MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100625_022AKT3.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100625_022AKT3.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P25054-2|APC_HUMAN	Isoform 2 of Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	null	1758-UNIMOD:510,1760-UNIMOD:21	0.01	45.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	null	228-UNIMOD:510,29-UNIMOD:510	0.15	44.0	5	2	1
PRT	sp|Q92766-5|RREB1_HUMAN	Isoform 5 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	1165-UNIMOD:510,1167-UNIMOD:21,1183-UNIMOD:510	0.01	43.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	180-UNIMOD:510,182-UNIMOD:21,198-UNIMOD:510,178-UNIMOD:510,178-UNIMOD:21	0.02	41.0	3	3	3
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	275-UNIMOD:510,277-UNIMOD:21,290-UNIMOD:510,276-UNIMOD:21	0.01	40.0	2	1	0
PRT	sp|Q9NP61-2|ARFG3_HUMAN	Isoform 2 of ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	321-UNIMOD:510,323-UNIMOD:21,336-UNIMOD:510	0.04	40.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	239-UNIMOD:510,360-UNIMOD:510	0.08	39.0	2	2	2
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	204-UNIMOD:510,222-UNIMOD:510,223-UNIMOD:510	0.13	38.0	2	2	2
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	571-UNIMOD:510,576-UNIMOD:4,584-UNIMOD:21,572-UNIMOD:510	0.02	36.0	2	2	2
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	41-UNIMOD:510,43-UNIMOD:21,48-UNIMOD:4,52-UNIMOD:4,56-UNIMOD:510	0.03	35.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	16-UNIMOD:510,18-UNIMOD:21,31-UNIMOD:510,17-UNIMOD:21	0.09	35.0	2	1	0
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	221-UNIMOD:510,160-UNIMOD:510,163-UNIMOD:21	0.06	35.0	2	2	2
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	240-UNIMOD:510,242-UNIMOD:21,238-UNIMOD:510,238-UNIMOD:21,240-UNIMOD:21	0.07	35.0	4	2	0
PRT	sp|P04075-2|ALDOA_HUMAN	Isoform 2 of Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	228-UNIMOD:510,230-UNIMOD:21,232-UNIMOD:4,254-UNIMOD:510,83-UNIMOD:510,93-UNIMOD:21,96-UNIMOD:510,385-UNIMOD:510,390-UNIMOD:21,393-UNIMOD:4,396-UNIMOD:510,97-UNIMOD:510,103-UNIMOD:21,98-UNIMOD:510,100-UNIMOD:21	0.17	35.0	5	5	4
PRT	sp|Q9Y243|AKT3_HUMAN	RAC-gamma serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	295-UNIMOD:510,304-UNIMOD:510,305-UNIMOD:21,307-UNIMOD:4,309-UNIMOD:21,117-UNIMOD:510,119-UNIMOD:4,136-UNIMOD:21,141-UNIMOD:510,120-UNIMOD:21,122-UNIMOD:21,303-UNIMOD:35,465-UNIMOD:510,472-UNIMOD:21,474-UNIMOD:21,123-UNIMOD:21,133-UNIMOD:35,182-UNIMOD:510,187-UNIMOD:510,193-UNIMOD:21,117-UNIMOD:35,476-UNIMOD:21,305-UNIMOD:510,473-UNIMOD:21	0.19	35.0	40	5	1
PRT	sp|P31749|AKT1_HUMAN	RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	null	308-UNIMOD:510,310-UNIMOD:4,312-UNIMOD:21	0.05	35.0	1	1	0
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	329-UNIMOD:510,332-UNIMOD:21,327-UNIMOD:510,329-UNIMOD:21,331-UNIMOD:21	0.05	35.0	2	2	0
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	14-UNIMOD:510	0.06	34.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	34.0	2	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	28-UNIMOD:510	0.06	34.0	1	1	1
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	686-UNIMOD:510,686-UNIMOD:21,690-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	null	174-UNIMOD:510,174-UNIMOD:21,178-UNIMOD:4,200-UNIMOD:510	0.08	33.0	1	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	228-UNIMOD:510	0.08	32.0	1	1	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	204-UNIMOD:510,206-UNIMOD:21,210-UNIMOD:35,182-UNIMOD:510,192-UNIMOD:510,215-UNIMOD:35,184-UNIMOD:21	0.12	32.0	4	2	0
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	283-UNIMOD:510,285-UNIMOD:21,307-UNIMOD:510,247-UNIMOD:510,251-UNIMOD:21,283-UNIMOD:21	0.13	32.0	3	2	0
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	192-UNIMOD:510,194-UNIMOD:21,207-UNIMOD:510	0.02	32.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	43-UNIMOD:510,57-UNIMOD:510,100-UNIMOD:510,105-UNIMOD:4	0.11	31.0	2	2	2
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	48-UNIMOD:510,51-UNIMOD:21,62-UNIMOD:510,52-UNIMOD:21	0.09	31.0	2	1	0
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	879-UNIMOD:510,881-UNIMOD:21,888-UNIMOD:35,895-UNIMOD:510,879-UNIMOD:21	0.01	31.0	3	1	0
PRT	sp|P17544-5|ATF7_HUMAN	Isoform 5 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	42-UNIMOD:510,44-UNIMOD:21	0.14	31.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	325-UNIMOD:510,336-UNIMOD:510,330-UNIMOD:35	0.03	30.0	2	1	0
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	188-UNIMOD:510,200-UNIMOD:4,201-UNIMOD:510	0.02	30.0	1	1	1
PRT	sp|Q6PJG9|LRFN4_HUMAN	Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRFN4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	583-UNIMOD:510,584-UNIMOD:4,585-UNIMOD:21,593-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	39-UNIMOD:510,40-UNIMOD:21	0.09	29.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	539-UNIMOD:510,550-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,187-UNIMOD:510,492-UNIMOD:510	0.07	29.0	4	4	4
PRT	sp|Q8NBJ7-2|SUMF2_HUMAN	Isoform 2 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	166-UNIMOD:510,168-UNIMOD:21	0.08	29.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	22-UNIMOD:510,24-UNIMOD:21,35-UNIMOD:510,462-UNIMOD:510,468-UNIMOD:4	0.06	29.0	2	2	2
PRT	sp|Q12982|BNIP2_HUMAN	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=BNIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	112-UNIMOD:510,114-UNIMOD:21,124-UNIMOD:510	0.04	29.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	29.0	1	1	1
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	328-UNIMOD:510,330-UNIMOD:21	0.04	29.0	1	1	0
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	694-UNIMOD:510,696-UNIMOD:21,709-UNIMOD:510,695-UNIMOD:21,908-UNIMOD:510,910-UNIMOD:21	0.03	29.0	3	2	1
PRT	sp|Q9P260|RELCH_HUMAN	RAB11-binding protein RELCH OS=Homo sapiens OX=9606 GN=RELCH PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	178-UNIMOD:510,180-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	933-UNIMOD:510,936-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q14676-4|MDC1_HUMAN	Isoform 4 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	445-UNIMOD:510,445-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	4215-UNIMOD:510,4216-UNIMOD:21	0.00	28.0	1	1	0
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	19-UNIMOD:510,19-UNIMOD:21,50-UNIMOD:510,273-UNIMOD:510,279-UNIMOD:21,281-UNIMOD:4	0.09	28.0	2	2	2
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	174-UNIMOD:510,187-UNIMOD:21,191-UNIMOD:510	0.04	27.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	27.0	1	1	1
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	376-UNIMOD:510,378-UNIMOD:21,387-UNIMOD:510	0.02	27.0	1	1	1
PRT	sp|P29692-4|EF1D_HUMAN	Isoform 4 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	125-UNIMOD:510,143-UNIMOD:21,150-UNIMOD:510	0.10	27.0	1	1	1
PRT	sp|P49419-4|AL7A1_HUMAN	Isoform 4 of Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	82-UNIMOD:510,84-UNIMOD:21,93-UNIMOD:510,94-UNIMOD:510,80-UNIMOD:510	0.03	27.0	3	3	3
