MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100630_008PKCz_PRKCZ.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100630_008PKCz_PRKCZ.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	50.0	null	333-UNIMOD:510,353-UNIMOD:21	0.06	50.0	1	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	228-UNIMOD:510	0.09	43.0	7	1	0
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	43.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	180-UNIMOD:510,186-UNIMOD:21,196-UNIMOD:21,183-UNIMOD:21	0.02	43.0	3	1	0
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	119-UNIMOD:510,136-UNIMOD:21,137-UNIMOD:510	0.06	41.0	2	1	0
PRT	sp|Q15185-4|TEBP_HUMAN	Isoform 4 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	108-UNIMOD:510,117-UNIMOD:35	0.12	40.0	2	1	0
PRT	sp|Q05513|KPCZ_HUMAN	Protein kinase C zeta type OS=Homo sapiens OX=9606 GN=PRKCZ PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	199-UNIMOD:510,217-UNIMOD:21,216-UNIMOD:21,183-UNIMOD:510,184-UNIMOD:35,186-UNIMOD:21,188-UNIMOD:35,198-UNIMOD:510,569-UNIMOD:510,573-UNIMOD:21,587-UNIMOD:21	0.11	38.0	6	3	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	204-UNIMOD:510,213-UNIMOD:35,222-UNIMOD:510,223-UNIMOD:510	0.13	36.0	4	2	1
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	463-UNIMOD:510,473-UNIMOD:21,482-UNIMOD:510	0.01	35.0	1	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	292-UNIMOD:510,306-UNIMOD:510,492-UNIMOD:510,457-UNIMOD:510,459-UNIMOD:21,462-UNIMOD:21,42-UNIMOD:510,53-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510,551-UNIMOD:510,613-UNIMOD:510,617-UNIMOD:35,620-UNIMOD:35,621-UNIMOD:35,623-UNIMOD:510,187-UNIMOD:510	0.15	35.0	11	9	7
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	228-UNIMOD:510	0.08	34.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,36-UNIMOD:21,61-UNIMOD:510	0.07	34.0	3	2	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	418-UNIMOD:510,435-UNIMOD:21,441-UNIMOD:510	0.05	34.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	34.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	239-UNIMOD:510,19-UNIMOD:510,360-UNIMOD:510	0.11	34.0	3	3	3
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510	0.02	33.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	354-UNIMOD:510,365-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	null	355-UNIMOD:510,366-UNIMOD:21	0.06	32.0	1	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	44-UNIMOD:510,64-UNIMOD:21,253-UNIMOD:510,265-UNIMOD:510	0.05	31.0	2	2	2
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	null	661-UNIMOD:510,675-UNIMOD:21,689-UNIMOD:510	0.04	31.0	1	1	0
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	null	463-UNIMOD:510,475-UNIMOD:21,482-UNIMOD:510	0.01	31.0	1	1	0
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	144-UNIMOD:510,169-UNIMOD:510,162-UNIMOD:21	0.10	30.0	2	1	0
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	446-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	125-UNIMOD:510	0.01	29.0	1	1	1
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	288-UNIMOD:510	0.03	29.0	1	1	1
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	102-UNIMOD:510,103-UNIMOD:35,111-UNIMOD:4,114-UNIMOD:21,115-UNIMOD:510	0.05	29.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	29.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	16-UNIMOD:510,27-UNIMOD:21,28-UNIMOD:510,93-UNIMOD:510,103-UNIMOD:510	0.06	29.0	2	2	2
PRT	sp|Q9BUJ2-3|HNRL1_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	387-UNIMOD:510,398-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	108-UNIMOD:510,120-UNIMOD:21,121-UNIMOD:510,107-UNIMOD:510,116-UNIMOD:21,118-UNIMOD:21	0.02	29.0	5	2	0
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	29.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	129-UNIMOD:510,130-UNIMOD:21,144-UNIMOD:510,138-UNIMOD:21,126-UNIMOD:510,135-UNIMOD:21	0.08	28.0	4	2	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	44-UNIMOD:510,55-UNIMOD:21,54-UNIMOD:21,8-UNIMOD:510	0.17	28.0	3	2	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	151-UNIMOD:510,168-UNIMOD:21	0.08	28.0	1	1	0
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	28.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	232-UNIMOD:510,233-UNIMOD:21,245-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|Q96EY7-2|PTCD3_HUMAN	Isoform 2 of Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	252-UNIMOD:510,261-UNIMOD:21,280-UNIMOD:510	0.11	27.0	1	1	0
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	74-UNIMOD:510,76-UNIMOD:35	0.11	27.0	2	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510	0.06	27.0	2	2	2
