 GN=FAM83A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	348-UNIMOD:510,356-UNIMOD:4,357-UNIMOD:21,352-UNIMOD:21	0.05	23.0	2	1	0
PRT	sp|Q9NPI6|DCP1A_HUMAN	mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	521-UNIMOD:510,523-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q8N5J2|MINY1_HUMAN	Ubiquitin carboxyl-terminal hydrolase MINDY-1 OS=Homo sapiens OX=9606 GN=MINDY1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	93-UNIMOD:510,94-UNIMOD:4,103-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q8IZP2|ST134_HUMAN	Putative protein FAM10A4 OS=Homo sapiens OX=9606 GN=ST13P4 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	170-UNIMOD:510,177-UNIMOD:21,182-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	1028-UNIMOD:510,1035-UNIMOD:21,1038-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	78-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|Q01844-2|EWS_HUMAN	Isoform EWS-B of RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	338-UNIMOD:510,349-UNIMOD:21,351-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q5TDH0-2|DDI2_HUMAN	Isoform 2 of Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	94-UNIMOD:510,104-UNIMOD:21	0.08	22.0	1	1	0
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	230-UNIMOD:510,238-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P07199|CENPB_HUMAN	Major centromere autoantigen B OS=Homo sapiens OX=9606 GN=CENPB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	145-UNIMOD:510,150-UNIMOD:21,156-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q7Z3T8|ZFY16_HUMAN	Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	934-UNIMOD:510,939-UNIMOD:21,949-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	380-UNIMOD:510,385-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q8WWC4|MAIP1_HUMAN	m-AAA protease-interacting protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=MAIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	259-UNIMOD:510,262-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	1140-UNIMOD:510,1144-UNIMOD:21,1152-UNIMOD:510	0.00	22.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	2261-UNIMOD:510,2272-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	751-UNIMOD:510,757-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P55809|SCOT1_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	501-UNIMOD:510,504-UNIMOD:4,509-UNIMOD:21,511-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	166-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	291-UNIMOD:510,296-UNIMOD:35,301-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9NUP9|LIN7C_HUMAN	Protein lin-7 homolog C OS=Homo sapiens OX=9606 GN=LIN7C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	112-UNIMOD:510,115-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	178-UNIMOD:510,188-UNIMOD:21,194-UNIMOD:21,203-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	159-UNIMOD:510,169-UNIMOD:21,173-UNIMOD:510	0.05	21.0	1	1	0
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	353-UNIMOD:510,363-UNIMOD:21,367-UNIMOD:21,372-UNIMOD:510	0.04	21.0	2	1	0
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	767-UNIMOD:510,769-UNIMOD:4,770-UNIMOD:510,771-UNIMOD:21,779-UNIMOD:21,784-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|P17174-2|AATC_HUMAN	Isoform 2 of Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	66-UNIMOD:510,72-UNIMOD:21,76-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	15-UNIMOD:510,21-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	235-UNIMOD:510,244-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	555-UNIMOD:510,563-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P28340|DPOD1_HUMAN	DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	50-UNIMOD:510,73-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q08AD1-2|CAMP2_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1284-UNIMOD:510,1292-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	345-UNIMOD:510,360-UNIMOD:4,361-UNIMOD:21	0.02	21.0	1	1	0
PRT	sp|Q9H1E3-2|NUCKS_HUMAN	Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	162-UNIMOD:510,166-UNIMOD:510,174-UNIMOD:21,178-UNIMOD:510	0.09	21.0	1	1	1
PRT	sp|Q9BTC0-1|DIDO1_HUMAN	Isoform 1 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1024-UNIMOD:510,1030-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q92538|GBF1_HUMAN	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	345-UNIMOD:510,360-UNIMOD:4,362-UNIMOD:21	0.02	21.0	1	1	0
PRT	sp|Q5TDH0|DDI2_HUMAN	Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	94-UNIMOD:510,106-UNIMOD:21	0.04	21.0	1	1	0
PRT	sp|Q96EK9|KTI12_HUMAN	Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	173-UNIMOD:510,184-UNIMOD:21,192-UNIMOD:21,194-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|Q7Z309|PBIR2_HUMAN	PABIR family member 2 OS=Homo sapiens OX=9606 GN=PABIR2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	108-UNIMOD:510,112-UNIMOD:21,115-UNIMOD:21,119-UNIMOD:21	0.06	21.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	1	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=3983	41.651	2	2608.0617	2608.0617	R	G	227	255
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=4816	48.259	2	2226.9361	2226.9361	R	-	228	248
PSM	YESQEPLAGQESPLPLATR	3	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3985	41.666	2	2199.0673	2199.0673	R	E	590	609