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	322-UNIMOD:510,325-UNIMOD:21,328-UNIMOD:4,334-UNIMOD:510	0.03	27.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	207-UNIMOD:510,210-UNIMOD:21,208-UNIMOD:510	0.00	27.0	3	2	1
PRT	sp|O95155-2|UBE4B_HUMAN	Isoform 2 of Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	103-UNIMOD:510,105-UNIMOD:21,113-UNIMOD:4,115-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	108-UNIMOD:510,110-UNIMOD:21	0.04	27.0	1	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	104-UNIMOD:510,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:510	0.12	26.0	1	1	1
PRT	sp|Q9NXC5|MIO_HUMAN	GATOR complex protein MIOS OS=Homo sapiens OX=9606 GN=MIOS PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	757-UNIMOD:510,766-UNIMOD:21,769-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	196-UNIMOD:510,205-UNIMOD:21,211-UNIMOD:510,202-UNIMOD:510,203-UNIMOD:21	0.04	26.0	2	2	2
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	92-UNIMOD:510,94-UNIMOD:21,105-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	65-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510	0.09	26.0	1	1	1
PRT	sp|P08174-4|DAF_HUMAN	Isoform 4 of Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	97-UNIMOD:510,98-UNIMOD:4,106-UNIMOD:21,110-UNIMOD:510	0.04	26.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	619-UNIMOD:510,621-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q6GYQ0-3|RGPA1_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	842-UNIMOD:510,844-UNIMOD:21	0.01	26.0	1	1	0
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	579-UNIMOD:510,581-UNIMOD:21,589-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	331-UNIMOD:510,333-UNIMOD:21,332-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	207-UNIMOD:510,218-UNIMOD:35	0.14	26.0	2	1	0
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	518-UNIMOD:510,520-UNIMOD:21,518-UNIMOD:21,521-UNIMOD:21	0.04	26.0	3	1	0
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	56-UNIMOD:510,58-UNIMOD:21	0.03	26.0	1	1	0
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	27-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	4384-UNIMOD:510,4384-UNIMOD:21	0.00	26.0	1	1	0
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	235-UNIMOD:510,238-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	186-UNIMOD:510,188-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|O75665-3|OFD1_HUMAN	Isoform 3 of Oral-facial-digital syndrome 1 protein OS=Homo sapiens OX=9606 GN=OFD1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	857-UNIMOD:510,859-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q07666-3|KHDR1_HUMAN	Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	18-UNIMOD:510,20-UNIMOD:21	0.04	25.0	1	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	35-UNIMOD:510,37-UNIMOD:21,49-UNIMOD:510,36-UNIMOD:35	0.04	25.0	2	1	0
PRT	sp|Q9HAU0-3|PKHA5_HUMAN	Isoform 3 of Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	408-UNIMOD:510,410-UNIMOD:21,419-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	546-UNIMOD:510,550-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	233-UNIMOD:510,235-UNIMOD:21,236-UNIMOD:21,243-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	1454-UNIMOD:510,1456-UNIMOD:21,1477-UNIMOD:510	0.01	24.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	607-UNIMOD:510,609-UNIMOD:21,622-UNIMOD:510	0.02	24.0	1	1	0
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	97-UNIMOD:510,100-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	0.07	24.0	1	1	1
PRT	sp|Q9ULL1|PKHG1_HUMAN	Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	608-UNIMOD:510,610-UNIMOD:21,618-UNIMOD:4,615-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	326-UNIMOD:510,332-UNIMOD:21,336-UNIMOD:510	0.02	24.0	1	1	0
PRT	sp|Q5SSJ5-3|HP1B3_HUMAN	Isoform 3 of Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	71-UNIMOD:510,75-UNIMOD:21,81-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	152-UNIMOD:510,154-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q86UU0-3|BCL9L_HUMAN	Isoform 3 of B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	116-UNIMOD:510,118-UNIMOD:21,137-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	264-UNIMOD:510,268-UNIMOD:21,262-UNIMOD:510,267-UNIMOD:21	0.05	23.0	3	2	1
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	201-UNIMOD:510,207-UNIMOD:21,205-UNIMOD:21	0.02	23.0	3	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	null	482-UNIMOD:510,493-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|Q9H6Z4|RANB3_HUMAN	Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	124-UNIMOD:510,125-UNIMOD:21,128-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	494-UNIMOD:510,495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21,521-UNIMOD:510,503-UNIMOD:21	0.05	23.0	3	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	25-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	355-UNIMOD:510,357-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	134-UNIMOD:510,139-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	11-UNIMOD:510,11-UNIMOD:35,13-UNIMOD:21,19-UNIMOD:510	0.03	22.0	2	1	0
PRT	sp|Q8TEW0-8|PARD3_HUMAN	Isoform 8 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	832-UNIMOD:510,834-UNIMOD:21,843-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	291-UNIMOD:510,294-UNIMOD:21,301-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|O14579-3|COPE_HUMAN	Isoform 3 of Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	97-UNIMOD:510,99-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9UKV8-2|AGO2_HUMAN	Isoform 2 of Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	385-UNIMOD:510,387-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9ULD2-5|MTUS1_HUMAN	Isoform 5 of Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	197-UNIMOD:510,197-UNIMOD:21,215-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q92973-3|TNPO1_HUMAN	Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	300-UNIMOD:510,300-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q92614-5|MY18A_HUMAN	Isoform 5 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	268-UNIMOD:510,268-UNIMOD:21,287-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	111-UNIMOD:510,112-UNIMOD:21,129-UNIMOD:510	0.02	22.0	1	1	0
PRT	sp|O14639|ABLM1_HUMAN	Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	450-UNIMOD:510,450-UNIMOD:21	0.02	22.0	1	1	0
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	726-UNIMOD:510,726-UNIMOD:4,727-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P53365|ARFP2_HUMAN	Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	256-UNIMOD:510,260-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 3 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	125-UNIMOD:510,135-UNIMOD:21,136-UNIMOD:4,137-UNIMOD:510	0.08	21.0	1	1	1