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	217-UNIMOD:510,224-UNIMOD:21,192-UNIMOD:510,200-UNIMOD:21	0.15	27.0	2	2	2
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	73-UNIMOD:510,83-UNIMOD:35,79-UNIMOD:21	0.20	27.0	2	1	0
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	65-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510	0.09	27.0	1	1	1
PRT	sp|P22492|H1T_HUMAN	Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	69-UNIMOD:510,79-UNIMOD:510	0.06	26.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	82-UNIMOD:510	0.09	26.0	1	1	1
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	373-UNIMOD:510,377-UNIMOD:510,391-UNIMOD:510,622-UNIMOD:510,169-UNIMOD:510,174-UNIMOD:21,180-UNIMOD:510	0.05	26.0	4	3	2
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	129-UNIMOD:510,139-UNIMOD:21,126-UNIMOD:510	0.12	26.0	3	3	3
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	14-UNIMOD:510	0.06	26.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	70-UNIMOD:510,78-UNIMOD:21,80-UNIMOD:21	0.04	26.0	3	1	0
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	172-UNIMOD:510,180-UNIMOD:21,161-UNIMOD:510,163-UNIMOD:21,171-UNIMOD:510	0.12	26.0	3	2	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	37-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	26.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	151-UNIMOD:510,170-UNIMOD:21	0.07	26.0	1	1	0
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	100-UNIMOD:510,105-UNIMOD:4,109-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	128-UNIMOD:510,138-UNIMOD:510,139-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	47-UNIMOD:510,53-UNIMOD:21,58-UNIMOD:510	0.02	25.0	1	1	0
PRT	sp|Q9H3K6-2|BOLA2_HUMAN	Isoform 2 of BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	15-UNIMOD:510	0.29	24.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	483-UNIMOD:510,485-UNIMOD:21,494-UNIMOD:510,496-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P62979|RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	120-UNIMOD:510,121-UNIMOD:4,126-UNIMOD:4,134-UNIMOD:21	0.13	24.0	1	1	1
PRT	sp|P56270-3|MAZ_HUMAN	Isoform 3 of Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	276-UNIMOD:510,279-UNIMOD:21,282-UNIMOD:510,286-UNIMOD:4,289-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q92576-2|PHF3_HUMAN	Isoform 2 of PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	1507-UNIMOD:510,1528-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	42-UNIMOD:510,49-UNIMOD:21,53-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	235-UNIMOD:510,241-UNIMOD:21,246-UNIMOD:21,247-UNIMOD:4	0.04	24.0	2	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	25-UNIMOD:510,34-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	244-UNIMOD:510,249-UNIMOD:21,255-UNIMOD:4,256-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	40-UNIMOD:510,53-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	44-UNIMOD:510,49-UNIMOD:4,50-UNIMOD:21,295-UNIMOD:510,305-UNIMOD:510	0.05	23.0	2	2	2
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	131-UNIMOD:510,135-UNIMOD:21,131-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	494-UNIMOD:510,495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21,521-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	241-UNIMOD:510,243-UNIMOD:21,273-UNIMOD:510	0.08	23.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	81-UNIMOD:510,83-UNIMOD:21,86-UNIMOD:21,91-UNIMOD:35,93-UNIMOD:510	0.09	22.0	2	1	0
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	726-UNIMOD:510,726-UNIMOD:4,727-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	263-UNIMOD:510,270-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	469-UNIMOD:510,502-UNIMOD:510	0.07	22.0	1	1	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	3-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:21,13-UNIMOD:510	0.08	22.0	1	1	1
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	104-UNIMOD:510,105-UNIMOD:4,107-UNIMOD:21,111-UNIMOD:21,115-UNIMOD:510	0.08	22.0	2	2	2
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	578-UNIMOD:510,589-UNIMOD:510,334-UNIMOD:510	0.03	22.0	2	2	2
PRT	sp|P62312|LSM6_HUMAN	U6 snRNA-associated Sm-like protein LSm6 OS=Homo sapiens OX=9606 GN=LSM6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	67-UNIMOD:510,74-UNIMOD:21,77-UNIMOD:510	0.15	22.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|Q16513-5|PKN2_HUMAN	Isoform 5 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	613-UNIMOD:510,632-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P06753-3|TPM3_HUMAN	Isoform 3 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	56-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|Q8IXH6|T53I2_HUMAN	Tumor protein p53-inducible nuclear protein 2 OS=Homo sapiens OX=9606 GN=TP53INP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	205-UNIMOD:510,208-UNIMOD:21,214-UNIMOD:4	0.06	22.0	1	1	1