PSM	DNLTLWTSDQQDDDGGEGNN	4	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510	ms_run[2]:scan=4690	47.253	2	2226.9361	2226.9361	R	-	228	248
PSM	SSSPAPADIAQTVQEDLR	5	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5280	52.279	2	1997.9519	1997.9519	K	T	230	248
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	6	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,2-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=2220	28.349	3	3122.2192	3122.2192	R	A	10	40
PSM	TPEELDDSDFETEDFDVR	7	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4918	49.075	2	2271.9157	2271.9157	R	S	264	282
PSM	TDSVIIADQTPTPTR	8	sp|P17544-5|ATF7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2737	32.213	2	1727.8555	1727.8555	R	F	42	57
PSM	GEPAAAAAPEAGASPVEK	9	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,14-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=1576	23.533	2	1769.8873	1769.8873	K	E	88	106
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	10	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2506	30.484	3	2810.1902	2810.1902	R	E	418	442
PSM	NSDVLQSPLDSAARDEL	11	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4755	47.75	2	1942.9097	1942.9097	K	-	606	623
PSM	TDYNASVSVPDSSGPER	12	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2507	30.492	2	1893.8206	1893.8206	R	I	70	87
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	13	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:510,12-UNIMOD:35,16-UNIMOD:21	ms_run[1]:scan=4427	45.107126666666666	3	3586.4502	3586.4662	R	-	207	238
PSM	GILAADESTGSIAK	14	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2560	30.886408333333332	2	1479.784345	1479.785825	K	R	29	43
PSM	GILAADESTGSIAK	15	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2560	30.886	2	1479.7858	1479.7858	K	R	29	43
PSM	NVSSFPDDATSPLQENR	16	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3365	36.92	2	1989.8893	1989.8893	R	N	52	69
PSM	SYELPDGQVITIGNER	17	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=4838	48.43	2	1823.9478	1823.9478	K	F	239	255
PSM	TDGFAEAIHSPQVAGVPR	18	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3583	38.593	2	1964.957	1964.9570	R	F	2146	2164
PSM	SSSPAPADIAQTVQEDLR	19	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=5280	52.278525	2	1997.949498	1997.951933	K	T	230	248
PSM	GGTTSWGTSGQPSPSYDSSR	20	sp|Q99081|HTF4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2320	29.095	2	2127.8959	2127.8959	R	G	55	75
PSM	LNQVCFDDDGTSSPQDR	21	sp|Q8N1F7-2|NUP93_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2848	33.046	2	2066.8465	2066.8465	K	L	295	312
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	22	sp|P13807-2|GYS1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=3250	36.059	3	3219.4993	3219.4993	K	-	644	674
PSM	RSLAALDALNTDDENDEEEYEAWK	23	sp|P55081|MFAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=4908	48.997	3	2944.3288	2944.3288	K	V	257	281
PSM	SAESPTSPVTSETGSTFK	24	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,7-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2577	31.013	2	1959.9351	1959.9351	K	K	175	193
PSM	EFQDAGEQVVSSPADVAEK	25	sp|P31937|3HIDH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,12-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=3243	36.006056666666666	2	2154.0082	2153.0192	K	A	77	96
PSM	DLFSLDSEDPSPASPPLR	26	sp|Q9BTK6|PAGR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=5687	56.667	2	2055.9614	2055.9614	R	S	224	242
PSM	HTGPNSPDTANDGFVR	27	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1464	22.697	2	1797.7896	1797.7896	K	L	99	115
PSM	NWTEDMEGGISSPVK	28	sp|P08651-4|NFIC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,12-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3961	41.482	2	1796.8329	1796.8329	R	K	279	294
PSM	RIITYNEAMDSPDQ	29	sp|Q7Z417-2|NUFP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2949	33.802	2	1765.7806	1765.7806	K	-	107	121
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	30	sp|P13807-2|GYS1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,14-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=3459	37.63	3	3299.4656	3299.4656	K	-	644	674
PSM	VADPDHDHTGFLTEYVATR	31	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,13-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=3585	38.608	2	2336.9928	2336.9928	R	W	173	192
PSM	EYIPGQPPLSQSSDSSPTR	32	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=3233	35.93178333333333	2	2158.9942	2158.9991	K	N	871	890
PSM	SATSSSPGSPLHSLETSL	33	sp|P20020|AT2B1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=5005	49.841125	2	1870.8746	1870.8768	K	-	1203	1221
PSM	DDGVFVQEVTQNSPAAR	34	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4096	42.518	2	1945.8995	1945.8995	R	T	29	46
PSM	RIDFIPVSPAPSPTR	35	sp|Q96E09|PBIR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=4665	47.061	2	1845.9004	1845.9004	K	G	136	151
PSM	SSDEENGPPSSPDLDR	36	sp|Q96B36-2|AKTS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1591	23.646	2	1814.742	1814.7420	R	I	72	88
PSM	SVTEQGAELSNEER	37	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1831	25.446	2	1661.7358	1661.7358	K	N	28	42
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	38	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,12-UNIMOD:35,17-UNIMOD:21	ms_run[2]:scan=4427	45.107	3	3586.4667	3586.4667	R	-	207	238