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	134-UNIMOD:510,142-UNIMOD:510,145-UNIMOD:21,154-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	301-UNIMOD:510,312-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	307-UNIMOD:510,312-UNIMOD:21,321-UNIMOD:510,322-UNIMOD:510	0.05	21.0	1	1	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	19-UNIMOD:510,22-UNIMOD:21,23-UNIMOD:4,35-UNIMOD:510	0.17	21.0	1	1	1
PRT	sp|Q9NZQ3-5|SPN90_HUMAN	Isoform 5 of NCK-interacting protein with SH3 domain OS=Homo sapiens OX=9606 GN=NCKIPSD	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	249-UNIMOD:510,251-UNIMOD:21,264-UNIMOD:510	0.03	21.0	1	1	0
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	110-UNIMOD:510,112-UNIMOD:21,119-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|Q3KQU3-2|MA7D1_HUMAN	Isoform 2 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	111-UNIMOD:510,116-UNIMOD:21,129-UNIMOD:510	0.02	21.0	1	1	0
PRT	sp|Q9UQ35-2|SRRM2_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	846-UNIMOD:510,848-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|O95835-2|LATS1_HUMAN	Isoform 2 of Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	462-UNIMOD:510,464-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	596-UNIMOD:510,598-UNIMOD:21,599-UNIMOD:35,604-UNIMOD:510,469-UNIMOD:510,469-UNIMOD:35,471-UNIMOD:21,480-UNIMOD:510	0.02	21.0	2	2	2
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	227-UNIMOD:510,232-UNIMOD:21,237-UNIMOD:510	0.02	21.0	1	1	0
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	18-UNIMOD:510,25-UNIMOD:21	0.07	21.0	1	1	0
PRT	sp|Q6GYQ0|RGPA1_HUMAN	Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	795-UNIMOD:510,795-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|Q01130|SRSF2_HUMAN	Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	18-UNIMOD:510,26-UNIMOD:21	0.07	21.0	1	1	0
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	655-UNIMOD:510,659-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9NZQ3|SPN90_HUMAN	NCK-interacting protein with SH3 domain OS=Homo sapiens OX=9606 GN=NCKIPSD PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	249-UNIMOD:510,254-UNIMOD:21,264-UNIMOD:510	0.02	21.0	1	1	0
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	162-UNIMOD:510,168-UNIMOD:21	0.03	20.0	1	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	125-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	47-UNIMOD:510,58-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q9NYF8-4|BCLF1_HUMAN	Isoform 4 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	317-UNIMOD:510,319-UNIMOD:21,332-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	729-UNIMOD:510,730-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	11-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q8N257|H2B3B_HUMAN	Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	35-UNIMOD:510,37-UNIMOD:21,44-UNIMOD:510	0.09	20.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	35-UNIMOD:510,37-UNIMOD:21,44-UNIMOD:510	0.09	20.0	1	1	1
PRT	sp|Q14671-4|PUM1_HUMAN	Isoform 4 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	648-UNIMOD:510,650-UNIMOD:21,659-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	107-UNIMOD:510,111-UNIMOD:21,116-UNIMOD:21,121-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	221-UNIMOD:510,223-UNIMOD:21,231-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	232-UNIMOD:510,233-UNIMOD:21,245-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	286-UNIMOD:510,287-UNIMOD:21,294-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	134-UNIMOD:510,134-UNIMOD:21,150-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	1083-UNIMOD:510,1085-UNIMOD:21,1099-UNIMOD:510,454-UNIMOD:510,456-UNIMOD:21	0.01	20.0	2	2	2
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	55-UNIMOD:510,63-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|Q07666|KHDR1_HUMAN	KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	18-UNIMOD:510,18-UNIMOD:21	0.03	20.0	1	1	0
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	259-UNIMOD:510,261-UNIMOD:21,264-UNIMOD:4,271-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	71-UNIMOD:510,74-UNIMOD:21,77-UNIMOD:4,78-UNIMOD:21	0.13	19.0	1	1	1
PRT	sp|P30043|BLVRB_HUMAN	Flavin reductase (NADPH) OS=Homo sapiens OX=9606 GN=BLVRB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	188-UNIMOD:510,188-UNIMOD:4,190-UNIMOD:21	0.10	19.0	1	1	1
PRT	sp|Q15185-4|TEBP_HUMAN	Isoform 4 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	108-UNIMOD:510,117-UNIMOD:35	0.12	19.0	1	1	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	107-UNIMOD:510,110-UNIMOD:21	0.04	19.0	1	1	0
PRT	sp|Q8TB72-4|PUM2_HUMAN	Isoform 4 of Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	529-UNIMOD:510,531-UNIMOD:21,540-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|Q9NYV4-3|CDK12_HUMAN	Isoform 3 of Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	330-UNIMOD:510,332-UNIMOD:21,333-UNIMOD:21,339-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|Q9Y580|RBM7_HUMAN	RNA-binding protein 7 OS=Homo sapiens OX=9606 GN=RBM7 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	134-UNIMOD:510,136-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q71RC2-7|LARP4_HUMAN	Isoform 7 of La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	381-UNIMOD:510,392-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	846-UNIMOD:510,856-UNIMOD:21	0.01	19.0	1	1	0
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	107-UNIMOD:510,109-UNIMOD:21	0.04	19.0	1	1	0
PRT	sp|Q9BY44|EIF2A_HUMAN	Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	521-UNIMOD:510,524-UNIMOD:21,535-UNIMOD:510,536-UNIMOD:510	0.03	19.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	NDSLSSLDFDDDDVDLSR	1	sp|P25054-2|APC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5386	52.986	2	2140.8898	2140.8898	R	E	1758	1776
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510	ms_run[2]:scan=5027	49.421	2	2226.9361	2226.9361	R	-	228	248
PSM	ANSGGVDLDSSGEFASIEK	3	sp|Q92766-5|RREB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,3-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=4526	45.019	2	2029.9518	2029.9518	R	M	1165	1184
PSM	INSSGESGDESDEFLQSR	4	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3377	35.672	2	2069.8639	2069.8639	R	K	180	198
PSM	GSSLSGTDDGAQEVVK	5	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2301	27.717	2	1696.8193	1696.8193	R	D	275	291
PSM	SSSFSSWDDSSDSYWK	6	sp|Q9NP61-2|ARFG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=5124	50.326	2	2017.8255	2017.8255	R	K	321	337
PSM	SYELPDGQVITIGNER	7	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=5023	49.392	2	1823.9478	1823.9478	K	F	239	255
PSM	DNLTLWTSDMQGDGEEQNK	8	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4822	47.558	2	2248.059	2248.0590	R	E	204	223
PSM	GSSLSGTDDGAQEVVK	9	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=2301	27.717498333333335	2	1696.8164	1696.8188	R	D	275	291
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	10	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2526	29.343	3	2847.2212	2847.2212	K	M	571	596
PSM	GGSVLVTCSTSCDQPK	11	sp|P05362|ICAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2332	27.944	2	1842.8529	1842.8529	R	L	41	57