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	97-UNIMOD:510,100-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.18	22.0	1	1	1
PRT	sp|P55196-2|AFAD_HUMAN	Isoform 1 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	213-UNIMOD:510,215-UNIMOD:21,221-UNIMOD:35,222-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	9-UNIMOD:510	0.10	22.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	98-UNIMOD:510,107-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	92-UNIMOD:510,97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,112-UNIMOD:4,116-UNIMOD:4,117-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P18621-3|RL17_HUMAN	Isoform 3 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	428-UNIMOD:510,432-UNIMOD:21,439-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	396-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q92890|UFD1_HUMAN	Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	290-UNIMOD:510,299-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q8NBJ7-2|SUMF2_HUMAN	Isoform 2 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	166-UNIMOD:510,168-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|Q969Q0|RL36L_HUMAN	60S ribosomal protein L36a-like OS=Homo sapiens OX=9606 GN=RPL36AL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	70-UNIMOD:510,72-UNIMOD:4,77-UNIMOD:4,79-UNIMOD:21,80-UNIMOD:510	0.11	21.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	544-UNIMOD:510,548-UNIMOD:21,552-UNIMOD:21,553-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	301-UNIMOD:510,312-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	87-UNIMOD:510,154-UNIMOD:510	0.06	21.0	2	2	2
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q9UKV8-2|AGO2_HUMAN	Isoform 2 of Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	385-UNIMOD:510,387-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	240-UNIMOD:510,250-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	40-UNIMOD:510,50-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	16-UNIMOD:510,24-UNIMOD:21,26-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	22-UNIMOD:510,25-UNIMOD:21,29-UNIMOD:21,31-UNIMOD:510	0.08	21.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	47-UNIMOD:510,59-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P60484|PTEN_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	379-UNIMOD:510,380-UNIMOD:21,402-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|Q7LFL8|CXXC5_HUMAN	CXXC-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=CXXC5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	75-UNIMOD:510,80-UNIMOD:21,87-UNIMOD:21,97-UNIMOD:35,101-UNIMOD:21	0.10	21.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	151-UNIMOD:510,160-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	618-UNIMOD:510,628-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	55-UNIMOD:510,57-UNIMOD:21,65-UNIMOD:21,70-UNIMOD:510	0.12	20.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	431-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	36-UNIMOD:510,39-UNIMOD:21,44-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	987-UNIMOD:510,994-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	152-UNIMOD:510,154-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|O75494-5|SRS10_HUMAN	Isoform 5 of Serine/arginine-rich splicing factor 10 OS=Homo sapiens OX=9606 GN=SRSF10	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	103-UNIMOD:510,107-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	236-UNIMOD:510,239-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	569-UNIMOD:510,576-UNIMOD:21,577-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	821-UNIMOD:510,823-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9UQ35-2|SRRM2_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	2272-UNIMOD:510,2274-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	39-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	33-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	264-UNIMOD:510,267-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	225-UNIMOD:510,227-UNIMOD:21,242-UNIMOD:510	0.05	20.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	SSGSPYGGGYGSGGGSGGYGSR	1	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	50.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=1968	25.991	2	2023.8121	2023.8121	R	R	333	355