PSM	TQPDGTSVPGEPASPISQR	39	sp|Q14980-5|NUMA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2389	29.616	2	2036.9628	2036.9628	R	L	608	627
PSM	VLGTSPEAIDSAENR	40	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2656	31.607	2	1671.7929	1671.7929	R	F	1034	1049
PSM	WLDDLLASPPPSGGGAR	41	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=5660	56.303	2	1901.8538	1901.8538	R	R	684	701
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	42	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,16-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=3459	37.630251666666666	3	3299.4522	3299.4652	K	-	708	738
PSM	NWTEDMEGGISSPVK	43	sp|P08651|NFIC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3961	41.48160166666667	2	1796.828712	1796.832852	R	K	312	327
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	44	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,2-UNIMOD:4,16-UNIMOD:4,24-UNIMOD:21	ms_run[1]:scan=2220	28.349098333333334	3	3122.205116	3122.219153	R	A	10	40
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	45	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,9-UNIMOD:4,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3862	40.734	3	3130.5278	3130.5278	K	S	2194	2221
PSM	ADLNQGIGEPQSPSR	46	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2065	27.208	2	1681.7885	1681.7885	R	R	63	78
PSM	DSENLASPSEYPENGER	47	sp|P52948-4|NUP98_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2517	30.566	2	2006.8319	2006.8319	R	F	600	617
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	48	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2053	27.118	3	2826.1852	2826.1852	R	E	418	442
PSM	IQELGDLYTPAPGR	49	sp|Q9NWS0|PIHD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3806	40.313	2	1642.818	1642.8180	R	A	187	201
PSM	KPVTVSPTTPTSPTEGEAS	50	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=1806	25.257	2	2033.0242	2033.0242	R	-	505	524
PSM	MDATANDVPSPYEVR	51	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3088	34.836	2	1777.7806	1777.7806	K	G	434	449
PSM	RHASSSDDFSDFSDDSDFSPSEK	52	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,19-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=3270	36.209	3	2712.1137	2712.1137	K	G	128	151
PSM	RIDFTPVSPAPSPTR	53	sp|Q7Z309-5|PBIR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3508	38.021	2	1833.864	1833.8640	K	G	55	70
PSM	SVTSNQSDGTQESCESPDVLDR	54	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,14-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=2326	29.139	2	2524.0485	2524.0485	R	H	257	279
PSM	TDLNPDNLQGGDDLDPNYVLSSR	55	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=5002	49.818	2	2631.1914	2631.1914	K	V	108	131
PSM	ELSDQATASPIVAR	56	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2303	28.968	2	1570.7816	1570.7816	K	T	63	77
PSM	EQGPYETYEGSPVSK	57	sp|P23921|RIR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2195	28.163	2	1817.8397	1817.8397	K	G	549	564
PSM	GGNFGGRSSGPYGGGGQYFAK	58	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,8-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=2834	32.94	3	2168.0113	2168.0113	K	P	225	246
PSM	MDATANDVPSPYEVR	59	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=3550	38.347	2	1857.747	1857.7470	K	G	434	449
PSM	RIITYNEAMDSPDQ	60	sp|Q7Z417-2|NUFP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,9-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=2204	28.228	2	1781.7755	1781.7755	K	-	107	121
PSM	RSEACPCQPDSGSPLPAEEEK	61	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=1558	23.401	3	2491.1033	2491.1033	R	R	411	432
PSM	STETSDFENIESPLNER	62	sp|Q96K76-2|UBP47_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4073	42.345	2	2080.905	2080.9050	K	D	811	828
PSM	TTPSVVAFTADGER	63	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3826	40.461	2	1563.7394	1563.7394	R	L	86	100
PSM	VEVTEFEDIKSGYR	64	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,10-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3903	41.041	2	1818.9077	1818.9077	R	I	98	112
PSM	DSSTSPGDYVLSVSENSR	65	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=4558	46.181581666666666	2	2012.8742	2012.8783	R	V	39	57
PSM	ADLLLSTQPGREEGSPLELER	66	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=4415	45.018	2	2423.2158	2423.2158	K	L	492	513
PSM	AEEDEILNRSPR	67	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1747	24.818	2	1541.7299	1541.7299	K	N	466	478
PSM	AQAAAPASVPAQAPK	68	sp|P47914|RL29_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1465	22.705	2	1524.8338	1524.8338	K	R	135	150
PSM	EAAFSPGQQDWSR	69	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3278	36.268	2	1591.6881	1591.6881	R	D	1099	1112
PSM	EGPYSISVLYGDEEVPRSPFK	70	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,18-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=5139	50.988	3	2516.2513	2516.2513	R	V	1516	1537
PSM	EYIPGQPPLSQSSDSSPTR	71	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3233	35.932	2	2158.9996	2158.9996	K	N	871	890
PSM	GNPTVEVDLFTSK	72	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4455	45.326	2	1553.8015	1553.8015	R	G	16	29
PSM	NLNNSNLFSPVNR	73	sp|P52948-4|NUP98_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3815	40.381	2	1601.7775	1601.7775	K	D	587	600