PSM	QYTSPEEIDAQLQAEK	12	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4248	42.756	2	1996.9667	1996.9667	R	Q	16	32
PSM	STAGDTHLGGEDFDNR	13	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=1888	24.763	2	1724.7814	1724.7814	K	M	221	237
PSM	THSTSSSLGSGESPFSR	14	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2404	28.462	2	1836.8104	1836.8104	R	S	240	257
PSM	YASICQQNGIVPIVEPEILPDGDHDLK	15	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,27-UNIMOD:510	ms_run[2]:scan=5649	56.071	3	3167.5887	3167.5887	R	R	228	255
PSM	EGITDAATMKTFCGTPEYLAPEVLEDNDYGR	16	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,10-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=5869	58.945355000000006	3	3690.612629	3690.618449	K	A	295	326
PSM	TFCGTPEYLAPEVLEDNDYGR	17	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,3-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=5591	55.377345	2	2559.104460	2559.108904	K	A	308	329
PSM	THSTSSSLGSGESPFSR	18	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=2404	28.462178333333334	2	1836.808686	1836.810354	R	S	329	346
PSM	IQALQQQADEAEDR	19	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=2099	26.267	2	1647.8276	1647.8276	K	A	14	28
PSM	KEESEESDDDMGFGLFD	20	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4642	45.97	2	2032.8732	2032.8732	K	-	73	90
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	21	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:4,20-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3376	35.667	3	2979.2722	2979.2722	R	R	117	142
PSM	SVTEQGAELSNEER	22	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=1707	23.467	2	1581.7695	1581.7695	K	N	28	42
PSM	TSSTCSNESLSVGGTSVTPR	23	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2872	31.866	2	2139.9568	2139.9568	R	R	686	706
PSM	YASICQQNGIVPIVEPEILPDGDHDLK	24	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:4,27-UNIMOD:510	ms_run[1]:scan=5649	56.07129333333334	3	3167.5857	3167.5881	R	R	174	201
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	25	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=3457	36.29	3	3112.2782	3112.2782	K	L	595	622
PSM	DNLTLWTSDQQDEEAGEGN	26	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=4972	48.99	2	2154.9402	2154.9402	R	-	228	247
PSM	GASQAGMTGYGMPR	27	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=2183	26.877	2	1512.6315	1512.6315	R	Q	204	218
PSM	GILAADESTGSIAK	28	sp|P04075-2|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2985	32.687	2	1479.7858	1479.7858	K	R	83	97
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	29	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=1954	25.233	3	2523.2027	2523.2027	R	S	283	308
PSM	TASFSESRADEVAPAK	30	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2062	26.004	2	1812.8931	1812.8931	R	K	192	208
PSM	DLADELALVDVIEDK	31	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6544	68.566	2	1724.972	1724.9720	K	L	43	58
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	32	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:4,4-UNIMOD:21,6-UNIMOD:21,20-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4268	42.913	3	3139.2049	3139.2049	R	R	117	142
PSM	NRPTSISWDGLDSGK	33	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3865	39.489	2	1779.8829	1779.8829	K	L	48	63
PSM	SESLDPDSSMDTTLILK	34	sp|Q5SW79|CE170_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:35,17-UNIMOD:510	ms_run[2]:scan=4557	45.268	2	2014.9694	2014.9694	R	D	879	896
PSM	SESLDPDSSMDTTLILK	35	sp|Q5SW79|CE170_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=5267	51.732	2	1998.9745	1998.9745	R	D	879	896
PSM	TDSVIIADQTPTPTR	36	sp|P17544-5|ATF7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3044	33.11	2	1727.8555	1727.8555	R	F	42	57
PSM	QYTSPEEIDAQLQAEK	37	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=4248	42.756296666666664	2	1996.9644	1996.9662	R	Q	16	32
PSM	NRPTSISWDGLDSGK	38	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3865	39.489403333333335	2	1779.8814	1779.8824	K	L	48	63
PSM	DNLTLWTSDQQDDDGGEGNN	39	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=4906	48.398	2	2226.9361	2226.9361	R	-	228	248
PSM	EVDEQMLNVQNK	40	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2870	31.853	2	1513.8083	1513.8083	K	N	325	337
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	41	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:4,4-UNIMOD:21,20-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3835	39.226	3	3059.2386	3059.2386	R	R	117	142
PSM	QDENDDDDDWNPCK	42	sp|Q14974-2|IMB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,13-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=2440	28.72	2	1832.7432	1832.7432	K	A	188	202
PSM	SCSLDLGDAGCYGYAR	43	sp|Q6PJG9|LRFN4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:4,3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=4246	42.739	2	1877.7538	1877.7538	R	R	583	599
PSM	DSSTSPGDYVLSVSENSR	44	sp|P46108-2|CRK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4726	46.686	2	2012.8788	2012.8788	R	V	39	57
PSM	EGLELPEDEEEK	45	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3062	33.242	2	1483.7566	1483.7566	K	K	539	551
PSM	GASWIDTADGSANHR	46	sp|Q8NBJ7-2|SUMF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3059	33.22	2	1670.7262	1670.7262	R	A	166	181
PSM	GVSLTNHHFYDESK	47	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2634	30.144	2	1780.8458	1780.8458	R	P	22	36
PSM	KGSITEYTAAEEK	48	sp|Q12982|BNIP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1844	24.444	2	1607.8544	1607.8544	R	E	112	125
PSM	RALANSLACQGK	49	sp|P04075-2|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1345	20.842	2	1435.7643	1435.7643	K	Y	385	397
PSM	TAFQEALDAAGDK	50	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3467	36.365	2	1403.7569	1403.7569	K	L	9	22
PSM	EGITDAATMKTFCGTPEYLAPEVLEDNDYGR	51	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,9-UNIMOD:35,10-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=5670	56.29033166666667	3	3706.6062	3706.6128	K	A	295	326
PSM	TASGSSVTSLDGTR	52	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2032	25.791608333333333	2	1451.6708	1451.6712	R	S	328	342
PSM	SESLDPDSSMDTTLILK	53	sp|Q5SW79|CE170_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:35,17-UNIMOD:510	ms_run[1]:scan=4557	45.26767833333333	2	2014.9667	2014.9689	R	D	879	896
PSM	RSTQGVTLTDLQEAEK	54	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=3260	34.71590833333333	2	1922.995204	1922.998672	R	T	694	710
PSM	AGSISTLDSLDFAR	55	sp|Q9P260|RELCH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5235	51.445	2	1565.7551	1565.7551	R	Y	178	192
PSM	DNLTLWTSDQQDDDGGEGNN	56	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=5352	52.672	2	2226.9361	2226.9361	R	-	228	248
PSM	ELISNASDALDK	57	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2960	32.514	2	1342.7616	1342.7616	R	I	42	54
PSM	RNTTQNTGYSSGTQNANYPVR	58	sp|Q12965|MYO1E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1609	22.761	3	2442.1137	2442.1137	R	A	933	954
PSM	RPHFPQFSYSASGRE	59	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=3533	36.871	2	1958.829	1958.8290	R	-	465	480