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=4801	49.122	2	2226.9361	2226.9361	R	-	228	248
PSM	DSSTSPGDYVLSVSENSR	3	sp|P46108-2|CRK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4522	46.421	2	2012.8788	2012.8788	R	V	39	57
PSM	INSSGESGDESDEFLQSR	4	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3291	35.831	2	2069.8639	2069.8639	R	K	180	198
PSM	INSSGESGDESDEFLQSR	5	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=3046	33.898	2	2069.8639	2069.8639	R	K	180	198
PSM	GAEAANVTGPGGVPVQGSK	6	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,18-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2206	27.708	2	1842.9513	1842.9513	K	Y	119	138
PSM	DWEDDSDEDMSNFDR	7	sp|Q15185-4|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=3155	34.718	2	1924.7117	1924.7117	K	F	108	123
PSM	INSSGESGDESDEFLQSR	8	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=3291	35.83112666666667	2	2069.862309	2069.863906	R	K	180	198
PSM	NEDADLPSEETDGIAYISSSR	9	sp|Q05513|KPCZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,19-UNIMOD:21	ms_run[2]:scan=4293	44.29	2	2382.0324	2382.0324	K	K	199	220
PSM	NEDADLPSEETDGIAYISSSR	10	sp|Q05513|KPCZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=4127	42.764	2	2382.0324	2382.0324	K	K	199	220
PSM	DNLTLWTSDMQGDGEEQNK	11	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3936	41.19	2	2264.0539	2264.0539	R	E	204	223
PSM	NEDADLPSEETDGIAYISSSR	12	sp|Q05513|KPCZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=4293	44.29002666666667	2	2382.0274	2382.0319	K	K	199	220
PSM	AGEEDEGEEDSDSDYEISAK	13	sp|A2RRP1-2|NBAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2465	29.597	2	2321.9221	2321.9221	R	A	463	483
PSM	DNLTLWTSDQQDDDGGEGNN	14	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=5449	56.702	2	2226.9361	2226.9361	R	-	228	248
PSM	NPDDITQEEYGEFYK	15	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3964	41.423	2	1914.916	1914.9160	R	S	292	307
PSM	DNLTLWTSDQQDEEAGEGN	16	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4758	48.698	2	2154.9402	2154.9402	R	-	228	247
PSM	GILAADESTGSIAK	17	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2866	32.539	2	1479.7858	1479.7858	K	R	29	43
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	18	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2698	31.301	3	2810.1902	2810.1902	R	E	418	442
PSM	RVSVCAETYNPDEEEEDTDPR	19	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2724	31.492	3	2624.0798	2624.0798	R	V	97	118
PSM	SYELPDGQVITIGNER	20	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4794	49.068	2	1823.9478	1823.9478	K	F	239	255
PSM	DNLTLWTSDQQDDDGGEGNN	21	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4800	49.114	3	2226.9361	2226.9361	R	-	228	248
PSM	ETVSEESNVLCLSK	22	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3401	36.642	2	1661.8818	1661.8818	R	S	581	595
PSM	TDYNASVSVPDSSGPER	23	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2693	31.263	2	1893.8206	1893.8206	R	I	70	87
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	24	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=3347	36.244	3	3112.2782	3112.2782	K	L	595	622
PSM	SDIDEIVLVGGSTR	25	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4637	47.504	2	1573.7813	1573.7813	K	I	354	368
PSM	SSGSPYGGGYGSGGGSGGYGSR	26	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[1]:scan=1968	25.990861666666667	2	2023.808696	2023.812145	R	R	355	377
PSM	DWEDDSDEDMSNFDR	27	sp|Q15185-4|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=4106	42.605	2	1908.7168	1908.7168	K	F	108	123
PSM	TDDEVVQREEEAIQLDGLNASQIR	28	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=4928	50.361	3	2841.3606	2841.3606	R	E	44	68
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	29	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,15-UNIMOD:21,29-UNIMOD:510	ms_run[1]:scan=4405	45.230154999999996	3	3082.3115	3082.3142	K	-	661	690
PSM	AGEEDEGEEDSDSDYEISAK	30	sp|A2RRP1|NBAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=2465	29.5966	2	2321.915790	2321.922057	R	A	463	483
PSM	EEASDYLELDTIK	31	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4346	44.714	2	1592.8458	1592.8458	K	N	253	266
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	32	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,26-UNIMOD:510	ms_run[2]:scan=3831	40.072	3	3010.3787	3010.3787	K	E	144	170
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	33	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2887	32.691	3	2685.0632	2685.0632	K	M	446	470