PSM	NPSDSAVHSPFTK	74	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1459	22.659	2	1533.7501	1533.7501	K	R	401	414
PSM	NSDVLQSPLDSAAR	75	sp|Q8NBJ5|GT251_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3183	35.552	2	1585.7561	1585.7561	K	D	606	620
PSM	QPATPTAAESSEGEGEEGDDGGETESR	76	sp|Q96S55-2|WRIP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1387	22.112	3	2806.115	2806.1150	K	E	82	109
PSM	RADLNQGIGEPQSPSRR	77	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=1218	20.845	2	1993.9907	1993.9907	R	V	62	79
PSM	STPFIVPSSPTEQEGR	78	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3626	38.941	2	1844.877	1844.8770	R	Q	372	388
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	79	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=4928	49.152	3	3570.4718	3570.4718	R	-	207	238
PSM	YMIGVTYGGDDIPLSPYR	80	sp|O75369-8|FLNB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=5453	54.037	2	2129.9957	2129.9957	R	I	1619	1637
PSM	GVVDSEDLPLNISR	81	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510	ms_run[1]:scan=4037	42.070345	2	1546.8384	1546.8410	R	E	379	393
PSM	GNPTVEVDLFTSK	82	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4455	45.32583666666667	2	1553.7998	1553.8009	R	G	16	29
PSM	QPATPTAAESSEGEGEEGDDGGETESR	83	sp|Q96S55|WRIP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=1387	22.111988333333333	3	2806.1075	2806.1145	K	E	82	109
PSM	GTWIHPEIDNPEYSPD	84	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[1]:scan=4421	45.06312833333333	2	1982.8451	1982.8506	K	P	287	303
PSM	RIDFIPVSPAPSPTR	85	sp|Q96E09|PBIR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=4665	47.06060166666666	2	1845.896611	1845.900369	K	G	136	151
PSM	CQENGQELSPIALEPGPEPHR	86	sp|O94966-2|UBP19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=3291	36.365	3	2471.1365	2471.1365	R	A	202	223
PSM	DALGDSLQVPVSPSSTTSSR	87	sp|Q9Y2D5|AKAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4147	42.906	2	2117.0102	2117.0102	R	C	141	161
PSM	DLADELALVDVIEDK	88	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6556	67.968	2	1724.972	1724.9720	K	L	43	58
PSM	EVNVSPCPTQPCQLSK	89	sp|P61916-2|NPC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2499	30.43	2	1990.953	1990.9530	K	G	36	52
PSM	MGNTPDSASDNLGFR	90	sp|Q8NBJ7-5|SUMF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=2750	32.307	2	1710.7133	1710.7133	R	C	191	206
PSM	NQYDNDVTVWSPQGR	91	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3450	37.562	2	1891.8314	1891.8314	R	I	4	19
PSM	SWASPVYTEADGTFSR	92	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4531	45.978	2	1886.83	1886.8300	R	L	342	358
PSM	TVIIEQSWGSPK	93	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3814	40.374	2	1491.8011	1491.8011	R	V	61	73
PSM	TVQGPPTSDDIFER	94	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3756	39.931	2	1674.7714	1674.7714	K	E	33	47
PSM	VTNGAFTGEISPGMIK	95	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4446	45.257	2	1768.9107	1768.9107	K	D	70	86
PSM	YISPDQLADLYK	96	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5128	50.892	2	1572.8113	1572.8113	R	S	270	282
PSM	YLLGDAPVSPSSQK	97	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3326	36.628	2	1608.8437	1608.8437	K	L	195	209
PSM	TDLNPDNLQGGDDLDPNYVLSSR	98	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=5002	49.817915	2	2631.1792	2631.1912	K	V	108	131
PSM	DLFSLDSEDPSPASPPLR	99	sp|Q9BTK6|PAGR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=5687	56.667258333333336	2	2055.958516	2055.961435	R	S	224	242
PSM	ADLLLSTQPGREEGSPLELER	100	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=4846	48.491	3	2503.1821	2503.1821	K	L	492	513
PSM	DNLTLWTSDQQDEEAGEGN	101	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4788	48.004	2	2154.9402	2154.9402	R	-	228	247
PSM	DSSTSPGDYVLSVSENSR	102	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4558	46.182	2	2012.8788	2012.8788	R	V	39	57
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	103	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=4261	43.79	3	3461.4719	3461.4719	K	F	86	114
PSM	GVQVETISPGDGR	104	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2154	27.865	2	1427.687	1427.6870	M	T	2	15
PSM	HGSYEDAVHSGALND	105	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1776	25.035	2	1684.6943	1684.6943	K	-	542	557
PSM	KEESEESDDDMGFGLFD	106	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4376	44.719	2	2032.8732	2032.8732	K	-	99	116
PSM	MGNTPDSASDNLGFR	107	sp|Q8NBJ7-5|SUMF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3223	35.857	2	1694.7184	1694.7184	R	C	191	206
PSM	TTPSYVAFTDTER	108	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3781	40.123	2	1600.7234	1600.7234	R	L	37	50
PSM	YDSDGDKSDDLVVDVSNEDPATPR	109	sp|Q04726-2|TLE3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:510,22-UNIMOD:21	ms_run[2]:scan=3667	39.251	3	2756.2338	2756.2338	R	V	238	262
PSM	MDATANDVPSPYEVR	110	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=3157	35.358305	2	1777.7771	1777.7801	K	G	434	449
PSM	TQPDGTSVPGEPASPISQR	111	sp|Q14980|NUMA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[1]:scan=2389	29.615831666666665	2	2036.959477	2036.962832	R	L	1744	1763
PSM	ADSGPTQPPLSLSPAPETK	112	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,13-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3370	36.957	2	2040.0453	2040.0453	R	R	2071	2090