PSM	SQTTTERDSDTDVEEEELPVENR	60	sp|Q14676-4|MDC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3006	32.841	3	2792.2086	2792.2086	R	E	445	468
PSM	SSSVGSSSSYPISPAVSR	61	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3019	32.934	2	1867.8777	1867.8777	R	T	4215	4233
PSM	TASGSSVTSLDGTR	62	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2032	25.792	2	1451.6717	1451.6717	R	S	247	261
PSM	TPEELDDSDFETEDFDVR	63	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=5169	50.749	2	2271.9157	2271.9157	R	S	264	282
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	64	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21,32-UNIMOD:510	ms_run[2]:scan=2021	25.711	3	2580.1514	2580.1514	R	A	19	51
PSM	GADFLVTEVENGGSLGSK	65	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,14-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=5142	50.498	2	1926.9612	1926.9612	K	K	174	192
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	66	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2308	27.767	3	2826.1852	2826.1852	R	E	418	442
PSM	GRSFAGNLNTYK	67	sp|Q01813-2|PFKAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2436	28.693	2	1474.7606	1474.7606	R	R	376	388
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	68	sp|P29692-4|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,19-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4256	42.817	3	3090.3451	3090.3451	K	E	125	151
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	69	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:4,4-UNIMOD:21,7-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4255	42.811	3	3059.2386	3059.2386	R	R	117	142
PSM	QASVADYEETVK	70	sp|P49419-4|AL7A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2693	30.574	2	1486.7229	1486.7229	R	K	82	94
PSM	QVQSLTCEVDALK	71	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=4555	45.253	2	1637.8372	1637.8372	R	G	322	335
PSM	RQQSEISAAVER	72	sp|Q9Y520-2|PRC2C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1478	21.808	2	1486.7353	1486.7353	R	A	207	219
PSM	SQSMDIDGVSCEK	73	sp|O95155-2|UBE4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2702	30.637	2	1602.6943	1602.6943	R	S	103	116
PSM	STSQGSINSPVYSR	74	sp|O14639-4|ABLM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2190	26.928	2	1595.7405	1595.7405	R	H	108	122
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	75	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,3-UNIMOD:4,4-UNIMOD:21,6-UNIMOD:21,17-UNIMOD:35,20-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=3692	38.047145	3	3155.1936	3155.1993	R	R	117	142
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	76	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=3767	38.626	4	3527.556	3527.5560	K	L	104	135
PSM	DNLTLWTSDQQDDDGGEGNN	77	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=5136	50.429	2	2226.9361	2226.9361	R	-	228	248
PSM	EVDEQMLNVQNK	78	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1851	24.495	2	1529.8032	1529.8032	K	N	325	337
PSM	EVIIAKDEVAHTLTESR	79	sp|Q9Y243|AKT3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2834	31.591	3	2058.1035	2058.1035	K	V	182	199
PSM	GFSQYGVSGSPTK	80	sp|Q9NXC5|MIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2782	31.211	2	1461.7177	1461.7177	R	S	757	770
PSM	HSGSDRSSFSHYSGLK	81	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1778	23.963	2	1898.8949	1898.8949	R	H	196	212
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	82	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:4,20-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3169	34.037	3	2995.2671	2995.2671	R	R	117	142
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	83	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:4,6-UNIMOD:21,20-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3725	38.286	3	3075.2335	3075.2335	R	R	117	142
PSM	RGSLSNAGDPEIVK	84	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1936	25.107	2	1589.8451	1589.8451	R	S	92	106
PSM	RNQSFCPTVNLDK	85	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2802	31.357	2	1725.8546	1725.8546	K	L	65	78
PSM	SCEVPTRLNSASLK	86	sp|P08174-4|DAF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2592	29.815	2	1708.8856	1708.8856	R	Q	97	111
PSM	SQSFSEAEPQLPPAPVR	87	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4001	40.619	2	1952.9457	1952.9457	R	G	619	636
PSM	SRTHSTSSSLGSGESPFSR	88	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1948	25.192	2	2079.9435	2079.9435	R	S	238	257
PSM	SSSTSDILEPFTVER	89	sp|Q6GYQ0-3|RGPA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5336	52.529	2	1780.8344	1780.8344	R	A	842	857
PSM	SSTLSQLPGDK	90	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2384	28.319	2	1279.6697	1279.6697	R	S	579	590
PSM	SSTVTEAPIAVVTSR	91	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3974	40.394	2	1630.8391	1630.8391	R	T	331	346
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	92	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:35	ms_run[2]:scan=4424	44.232	3	3506.5004	3506.5004	R	-	207	238
PSM	TQSSASLAASYAAQQHPQAAASYR	93	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3011	32.877	3	2578.2026	2578.2026	R	G	518	542
PSM	TSSLTQFPPSQSEER	94	sp|Q9H6Z4-3|RANB3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3776	38.728	2	1806.8249	1806.8249	R	S	56	71
PSM	VEIIANDQGNR	95	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510	ms_run[1]:scan=1728	23.618479999999998	2	1261.6829	1261.6834	K	T	27	38
PSM	RSTQGVTLTDLQEAEK	96	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=3260	34.71590833333333	2	1922.9946	1922.9981	R	T	694	710
PSM	SSSVGSSSSYPISPAVSR	97	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=3019	32.93419	2	1867.8734	1867.8772	R	T	4384	4402
PSM	TQSSASLAASYAAQQHPQAAASYR	98	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=3011	32.87665166666667	3	2578.1990	2578.2020	R	G	518	542
PSM	ESLKEEDESDDDNM	99	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:510	ms_run[2]:scan=1656	23.099	2	1722.7414	1722.7414	K	-	235	249
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	100	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:4,4-UNIMOD:21,7-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4090	41.443	3	3075.2335	3075.2335	R	R	117	142
PSM	RDSFDDRGPSLNPVLDYDHGSR	101	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3678	37.948	4	2631.1927	2631.1927	R	S	186	208
PSM	RLQSIGTENTEENRR	102	sp|P04075-2|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1334	20.763	2	1915.9325	1915.9325	K	F	97	112
PSM	RLSQSDEDVIR	103	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1946	25.178	2	1430.6979	1430.6979	K	L	119	130
PSM	RPHFPQFSYSASGRE	104	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3488	36.543	2	1958.829	1958.8290	R	-	465	480
PSM	RQSNLQEVLER	105	sp|O75665-3|OFD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2748	30.968	2	1484.7561	1484.7561	R	E	857	868
PSM	SGSMDPSGAHPSVR	106	sp|Q07666-3|KHDR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1279	20.363	2	1497.6496	1497.6496	R	Q	18	32