PSM	HMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSR	34	sp|Q05513|KPCZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,2-UNIMOD:35,4-UNIMOD:21,6-UNIMOD:35,16-UNIMOD:510,35-UNIMOD:21	ms_run[1]:scan=4194	43.396435	4	4320.8194	4320.8272	K	K	183	220
PSM	DNNQFASASLDR	35	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=2406	29.171	2	1370.6639	1370.6639	K	T	125	137
PSM	ELSLAGNELGDEGAR	36	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=3426	36.841	2	1563.7953	1563.7953	K	L	288	303
PSM	EMQNLSFQDCYSSK	37	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:35,10-UNIMOD:4,13-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3126	34.504	2	1899.8056	1899.8057	K	F	102	116
PSM	ESLKEEDESDDDNM	38	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=1037	19.15	2	1738.7364	1738.7364	K	-	235	249
PSM	GNPTVEVDLFTSK	39	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4537	46.547	2	1553.8015	1553.8015	R	G	16	29
PSM	NYILDQTNVYGSAQR	40	sp|Q9BUJ2-3|HNRL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3959	41.372	2	1854.8726	1854.8726	R	R	387	402
PSM	QAVTNPNNTFYATK	41	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2442	29.433	2	1715.8556	1715.8556	R	R	108	122
PSM	TAFQEALDAAGDK	42	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3357	36.318	2	1403.7569	1403.7569	K	L	9	22
PSM	ASGNYATVISHNPETK	43	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2355	28.795	2	1835.9091	1835.9091	R	K	129	145
PSM	ELAPYDENWFYTR	44	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=5284	54.388	2	1816.7922	1816.7922	K	A	44	57
PSM	GAEAANVTGPDGVPVEGSRYAADR	45	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=2786	31.942	3	2472.1495	2472.1495	K	R	151	175
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	46	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4969	50.75	3	2995.386	2995.3860	R	G	2913	2938
PSM	NNSGEEFDCAFR	47	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2908	32.844	2	1478.6309	1478.6309	R	L	355	367
PSM	SSGPYGGGGQYFAK	48	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2947	33.133	2	1522.713	1522.7130	R	P	232	246
PSM	DNLTLWTSDQQDDDGGEGNN	49	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=5116	52.281	2	2226.9361	2226.9361	R	-	228	248
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	50	sp|Q96EY7-2|PTCD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21,29-UNIMOD:510	ms_run[2]:scan=4405	45.23	3	3082.3147	3082.3147	K	-	252	281
PSM	EGMNIVEAMER	51	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:35	ms_run[2]:scan=3049	33.919	2	1327.6324	1327.6324	K	F	74	85
PSM	EVDEQMLNVQNK	52	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1765	24.522	2	1529.8032	1529.8032	K	N	325	337
PSM	GGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGR	53	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3788	39.754	3	3501.4245	3501.4245	R	G	217	255
PSM	KEESEESDDDMGFGLFD	54	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4464	45.785	2	2032.8732	2032.8732	K	-	73	90
PSM	RNQSFCPTVNLDK	55	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2699	31.308	2	1725.8546	1725.8546	K	L	65	78
PSM	ALAAAGYDVEK	56	sp|P22492|H1T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2131	27.172	2	1174.687	1174.6870	K	N	69	80
PSM	DNLTLWTSDQQDDDGGEGNN	57	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4701	48.102	2	2226.9361	2226.9361	R	-	228	248
PSM	DQGTYEDYVEGLR	58	sp|P60660-2|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4278	44.152	2	1577.7422	1577.7422	K	V	82	95
PSM	EGMNIVEAMER	59	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4088	42.459	2	1311.6375	1311.6375	K	F	74	85
PSM	EQVANSAFVER	60	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1852	25.155	2	1282.673	1282.6730	K	V	492	503
PSM	ESEDKPEIEDVGSDEEEEK	61	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=2107	26.997	3	2294.1022	2294.1022	K	K	373	392
PSM	IEDVTPIPSDSTR	62	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2957	33.208	2	1542.7391	1542.7391	R	R	129	142
PSM	IQALQQQADEAEDR	63	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=2017	26.343	2	1647.8276	1647.8276	K	A	14	28
PSM	NVDGVNYASITR	64	sp|Q9UBR2|CATZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3158	34.74	2	1421.6764	1421.6764	R	N	70	82
PSM	NVIGLQMGTNR	65	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3532	37.657	2	1315.6532	1315.6532	K	G	172	183
PSM	RQAVTNPNNTFYATK	66	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1809	24.845	2	1871.9567	1871.9567	K	R	107	122
PSM	TTPSYVAFTDTER	67	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=3340	36.192	2	1520.7571	1520.7571	R	L	37	50