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	113	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=2570	30.96	3	3127.3403	3127.3403	R	-	502	532
PSM	ALINSPEGAVGR	114	sp|O00115-2|DNS2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2596	31.158	2	1296.6651	1296.6651	R	S	66	78
PSM	APNTPDILEIEFK	115	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5517	54.745	2	1633.8641	1633.8641	K	K	216	229
PSM	CELLSDDSLAVSSPR	116	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=4023	41.963	2	1761.8068	1761.8068	K	L	292	307
PSM	CIPALDSLTPANEDQK	117	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:4,9-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4165	43.045	2	1918.9384	1918.9384	R	I	447	463
PSM	DFAARSPSASITDEDSNV	118	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3586	38.616	2	1994.8683	1994.8683	K	-	841	859
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	119	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,17-UNIMOD:35,22-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=3958	41.459	3	2965.2161	2965.2161	K	T	701	725
PSM	EDFDSLLQSAK	120	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4589	46.437	2	1399.6909	1399.6909	K	K	187	198
PSM	EILGTAQSVGCNVDGR	121	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=2903	33.458	2	1788.829	1788.8290	K	H	98	114
PSM	ELASPVSPELR	122	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=3219	35.828	2	1390.6359	1390.6359	K	Q	175	186
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	123	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,20-UNIMOD:21,32-UNIMOD:4,33-UNIMOD:510	ms_run[2]:scan=3906	41.066	3	3881.5895	3881.5895	R	G	16	49
PSM	IFVGGLSPDTPEEK	124	sp|Q14103-4|HNRPD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3761	39.969	2	1635.8433	1635.8433	K	I	165	179
PSM	MLAESDESGDEESVSQTDKTELQNTLR	125	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:35,8-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3476	37.761	3	3175.4388	3175.4388	K	T	186	213
PSM	NDSVIVADQTPTPTR	126	sp|P15336-3|ATF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2251	28.58	2	1726.8351	1726.8351	R	F	60	75
PSM	NQLTSNPENTVFDAK	127	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3707	39.553	2	1824.8931	1824.8931	K	R	82	97
PSM	SNLVDNTNQVEVLQRDPNSPLYSVK	128	sp|Q9UMR2-2|DD19B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,19-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4369	44.666	3	2976.523	2976.5230	R	S	68	93
PSM	SVTSNQSDGTQESCESPDVLDR	129	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,14-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=2330	29.169	3	2524.0485	2524.0485	R	H	257	279
PSM	VEIIANDQGNRITPSYVAFTPEGER	130	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=4777	47.919	3	2969.3785	2969.3786	R	L	50	75
PSM	YSDDTPLPTPSYK	131	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3226	35.879	2	1710.7467	1710.7467	K	Y	261	274
PSM	DGLNDDDFEPYLSPQAR	132	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=5067	50.354	2	2064.889	2064.8890	K	P	27	44
PSM	EGLELPEDEEEK	133	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2744	32.264	2	1483.7566	1483.7566	K	K	539	551
PSM	GNPTVEVDLFTSK	134	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5042	50.165	2	1633.7678	1633.7678	R	G	16	29
PSM	GPPQSPVFEGVYNNSR	135	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3495	37.921	2	1860.862	1860.8620	K	M	107	123
PSM	IEDVTPIPSDSTR	136	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2342	29.263	2	1542.7391	1542.7391	R	R	129	142
PSM	LGGSPTSLGTWGSWIGPDHDK	137	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=5393	53.426	3	2315.126	2315.1260	K	F	436	457
PSM	SSSPAPADIAQTVQEDLR	138	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=5418	53.7	2	1997.9519	1997.9519	K	T	230	248
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	139	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=4735	47.594	3	3490.5054	3490.5054	R	-	207	238
PSM	VEIIANDQGNRITPSYVAFTPEGER	140	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4599	46.513	3	2889.4122	2889.4122	R	L	50	75
PSM	VLDNYLTSPLPEEVDETSAEDEGVSQRK	141	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21,28-UNIMOD:510	ms_run[2]:scan=4561	46.205	3	3267.5708	3267.5708	K	F	139	167
PSM	YRDVAECGPQQELDLNSPR	142	sp|Q9BTE3-2|MCMBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=2984	34.068	3	2360.068	2360.0680	K	N	102	121
PSM	AAVPSGASTGIYEALELR	143	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=6135	62.11948833333333	2	1997.9296	1997.9319	R	D	33	51
PSM	MDATANDVPSPYEVR	144	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=3550	38.34670666666666	2	1857.742136	1857.746965	K	G	434	449
PSM	ADSEPESPLNASYVYK	145	sp|Q5T1V6-2|DDX59_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3517	38.093	2	1916.9081	1916.9081	K	E	154	170
PSM	DDGLFSGDPNWFPK	146	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=6165	62.522	2	1741.8025	1741.8025	R	K	140	154
PSM	DNLTLWTSDQQDDDGGEGNN	147	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=5216	51.675	2	2226.9361	2226.9361	R	-	228	248
PSM	EQVANSAFVER	148	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2096	27.434	2	1362.6393	1362.6393	K	V	492	503
PSM	GYISPYFINTSK	149	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5062	50.315	2	1616.7565	1616.7565	R	G	222	234