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	107	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=4934	48.627	3	3490.5054	3490.5054	R	-	207	238
PSM	TMSEVGGSVEDLIAK	108	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=5285	51.956	2	1682.8474	1682.8474	R	G	35	50
PSM	TNSMQQLEQWIK	109	sp|Q9HAU0-3|PKHA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5443	53.667	2	1652.827	1652.8270	R	I	408	420
PSM	TQSSASLAASYAAQQHPQAAASYR	110	sp|Q96PK6|RBM14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=3011	32.87665166666667	3	2578.199526	2578.202562	R	G	518	542
PSM	ERLESLNIQR	111	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2948	32.428	2	1370.7131	1370.7131	K	E	546	556
PSM	GEPNVSYICSR	112	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2527	29.35	2	1394.6114	1394.6114	R	Y	273	284
PSM	LQSIGTENTEENR	113	sp|P04075-2|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1808	24.191	2	1603.7303	1603.7303	R	R	98	111
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	114	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2986	32.692	3	2685.0632	2685.0632	K	M	572	596
PSM	RLSSLRASTSK	115	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1411	21.316	2	1432.7477	1432.7477	R	S	233	244
PSM	RNSVERPAEPVAGAATPSLVEQQK	116	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2653	30.28	3	2681.4174	2681.4174	R	M	1454	1478
PSM	RSTQGVTLTDLQEAEK	117	sp|O14974-5|MYPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3277	34.842	2	1922.9987	1922.9987	R	T	607	623
PSM	SLQSVAEER	118	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2562	29.6	2	1131.5385	1131.5385	R	A	97	106
PSM	TDYNASVSVPDSSGPER	119	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2794	31.3	2	1893.8206	1893.8206	R	I	70	87
PSM	VRYSLDPENPTK	120	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2670	30.412	2	1565.8127	1565.8127	M	S	2	14
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	121	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:4,6-UNIMOD:21,7-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=4090	41.44285166666667	3	3075.2271	3075.2329	R	R	117	142
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	122	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:4,4-UNIMOD:21,6-UNIMOD:21,20-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=4054	41.11431333333333	3	3155.1937	3155.1993	R	R	117	142
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	123	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:4,4-UNIMOD:21,17-UNIMOD:35,20-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=2978	32.638405	3	3091.2204	3091.2279	R	R	117	142
PSM	RPHFPQFSYSASGRE	124	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=7234	80.96785166666666	3	1958.8284	1958.8285	R	-	465	480
PSM	RASSAGESNTCPPEIGTSDR	125	sp|Q9ULL1|PKHG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1600	22.697238333333335	3	2204.9541	2204.9576	R	T	608	628
PSM	TLNMTTSPEEK	126	sp|P49915|GUAA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2146	26.611385	2	1397.6772	1397.6781	K	R	326	337
PSM	GASGSFVVVQK	127	sp|Q5SSJ5-3|HP1B3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2585	29.764	2	1225.6744	1225.6744	K	S	71	82
PSM	HRTLTAEEAEEEWER	128	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2907	32.13	3	1998.8897	1998.8897	R	R	152	167
PSM	SVSVDSGEQREAGTPSLDSEAK	129	sp|Q86UU0-3|BCL9L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=2448	28.776	3	2396.1381	2396.1381	R	E	116	138
PSM	VTDSSVSVQLRE	130	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2846	31.677	2	1432.7023	1432.7023	R	-	264	276
PSM	RPHFPQFSYSASGRE	131	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=3978	40.42734166666667	3	1958.8277	1958.8285	R	-	465	480
PSM	RPHFPQFSYSASGRE	132	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=7992	93.90496166666667	3	1958.8280	1958.8285	R	-	465	480
PSM	ARPATDSFDDYPPR	133	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=2483	29.02999	3	1720.7653	1720.7665	R	R	201	215
PSM	SSTVTEAPIAVVTSR	134	sp|Q8TD19|NEK9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3974	40.393505	2	1630.8383	1630.8386	R	T	331	346
PSM	NAGVEGSLIVEK	135	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=2742	30.924265000000002	2	1282.776779	1282.776901	K	I	482	494
PSM	TSSLTQFPPSQSEER	136	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3776	38.727925	2	1806.8228	1806.8244	R	S	124	139
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	137	sp|Q9BRS2|RIOK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510	ms_run[1]:scan=1277	20.348066666666664	3	3246.2752	3246.2872	R	K	494	522
PSM	EQFLDGDGWTSR	138	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3981	40.467	2	1443.6843	1443.6843	K	W	25	37
PSM	INSSGESGDESDEFLQSRK	139	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2652	30.273	3	2232.022	2232.0220	R	G	180	199
PSM	LGSTSGEESDLEREVSDSEAGGGPQGER	140	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4157	42	3	2948.2733	2948.2733	R	K	355	383
PSM	LYGPSSVSFADDFVR	141	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=5524	54.653	2	1772.8235	1772.8235	R	S	134	149
PSM	MESALDQLK	142	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2687	30.533	2	1197.5989	1197.5989	R	Q	11	20
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	143	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:4,4-UNIMOD:21,17-UNIMOD:35,20-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3256	34.688	3	3075.2335	3075.2335	R	R	117	142
PSM	NFSDNQLQEGK	144	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1913	24.942	2	1346.7103	1346.7103	R	N	182	193
PSM	QASVADYEETVKK	145	sp|P49419-4|AL7A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2245	27.315	3	1648.881	1648.8810	R	A	82	95
PSM	QEYDESGPSIVHR	146	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1767	23.884	3	1549.7585	1549.7585	K	K	360	373
PSM	QFSDASQLDFVK	147	sp|Q8TEW0-8|PARD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4736	46.764	2	1531.7596	1531.7596	K	T	832	844
PSM	RAESMLQQADK	148	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1691	23.35	2	1423.7167	1423.7167	K	L	291	302
PSM	RASSAGESNTCPPEIGTSDR	149	sp|Q9ULL1|PKHG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=1600	22.697	3	2204.9582	2204.9582	R	T	608	628
PSM	RDSIVAELDR	150	sp|O14579-3|COPE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2874	31.881	2	1286.6444	1286.6444	R	E	97	107
PSM	RPHFPQFSYSASGRE	151	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3245	34.613	3	1878.8627	1878.8627	R	-	465	480
PSM	RPHFPQFSYSASGRE	152	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6770	72.437	3	1958.829	1958.8290	R	-	465	480
PSM	SASFNTDPYVR	153	sp|Q9UKV8-2|AGO2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3146	33.872	2	1369.6128	1369.6128	R	E	385	396
PSM	SGSTSSLSYSTWTSSHSDK	154	sp|Q9ULD2-5|MTUS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3143	33.849	3	2151.9634	2151.9634	R	T	197	216
PSM	SRTVAQQHDEDGIEEEDDDDDEIDDDDTISDWNLR	155	sp|Q92973-3|TNPO1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4695	46.401	4	4218.6995	4218.6995	R	K	300	335
PSM	STSFRQGPEESGLGDGTGPK	156	sp|Q92614-5|MY18A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2365	28.181	3	2154.0267	2154.0267	R	L	268	288