PSM	YHTSQSGDEMTSLSEYVSR	68	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4033	42.018	3	2289.9673	2289.9673	R	M	457	476
PSM	YHTSQSGDEMTSLSEYVSR	69	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=4033	42.01797166666667	3	2289.9657	2289.9668	R	M	457	476
PSM	ELAPYDENWFYTR	70	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=5284	54.387728333333335	2	1816.7917	1816.7917	K	A	44	57
PSM	FASENDLPEWK	71	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=4391	45.09516	2	1482.7062	1482.7063	R	E	58	69
PSM	GAEAANVTGPDGVPVEGSRYAADR	72	sp|P16989|YBOX3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[1]:scan=2786	31.942204999999998	3	2472.1452	2472.1489	K	R	151	175
PSM	ASGNYATVISHNPETK	73	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,10-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2950	33.156	2	1915.8755	1915.8755	R	K	129	145
PSM	ELISNASDALDK	74	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2849	32.416	2	1342.7616	1342.7616	R	I	42	54
PSM	KEESEESDDDMGFGLFD	75	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=5020	51.315	2	2112.8395	2112.8395	K	-	73	90
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	76	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,19-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4082	42.415	3	3090.3451	3090.3451	K	E	144	170
PSM	VIGSGCNLDSAR	77	sp|P00338-4|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=1829	24.99	2	1361.6223	1361.6223	R	F	100	112
PSM	YLAEVAAGDDKK	78	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1324	21.317	3	1380.8349	1380.8349	R	G	128	140
PSM	ELISNSSDALDK	79	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2768	31.813654999999997	2	1438.7218	1438.7224	R	I	47	59
PSM	DLEAEHVEVEDTTLNR	80	sp|Q9H3K6-2|BOLA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=3211	35.142	3	1902.9383	1902.9383	R	C	15	31
PSM	DQVANSAFVER	81	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2147	27.289	2	1268.6573	1268.6573	K	L	622	633
PSM	DVIELTDDSFDK	82	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=4511	46.341	2	1463.7668	1463.7668	K	N	158	170
PSM	EATNPPVIQEEKPK	83	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=1578	23.173	3	1760.981	1760.9810	R	K	483	497
PSM	ECPSDECGAGVFMASHFDR	84	sp|P62979|RS27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:4,7-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=4065	42.259	3	2284.8801	2284.8801	R	H	120	139
PSM	EGLELPEDEEEK	85	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2951	33.164	2	1483.7566	1483.7566	K	K	539	551
PSM	IGRIEDVTPIPSDSTR	86	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=3384	36.517	2	1868.9457	1868.9457	K	R	126	142
PSM	LARASGNYATVISHNPETK	87	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2316	28.519	3	2176.1314	2176.1314	K	K	126	145
PSM	LSHSDEKPYQCPVCQQR	88	sp|P56270-3|MAZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=1449	22.238	3	2279.0501	2279.0501	K	F	276	293
PSM	RIDQSEFEGFEYINPLLLSTEESV	89	sp|Q05513|KPCZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=6776	77.761	3	3008.3557	3008.3557	K	-	569	593
PSM	RQLQEDQENNLQDNQTSNSSPCR	90	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,22-UNIMOD:4	ms_run[2]:scan=1289	21.056	3	2794.2749	2794.2749	K	S	1507	1530
PSM	SIYYITGESK	91	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2862	32.51	2	1227.7023	1227.7023	K	E	482	492
PSM	VADWTGATYQDK	92	sp|O15371-2|EIF3D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2832	32.294	2	1501.7127	1501.7127	K	R	42	54
PSM	VPTANVSVVDLTCR	93	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4089	42.466	2	1723.783	1723.7830	R	L	235	249
PSM	DNLTLWTSDQQDDDGGEGNN	94	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510	ms_run[1]:scan=5878	62.372975	2	2226.9232	2226.9352	R	-	228	248
PSM	AGFAGDDAPR	95	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1241	20.701	2	1009.5041	1009.5041	K	A	19	29
PSM	ASGNYATVISHNPETK	96	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2932	33.023	3	1915.8755	1915.8755	R	K	129	145
PSM	EQFLDGDGWTSR	97	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=4195	43.404	2	1523.6506	1523.6506	K	W	25	37
PSM	GGNFGFGDSR	98	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2879	32.632	2	1126.4657	1126.4657	R	G	192	202
PSM	GILAADESTGSIAK	99	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3051	33.934	2	1479.7858	1479.7858	K	R	29	43
PSM	IIYGGSVTGATCK	100	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2550	30.227	2	1473.7575	1473.7575	R	E	244	257
PSM	ISVYYNEATGGK	101	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2512	29.953	2	1368.7562	1368.7562	R	Y	47	59