PSM	ICEPGYSPTYK	150	sp|P07858|CATB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:4,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2296	28.915	2	1461.6888	1461.6888	K	Q	210	221
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	151	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=5021	50.006	3	2995.386	2995.3860	R	G	2913	2938
PSM	ISVYYNEATGGK	152	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2615	31.298	2	1448.7225	1448.7225	R	Y	47	59
PSM	MDATANDVPSPYEVR	153	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=2632	31.427	2	1793.7755	1793.7755	K	G	434	449
PSM	NAPAAVDEGSISPR	154	sp|P28715|ERCC5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=1875	25.779	2	1496.7085	1496.7085	R	T	373	387
PSM	QSPASPPPLGGGAPVR	155	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2544	30.766	2	1600.8187	1600.8187	R	T	1363	1379
PSM	SFEAPATINSASLHPEK	156	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3587	38.623	3	2025.9486	2025.9486	K	E	219	236
PSM	SGSSSPDSEITELK	157	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2877	33.265	2	1583.7604	1583.7604	R	F	340	354
PSM	SPFNSPSPQDSPR	158	sp|P08651-4|NFIC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1771	24.997	2	1528.6772	1528.6772	K	L	300	313
PSM	TAFQEALDAAGDK	159	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3169	35.446	2	1403.7569	1403.7569	K	L	9	22
PSM	THSTSSSLGSGESPFSR	160	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=1670	24.235	3	1836.8104	1836.8104	R	S	240	257
PSM	TPESSHEGLITDPHSPSR	161	sp|P42892-3|ECE1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=1290	21.383	3	2059.9424	2059.9424	R	F	703	721
PSM	TTLPQDCSNPAPLSSPLNGVHDR	162	sp|P16278-2|BGAL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=3344	36.762	3	2589.2107	2589.2107	R	A	289	312
PSM	VYWDNGAQIISPHDK	163	sp|Q96G03-2|PGM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3533	38.216	3	1889.9349	1889.9349	K	G	37	52
PSM	YADEEIPRSPFK	164	sp|O75369-8|FLNB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2900	33.436	2	1598.8018	1598.8018	K	V	1528	1540
PSM	TDLNPDNLQGGDDLDPNYVLSSR	165	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[1]:scan=4997	49.7797	3	2631.1890	2631.1909	K	V	108	131
PSM	GALQNIIPASTGAAK	166	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3542	38.284683333333334	2	1558.8707	1558.8751	R	A	201	216
PSM	TTPSYVAFTDTER	167	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=3781	40.123145	2	1600.720769	1600.723437	R	L	37	50
PSM	AAVPSGASTGIYEALELR	168	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=6135	62.119	2	1997.9325	1997.9325	R	D	33	51
PSM	AFGESSTESDEEEEEGCGHTHCVR	169	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=1450	22.591	4	2852.0751	2852.0751	R	G	69	93
PSM	DFTPVCTTELGR	170	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=3825	40.454	2	1508.6795	1508.6795	R	A	42	54
PSM	EAYSGCSGPVDSECPPPPSSPVHK	171	sp|Q8N556|AFAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:4,19-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=1948	26.326	3	2688.1874	2688.1874	K	A	246	270
PSM	EITALAPSTMK	172	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21,10-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2637	31.464	2	1404.6649	1404.6649	K	I	316	327
PSM	ELPESGIQLGTPR	173	sp|Q9UI10-3|EI2BD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3638	39.032	2	1509.7652	1509.7652	R	E	75	88
PSM	EQISDIDDAVR	174	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3242	35.999	2	1373.6288	1373.6288	K	K	115	126
PSM	ESYDAPPTPSGAR	175	sp|Q96S55-2|WRIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=1520	23.118	2	1460.6397	1460.6397	R	L	109	122
PSM	FLMECRNSPVTK	176	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:35,5-UNIMOD:4,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1330	21.689	2	1644.8041	1644.8041	K	T	58	70
PSM	FLMECRNSPVTK	177	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:4,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2221	28.357	2	1628.8092	1628.8092	K	T	58	70
PSM	FNEEHIPDSPFVVPVASPSGDAR	178	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4580	46.352	3	2580.211	2580.2110	K	R	2303	2326
PSM	GGKPEPPAMPQPVPTA	179	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=2866	33.18	2	1720.8896	1720.8896	K	-	228	244
PSM	GPLQSVQVFGR	180	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3927	41.227	2	1300.6753	1300.6753	K	K	5	16
PSM	IDEPSTPYHSMMGDDEDACSDTEATEAMAPDILAR	181	sp|P41236|IPP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=5307	52.581	3	3954.6041	3954.6041	K	K	68	103
PSM	KEESEESDDDMGFGLFD	182	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=5189	51.441	2	2016.8783	2016.8783	K	-	99	116
PSM	QVGETSAPGDTLDGTPR	183	sp|Q9NZN5-2|ARHGC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=1985	26.606	2	1813.8308	1813.8308	K	T	670	687
PSM	RPPSPDVIVLSDNEQPSSPR	184	sp|Q86YP4-2|P66A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=3199	35.676	3	2303.1371	2303.1371	R	V	97	117
PSM	SQDATFSPGSEQAEKSPGPIVSR	185	sp|Q86WB0|NIPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,15-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=2479	30.282	3	2522.2326	2522.2326	R	T	329	352
PSM	TDGEPGPQGWSPR	186	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2455	30.105	2	1496.6509	1496.6509	K	E	75	88