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	157	sp|Q9BRS2|RIOK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510	ms_run[2]:scan=1276	20.343	4	3246.2875	3246.2875	R	K	494	522
PSM	RPHFPQFSYSASGRE	158	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=3741	38.40636666666667	3	1958.8277	1958.8285	R	-	465	480
PSM	SGSYSYLEER	159	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2888	31.980995	2	1303.5535	1303.5541	R	K	908	918
PSM	ARPATDSFDDYPPR	160	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=2347	28.049843333333335	3	1720.7653	1720.7665	R	R	201	215
PSM	RSSQPSPTAVPASDSPPTK	161	sp|Q3KQU3|MA7D1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=1492	21.910548333333335	3	2057.044760	2057.046685	R	Q	111	130
PSM	STSQGSINSPVYSR	162	sp|O14639|ABLM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=2190	26.92775	2	1595.737863	1595.740484	R	H	450	464
PSM	CSVSLSNVEAR	163	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21	ms_run[2]:scan=2979	32.645	2	1334.6114	1334.6114	R	R	726	737
PSM	GASQAGMTGYGMPR	164	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=1318	20.649	2	1528.6264	1528.6264	R	Q	204	218
PSM	GRLESAQATFQAHR	165	sp|P53365|ARFP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2024	25.733	3	1684.8259	1684.8259	R	D	256	270
PSM	IIYGGSVTGATCK	166	sp|P60174-4|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2547	29.494	2	1473.7575	1473.7575	R	E	125	138
PSM	IQVLQQQADDAEER	167	sp|P06753-4|TPM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2113	26.37	2	1641.7958	1641.7958	K	A	14	28
PSM	MESALDQLK	168	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3352	35.444	2	1181.604	1181.6040	R	Q	11	20
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	169	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:4,4-UNIMOD:21,7-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4292	43.1	3	3059.2386	3059.2386	R	R	117	142
PSM	NFSDNQLQEGK	170	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2437	28.699	2	1426.6766	1426.6766	R	N	182	193
PSM	NGSLDSPGKQDTEEDEEEDEK	171	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:510,12-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=1395	21.203	3	2532.1125	2532.1125	K	D	134	155
PSM	NNASTDYDLSDK	172	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1638	22.968	2	1409.6947	1409.6947	K	S	301	313
PSM	NTVSQSISGDPEIDKK	173	sp|Q9BY44-2|EIF2A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,15-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=1963	25.298	3	1899.0087	1899.0087	R	I	307	323
PSM	QQSEISAAVER	174	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2033	25.798	2	1330.6342	1330.6342	R	A	208	219
PSM	RGQTCVVHYTGMLEDGK	175	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=3175	34.078	3	2098.0013	2098.0013	K	K	19	36
PSM	RGTHTTVSQVQPPPSK	176	sp|Q9NZQ3-5|SPN90_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1031	18.464	3	1866.9989	1866.9989	R	A	249	265
PSM	RLSEDYGVLK	177	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2871	31.86	2	1326.7221	1326.7221	R	T	110	120
PSM	RPHFPQFSYSASGRE	178	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=3675	37.926	2	1958.829	1958.8290	R	-	465	480
PSM	RSSQPSPTAVPASDSPPTK	179	sp|Q3KQU3-2|MA7D1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=1492	21.911	3	2057.0467	2057.0467	R	Q	111	130
PSM	SGTPPRQGSITSPQANEQSVTPQR	180	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1967	25.323	3	2636.2768	2636.2768	K	R	846	870
PSM	SNSFNNPLGNR	181	sp|O95835-2|LATS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3048	33.14	2	1332.6036	1332.6036	R	A	462	473
PSM	SRINSSGESGDESDEFLQSR	182	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=2825	31.527	3	2312.997	2312.9970	R	K	178	198
PSM	SYTMDDAWK	183	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:35,9-UNIMOD:510	ms_run[2]:scan=2763	31.075	2	1279.5468	1279.5468	R	Y	596	605
PSM	TFCGTPEYLAPEVLEDNDYGR	184	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=5752	57.319	3	2559.1089	2559.1089	K	A	305	326
PSM	TLNMTTSPEEK	185	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2146	26.611	2	1397.6786	1397.6786	K	R	227	238
PSM	TMSEVGGSVEDLIAK	186	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:35,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4616	45.752	2	1698.8424	1698.8424	R	G	35	50
PSM	TRVTDSSVSVQLRE	187	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2589	29.792	2	1689.8511	1689.8511	R	-	262	276
PSM	VDNLTYRTSPDTLR	188	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2704	30.651	2	1763.8667	1763.8667	K	R	18	32
PSM	VIGSGCNLDSAR	189	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1571	22.487	2	1281.656	1281.6560	R	F	100	112
PSM	RPHFPQFSYSASGRE	190	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=7051	77.59278833333333	3	1958.8275	1958.8285	R	-	465	480
PSM	RPHFPQFSYSASGRE	191	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=5870	58.95155166666666	3	1958.8284	1958.8285	R	-	465	480
PSM	RPHFPQFSYSASGRE	192	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=6258	64.14894166666666	3	1958.8283	1958.8285	R	-	465	480
PSM	SSSTSDILEPFTVER	193	sp|Q6GYQ0|RGPA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=5336	52.52944833333333	2	1780.8336	1780.8339	R	A	795	810
PSM	VDNLTYRTSPDTLR	194	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=2704	30.650934999999997	2	1763.8649	1763.8662	K	R	18	32
PSM	GPLQSVQVFGR	195	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=4167	42.08280333333333	2	1300.6747	1300.6748	K	K	5	16
PSM	RNSSSPVSPASVPGQR	196	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=1545	22.299076666666668	3	1738.8561	1738.8571	R	R	655	671
PSM	RGTHTTVSQVQPPPSK	197	sp|Q9NZQ3|SPN90_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=1031	18.46435	3	1866.997502	1866.998946	R	A	249	265
PSM	ARPATDSFDDYPPR	198	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2737	30.888	2	1720.767	1720.7670	R	R	162	176
PSM	DAGTIAGLNVLR	199	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=5182	50.9	2	1312.6964	1312.6964	K	I	160	172
PSM	DNNQFASASLDR	200	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2496	29.124	2	1370.6639	1370.6639	K	T	125	137
PSM	EALQDVEDENQ	201	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2366	28.189	2	1322.605	1322.6050	K	-	223	234
PSM	ELISNSSDALDK	202	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2405	28.47	2	1358.7566	1358.7566	R	I	47	59
PSM	GRSSFYPDGGDQETAK	203	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1754	23.797	3	1861.852	1861.8520	R	T	317	333
PSM	GSFSGQAQPLR	204	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2121	26.429	2	1260.6076	1260.6076	R	T	729	740
PSM	HGESAWNLENR	205	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2001	25.57	2	1345.6587	1345.6587	R	F	11	22
PSM	KESYSIYVYK	206	sp|Q8N257|H2B3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3187	34.165	2	1460.8053	1460.8053	R	V	35	45
PSM	KESYSVYVYK	207	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2753	31.003	2	1446.7896	1446.7896	R	V	35	45