PSM	LAVDEEENADNNTK	102	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=1451	22.254	2	1628.8166	1628.8166	K	A	40	54
PSM	NPDDITQEEYGEFYK	103	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3970	41.468	3	1914.916	1914.9160	R	S	292	307
PSM	NTGIICTIGPASR	104	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=3168	34.813	2	1472.7271	1472.7271	R	S	44	57
PSM	SLYESFVSSSDR	105	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3967	41.445	2	1489.655	1489.6550	K	L	131	143
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	106	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510	ms_run[2]:scan=1206	20.441	3	3246.2875	3246.2875	R	K	494	522
PSM	TPEELDDSDFETEDFDVR	107	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4959	50.66	2	2271.9157	2271.9157	R	S	264	282
PSM	VPTANVSVVDLTCR	108	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3920	41.068	2	1643.8166	1643.8166	R	L	235	249
PSM	NVDGVNYASITR	109	sp|Q9UBR2|CATZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=3187	34.951676666666664	2	1421.6743	1421.6759	R	N	70	82
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	110	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,33-UNIMOD:510	ms_run[1]:scan=3604	38.25207	4	3922.7270	3922.7326	K	E	241	274
PSM	AITGASLADIMAK	111	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,11-UNIMOD:35,13-UNIMOD:510	ms_run[2]:scan=4076	42.37	2	1504.7286	1504.7286	R	R	81	94
PSM	AITGASLADIMAK	112	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5265	54.136	2	1488.7337	1488.7337	R	R	81	94
PSM	CSVSLSNVEAR	113	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21	ms_run[2]:scan=2876	32.61	2	1334.6114	1334.6114	R	R	726	737
PSM	DNLTLWTSDMQGDGEEQNK	114	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3928	41.129	3	2264.0539	2264.0539	R	E	204	223
PSM	DNLTLWTSDMQGDGEEQNK	115	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4610	47.255	3	2248.059	2248.0590	R	E	204	223
PSM	DVNQQEFVR	116	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2128	27.151	2	1167.6097	1167.6097	K	A	8	17
PSM	EGLELPEDEEEKK	117	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2407	29.177	3	1645.9147	1645.9147	K	K	539	552
PSM	EQFLDGDGWTSR	118	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3864	40.413	2	1443.6843	1443.6843	K	W	25	37
PSM	ESYDDVSSFR	119	sp|Q99848|EBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2886	32.684	2	1317.5338	1317.5338	R	A	263	273
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	120	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,34-UNIMOD:510	ms_run[2]:scan=4984	50.917	4	3824.5651	3824.5651	K	A	469	503
PSM	FNPFVTSDRSK	121	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3884	40.643	2	1524.7051	1524.7051	K	N	3	14
PSM	GCGTVLLSGPR	122	sp|Q07020-2|RL18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:4,4-UNIMOD:21	ms_run[2]:scan=3052	33.941	2	1229.6052	1229.6052	K	K	104	115
PSM	GCGTVLLSGPRK	123	sp|Q07020-2|RL18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2300	28.405	2	1471.7296	1471.7296	K	G	104	116
PSM	GDLGIEIPAEK	124	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3632	38.456	2	1208.7289	1208.7289	R	V	295	306
PSM	GLSEDTTEETLK	125	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2019	26.358	2	1389.7511	1389.7511	K	E	578	590
PSM	GNNVLYISTQK	126	sp|P62312|LSM6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2885	32.677	2	1383.7436	1383.7436	R	R	67	78
PSM	GPLQSVQVFGR	127	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4009	41.757	2	1300.6753	1300.6753	K	K	5	16
PSM	GREDVSNFDDEFTSEAPILTPPREPR	128	sp|Q16513-5|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=4577	46.915	4	3087.4399	3087.4399	R	I	613	639
PSM	IQLVEEELDR	129	sp|P06753-3|TPM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3565	37.924	2	1276.7087	1276.7087	R	A	56	66
PSM	LMIEMDGTENK	130	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3183	34.922	2	1347.7051	1347.7051	K	S	93	104
PSM	NFSDNQLQEGK	131	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2336	28.662	2	1426.6766	1426.6766	R	N	161	172
PSM	NQSSFIYQPCQR	132	sp|Q8IXH6|T53I2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=3000	33.548	2	1640.7231	1640.7231	K	Q	205	217
PSM	QEYDESGPSIVHR	133	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1703	24.071	3	1549.7585	1549.7585	K	K	360	373
PSM	RQAVTNPNNTFYATK	134	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1895	25.466	3	1951.9231	1951.9231	K	R	107	122
PSM	RQAVTNPNNTFYATK	135	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1898	25.487	2	1951.9231	1951.9231	K	R	107	122
PSM	SLQSVAEER	136	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2457	29.54	2	1131.5385	1131.5385	R	A	97	106