PSM	TDGFAEAIHSPQVAGVPR	187	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3606	38.778	3	1964.957	1964.9570	R	F	2146	2164
PSM	TQSPGGCSAEAVLAR	188	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2494	30.393	2	1616.7442	1616.7442	R	K	74	89
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	189	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,23-UNIMOD:21,30-UNIMOD:510	ms_run[2]:scan=4472	45.473	3	3453.6419	3453.6419	K	A	362	392
PSM	VFDLQFSTDSPR	190	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4679	47.169	2	1524.7074	1524.7074	R	L	72	84
PSM	VIGSGCNLDSAR	191	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1332	21.703	2	1281.656	1281.6560	R	F	159	171
PSM	YGGDEIPFSPYR	192	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4256	43.751	2	1513.6703	1513.6703	K	V	1622	1634
PSM	DGARPDVTESESGSPEYR	193	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[1]:scan=1606	23.75772166666667	3	2064.8830	2064.8845	K	Q	425	443
PSM	ASYHFSPEELDENTSPLLGDAR	194	sp|O75410|TACC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[1]:scan=4685	47.21386	3	2561.1497	2561.1530	K	F	262	284
PSM	TTLPQDCSNPAPLSSPLNGVHDR	195	sp|P16278|BGAL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,7-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=3281	36.28982166666667	3	2589.1992	2589.2102	R	A	420	443
PSM	SVSASSGPCSPAAPHPPPPPR	196	sp|Q86UY5|FA83A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,9-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1695	24.422415	3	2166.012086	2166.014156	R	F	348	369
PSM	ASSPSPLTIGTPESQR	197	sp|Q9NPI6|DCP1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2958	33.871253333333335	2	1740.8470	1740.8502	K	K	521	537
PSM	EAYSGCSGPVDSECPPPPSSPVHK	198	sp|Q8N556|AFAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:4,20-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=1948	26.325823333333332	3	2688.1805	2688.1868	K	A	246	270
PSM	ACSMPQELPQSPR	199	sp|Q8N5J2|MINY1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=2315	29.057	2	1613.7155	1613.7155	R	T	93	106
PSM	AIEINPDSAQPYK	200	sp|Q8IZP2|ST134_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3072	34.718	2	1592.8124	1592.8124	R	R	170	183
PSM	DEILPTTPISEQK	201	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3534	38.224	2	1617.8539	1617.8539	K	G	215	228
PSM	EAALPPVSPLK	202	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3289	36.35	2	1268.7418	1268.7418	R	A	1028	1039
PSM	EIIDLVLDR	203	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4787	47.998	2	1118.6759	1118.6759	K	I	78	87
PSM	EQFLDGDGWTSR	204	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=4110	42.627	2	1523.6506	1523.6506	K	W	25	37
PSM	GDATVSYEDPPTAK	205	sp|Q01844-2|EWS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1868	25.725	2	1597.7549	1597.7549	K	A	338	352
PSM	IDFSSIAVPGTSSPR	206	sp|Q5TDH0-2|DDI2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=5056	50.27	2	1646.8129	1646.8129	R	Q	94	109
PSM	ITPSYVAFTPEGER	207	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3817	40.396	2	1679.802	1679.8020	R	L	61	75
PSM	LAIQGPEDSPSR	208	sp|Q15773|MLF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2248	28.559	2	1382.6655	1382.6655	R	Q	230	242
PSM	LFDHPESPTPNPTEPLFLAQAEVYK	209	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=5618	55.888	3	2987.4994	2987.4994	R	E	968	993
PSM	NAAPRTPAAPASPAAVPSEGSGGSTTGWR	210	sp|P07199|CENPB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2809	32.755	3	2914.3224	2914.3224	R	A	145	174
PSM	NEIIQSPISQVPSVEK	211	sp|Q7Z3T8|ZFY16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3962	41.489	2	1915.034	1915.0340	R	L	934	950
PSM	NIEIDSPYEISR	212	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3774	40.069	2	1548.7285	1548.7285	K	A	380	392
PSM	QLLSASYEFQR	213	sp|Q8WWC4|MAIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4105	42.59	2	1454.7019	1454.7019	K	E	259	270
PSM	SFEAPATINSASLHPEK	214	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3288	36.343	3	1945.9823	1945.9823	K	E	219	236
PSM	SVFGTPTLETANK	215	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3506	38.006	2	1511.7909	1511.7909	K	N	1140	1153
PSM	SVSASSGPCSPAAPHPPPPPR	216	sp|Q86UY5|FA83A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=1695	24.422	3	2166.0142	2166.0142	R	F	348	369
PSM	TPAAAAAMNLASPR	217	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2784	32.565	2	1454.7165	1454.7165	R	T	2261	2275
PSM	TQTPPVSPAPQPTEER	218	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1560	23.416	2	1847.8879	1847.8879	K	L	362	378
PSM	VADPDHDHTGFLTEYVATR	219	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3152	35.318	3	2257.0265	2257.0265	R	W	173	192
PSM	VADPDHDHTGFLTEYVATR	220	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,13-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=3580	38.573	3	2336.9928	2336.9928	R	W	173	192
PSM	VEIIANDQGNR	221	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510	ms_run[1]:scan=1494	22.924973333333334	2	1261.6823	1261.6834	R	I	50	61
PSM	DFTPVCTTELGR	222	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=4021	41.94766333333333	2	1588.6427	1588.6453	R	A	42	54
PSM	LSPPYSSPQEFAQDVGR	223	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=4577	46.32943833333333	2	1990.9206	1990.9245	K	M	751	768