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	208	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:4,4-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3728	38.305	3	2995.2671	2995.2671	R	R	117	142
PSM	RDSLTGSSDLYK	209	sp|Q14671-4|PUM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2167	26.764	2	1488.7498	1488.7498	R	R	648	660
PSM	RQAVTNPNNTFYATK	210	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2211	27.075	3	1951.9231	1951.9231	K	R	107	122
PSM	RQQSEISAAVER	211	sp|Q9Y520-2|PRC2C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1476	21.793	3	1486.7353	1486.7353	R	A	207	219
PSM	SASWGSADQLK	212	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3086	33.417	2	1296.6388	1296.6388	R	E	221	232
PSM	SSFSHYSGLK	213	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2230	27.209	2	1259.6224	1259.6224	R	H	202	212
PSM	SSGPYGGGGQYFAK	214	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3082	33.389	2	1522.713	1522.7130	R	P	232	246
PSM	STFVLDEFK	215	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=5228	51.368	2	1232.6366	1232.6366	K	R	286	295
PSM	SVGDGETVEFDVVEGEK	216	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4749	46.869	2	1942.9085	1942.9085	R	G	134	151
PSM	TASETRSEGSEYEEIPK	217	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=2232	27.222	2	2059.9623	2059.9623	R	R	1083	1100
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	218	sp|Q9BRS2|RIOK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:4,10-UNIMOD:21,13-UNIMOD:4,28-UNIMOD:510	ms_run[2]:scan=1277	20.348	3	3246.2875	3246.2875	R	K	494	522
PSM	TLSDYNIQK	219	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=2133	26.517	2	1148.6714	1148.6714	R	E	55	64
PSM	RPHFPQFSYSASGRE	220	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=4091	41.448528333333336	3	1958.8277	1958.8285	R	-	465	480
PSM	SGSMDPSGAHPSVR	221	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=1279	20.363364999999998	2	1497.6471	1497.6490	R	Q	18	32
PSM	VDSTTCLFPVEEK	222	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[1]:scan=4521	44.982058333333335	2	1672.8152	1671.8102	R	A	259	272
PSM	TSSLTQFPPSQSEER	223	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3776	38.727925	2	1806.823371	1806.824942	R	S	124	139
PSM	ARLTEGCSFR	224	sp|P42677|RS27_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=2202	27.011	2	1389.5726	1389.5726	K	R	71	81
PSM	CLTTDEYDGHSTYPSHQYQ	225	sp|P30043|BLVRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=2627	30.094	3	2414.9575	2414.9575	R	-	188	207
PSM	DWEDDSDEDMSNFDR	226	sp|Q15185-4|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=3260	34.716	2	1924.7117	1924.7117	K	F	108	123
PSM	EDQTEYLEER	227	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2092	26.216	2	1344.6258	1344.6258	K	R	187	197
PSM	EQVANSAFVER	228	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1943	25.157	2	1282.673	1282.6730	K	V	492	503
PSM	ERLESLNIQR	229	sp|Q14152-2|EIF3A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2950	32.442	3	1370.7131	1370.7131	K	E	546	556
PSM	KEESEESDDDMGFGLFD	230	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=5402	53.183	2	2016.8783	2016.8783	K	-	73	90
PSM	KQSSSEISLAVER	231	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2438	28.706	2	1580.8447	1580.8447	R	A	454	467
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	232	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:4,17-UNIMOD:35,20-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=2539	29.435	3	3011.262	3011.2621	R	R	117	142
PSM	MYSFDDVLEEGK	233	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5029	49.435	2	1595.7103	1595.7103	R	R	469	481
PSM	NVTELNEPLSNEER	234	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2857	31.757	2	1676.843	1676.8430	K	N	29	43
PSM	QASTDAGTAGALTPQHVR	235	sp|P46937-5|YAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1861	24.566	3	1893.9158	1893.9158	R	A	107	125
PSM	RESLSTSSDLYK	236	sp|Q8TB72-4|PUM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2161	26.721	2	1532.776	1532.7760	R	R	529	541
PSM	RPHFPQFSYSASGRE	237	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3190	34.187	2	1878.8627	1878.8627	R	-	465	480
PSM	RPHFPQFSYSASGRE	238	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=5457	53.812	3	1958.829	1958.8290	R	-	465	480
PSM	RRSSSPFLSK	239	sp|Q9NYV4-3|CDK12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1564	22.436	3	1391.7	1391.7000	R	R	330	340
PSM	SFSSPENFQR	240	sp|Q9Y580|RBM7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3065	33.263	2	1311.5709	1311.5709	R	Q	134	144
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	241	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=1942	25.151	4	2523.2027	2523.2027	R	S	283	308
PSM	SRTHSTSSSLGSGESPFSR	242	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1924	25.024	3	2079.9435	2079.9435	R	S	238	257
PSM	SRTHSTSSSLGSGESPFSR	243	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,3-UNIMOD:21	ms_run[2]:scan=2371	28.226	3	2159.9098	2159.9098	R	S	238	257
PSM	SSGGSEHSTEGSVSLGDGQLNR	244	sp|Q71RC2-7|LARP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2120	26.421	3	2273.9974	2273.9974	R	Y	381	403
PSM	TRVTDSSVSVQLRE	245	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2583	29.75	3	1689.8511	1689.8511	R	-	262	276
PSM	VRQASVADYEETVK	246	sp|P49419-4|AL7A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2497	29.131	3	1741.8924	1741.8924	R	K	80	94
PSM	YEQGTGCWQGPNR	247	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=1915	24.957	2	1585.7156	1585.7156	K	S	462	475
PSM	MNCSPTSQIDNIGEEEMDASTTHHK	248	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:4,4-UNIMOD:21,6-UNIMOD:21,20-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=4280	43.00698666666666	4	3139.2018	3139.2044	R	R	117	142
PSM	RPHFPQFSYSASGRE	249	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=4336	43.513481666666664	3	1958.8277	1958.8285	R	-	465	480
PSM	RPHFPQFSYSASGRE	250	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=4825	47.58074833333333	3	1958.8284	1958.8285	R	-	465	480
PSM	RPHFPQFSYSASGRE	251	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=3601	37.39439333333333	3	1958.8277	1958.8285	R	-	465	480
PSM	RPHFPQFSYSASGRE	252	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=6181	63.081525	3	1958.8284	1958.8285	R	-	465	480
PSM	SRTHSTSSSLGSGESPFSR	253	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=2371	28.225765000000003	3	2159.9074	2159.9093	R	S	327	346
PSM	ARPATDSFDDYPPR	254	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=2207	27.047040000000003	3	1720.7653	1720.7665	R	R	201	215
PSM	SGTPPRQGSITSPQANEQSVTPQR	255	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=1967	25.322766666666666	3	2636.2727	2636.2763	K	R	846	870
PSM	QASTDAGTAGALTPQHVR	256	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1861	24.56635	3	1893.9123	1893.9153	R	A	107	125
PSM	NTVSQSISGDPEIDKK	257	sp|Q9BY44|EIF2A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510,16-UNIMOD:510	ms_run[1]:scan=1963	25.297836666666665	3	1899.0068	1899.0082	R	I	521	537
PSM	RPHFPQFSYSASGRE	258	sp|Q9Y243|AKT3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=3978	40.42734166666667	3	1958.828152	1958.828995	R	-	465	480