PSM	STGCDFAVSPK	224	sp|P55809|SCOT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,4-UNIMOD:4,9-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2077	27.295226666666665	2	1315.615466	1315.615589	K	L	501	512
PSM	EQFLDGDGWTSR	225	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=4110	42.627309999999994	2	1523.649166	1523.650606	K	W	25	37
PSM	ATAGDTHLGGEDFDNR	226	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1638	24	3	1708.7865	1708.7865	K	L	166	182
PSM	DVSGPMPDSYSPR	227	sp|P26640|SYVC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=1909	26.026	2	1536.638	1536.6380	K	Y	291	304
PSM	ELASPVSPELR	228	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2817	32.815	2	1310.6695	1310.6696	K	Q	175	186
PSM	ELISNASDALDK	229	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2654	31.593	2	1342.7616	1342.7616	R	I	42	54
PSM	EQFLDGDGWTSR	230	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3975	41.591	2	1523.6506	1523.6506	K	W	25	37
PSM	EQNSPIYISR	231	sp|Q9NUP9|LIN7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2012	26.814	2	1319.6335	1319.6335	K	I	112	122
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	232	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21,17-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4272	43.874	3	3040.4508	3040.4508	K	Q	178	204
PSM	GALQNIIPASTGAAK	233	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3542	38.285	2	1558.8756	1558.8756	R	A	159	174
PSM	GHTDTEGRPPSPPPTSTPEK	234	sp|Q00613-2|HSF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=1016	19.295	3	2315.0509	2315.0509	R	C	353	373
PSM	GHTDTEGRPPSPPPTSTPEK	235	sp|Q00613-2|HSF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=1037	19.456	3	2235.0845	2235.0845	R	C	353	373
PSM	GYISPYFINTSK	236	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4451	45.296	2	1536.7902	1536.7902	R	G	222	234
PSM	HVPDSGATATAYLCGVK	237	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=3317	36.561	3	1893.9332	1893.9332	K	G	110	127
PSM	IACKSPPPESVDTPTSTK	238	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:4,4-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=1467	22.719	3	2176.0625	2176.0625	K	Q	767	785
PSM	LALGDDSPALK	239	sp|P17174-2|AATC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3221	35.843	2	1246.6847	1246.6847	R	E	66	77
PSM	LDGLVETPTGYIESLPR	240	sp|P55209-3|NP1L1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=5852	58.685	2	1972.9971	1972.9971	R	V	15	32
PSM	LDQPVSAPPSPR	241	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1817	25.341	2	1376.6913	1376.6913	K	D	235	247
PSM	LELQGPRGSPNAR	242	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=1646	24.059	2	1507.7721	1507.7721	R	S	555	568
PSM	LQEQEEEELQSVLEGVADGQVPPSAIDPR	243	sp|P28340|DPOD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,24-UNIMOD:21	ms_run[2]:scan=6547	67.897	3	3275.5659	3275.5659	R	W	50	79
PSM	NSDVLQSPLDSAARDEL	244	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=5299	52.466	2	2022.8761	2022.8761	K	-	606	623
PSM	RADLNQGIGEPQSPSR	245	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=1508	23.028	2	1837.8896	1837.8896	R	R	62	78
PSM	SESVEGFLSPSR	246	sp|Q08AD1-2|CAMP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3753	39.907	2	1407.6495	1407.6495	R	C	1284	1296
PSM	SGTSSPQSPVFR	247	sp|Q8N556|AFAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=1694	24.415	2	1362.6393	1362.6393	K	H	661	673
PSM	SQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPR	248	sp|Q92538-3|GBF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,16-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=4889	48.835	4	4158.7884	4158.7884	K	G	345	382
PSM	STAGDTHLGGEDFDNR	249	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1602	23.729	3	1724.7814	1724.7814	K	M	221	237
PSM	TPSPKEEDEEPESPPEK	250	sp|Q9H1E3-2|NUCKS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:510,13-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1109	20.009	3	2106.0142	2106.0142	K	K	162	179
PSM	VTNGAFTGEISPGMIK	251	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4844	48.475	2	1848.877	1848.8770	K	D	70	86
PSM	YLSVPPSPNISTSESR	252	sp|Q9BTC0-1|DIDO1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3071	34.71	2	1846.8926	1846.8926	R	S	1024	1040
PSM	LFDHPESPTPNPTEPLFLAQAEVYK	253	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=5618	55.88773166666667	3	2987.4965	2987.4989	R	E	968	993
PSM	HVPDSGATATAYLCGVK	254	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[1]:scan=3317	36.56069166666667	3	1893.9319	1893.9327	K	G	110	127
PSM	SQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPR	255	sp|Q92538|GBF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,16-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=4889	48.835235	4	4158.7798	4158.7879	K	G	345	382
PSM	VFDLQFSTDSPR	256	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=4679	47.169105	2	1524.7049	1524.7069	R	L	72	84
PSM	IDFSSIAVPGTSSPR	257	sp|Q5TDH0|DDI2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=5056	50.27043833333333	2	1646.8109	1646.8124	R	Q	94	109
PSM	ELEREESGAAESPALVTPDSEK	258	sp|Q96EK9|KTI12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,12-UNIMOD:21,20-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=2430	29.917523333333335	3	2571.1637	2571.1661	K	S	173	195
PSM	RIDFTPVSPAPSPTR	259	sp|Q7Z309|PBIR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=3782	40.13034833333333	2	1914.8302	1913.8302	K	G	108	123