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	137	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3220	35.207	3	3223.2305	3223.2305	K	-	122	148
PSM	TISNPEVVMK	138	sp|P55196-2|AFAD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:35,10-UNIMOD:510	ms_run[2]:scan=1883	25.38	2	1280.6724	1280.6724	R	R	213	223
PSM	TPVEPEVAIHR	139	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1857	25.192	3	1280.7301	1280.7301	K	I	9	20
PSM	VEVTEFEDIK	140	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3798	39.829	2	1275.7235	1275.7235	R	S	98	108
PSM	VNDGVCDCCDGTDEYNSGVICENTCK	141	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4,21-UNIMOD:4,25-UNIMOD:4,26-UNIMOD:510	ms_run[2]:scan=3018	33.679	3	3108.2512	3108.2512	R	E	92	118
PSM	VRYSLDPENPTK	142	sp|P18621-3|RL17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2590	30.52	2	1565.8127	1565.8127	M	S	2	14
PSM	QAVTNPNNTFYATK	143	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2442	29.432965000000003	2	1715.8512	1715.8551	R	R	108	122
PSM	NVDGVNYASITR	144	sp|Q9UBR2|CATZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=3158	34.740255	2	1421.674839	1421.676427	R	N	70	82
PSM	DMRQTVAVGVIK	145	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2967	33.294	3	1463.8208	1463.8208	R	A	428	440
PSM	DNSTMGYMMAK	146	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=868	17.569	2	1363.6094	1363.6094	R	K	613	624
PSM	DYEEVGVDSVEGEGEEEGEEY	147	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=4556	46.702	3	2381.9607	2381.9607	K	-	396	417
PSM	EALQDVEDENQ	148	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2271	28.192	2	1322.605	1322.6050	K	-	223	234
PSM	EDQTEYLEER	149	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2012	26.306	2	1344.6258	1344.6258	K	R	187	197
PSM	ELISNSSDALDK	150	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2768	31.814	2	1438.7229	1438.7229	R	I	169	181
PSM	FVAFSGEGQSLR	151	sp|Q92890|UFD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3644	38.545	2	1410.6757	1410.6757	R	K	290	302
PSM	GASWIDTADGSANHR	152	sp|Q8NBJ7-2|SUMF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2955	33.193	3	1670.7262	1670.7262	R	A	166	181
PSM	LECVEPNCRSK	153	sp|Q969Q0|RL36L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:4,8-UNIMOD:4,10-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1201	20.406	2	1538.7259	1538.7259	R	R	70	81
PSM	LILDSARATK	154	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2247	28.019	2	1314.6986	1314.6986	K	G	544	554
PSM	NDLAVVDVR	155	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2734	31.565	2	1033.598	1033.5980	K	I	334	343
PSM	NFSDNQLQEGK	156	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1833	25.019	2	1346.7103	1346.7103	R	N	161	172
PSM	NNASTDYDLSDK	157	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1573	23.135	2	1409.6947	1409.6947	K	S	301	313
PSM	QDIAFAYQR	158	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2858	32.481	2	1144.6089	1144.6089	R	R	87	96
PSM	QLLLTADDR	159	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2674	31.125	2	1077.6242	1077.6242	R	V	61	70
PSM	RLSQSDEDVIR	160	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1864	25.242	2	1430.6979	1430.6979	K	L	119	130
PSM	SASFNTDPYVR	161	sp|Q9UKV8-2|AGO2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3045	33.891	2	1369.6128	1369.6128	R	E	385	396
PSM	TGLYNYYDDEK	162	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3048	33.912	2	1447.7144	1447.7144	R	E	240	251
PSM	TLEEDEEELFK	163	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3858	40.368	2	1448.7559	1448.7559	K	M	40	51
PSM	TNQELQEINR	164	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1536	22.872	2	1277.6788	1277.6788	R	V	154	164
PSM	TQVAGGQLSFK	165	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3056	33.971	2	1282.6959	1282.6959	K	G	16	27
PSM	TSGSVYITLK	166	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3881	40.622	2	1295.6452	1295.6452	R	K	22	32
PSM	VAEDEAEAAAAAK	167	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=1414	21.983	2	1312.7147	1312.7147	K	F	47	60
PSM	VIGSGCNLDSAR	168	sp|P00338-4|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1492	22.554	2	1281.656	1281.6560	R	F	100	112
PSM	YSDTTDSDPENEPFDEDQHTQITKV	169	sp|P60484|PTEN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=3640	38.514	3	3058.3241	3058.3241	R	-	379	404
PSM	HMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSR	170	sp|Q05513|KPCZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,2-UNIMOD:35,4-UNIMOD:21,6-UNIMOD:35,16-UNIMOD:510,34-UNIMOD:21	ms_run[1]:scan=3979	41.53557	4	4320.8198	4320.8272	K	K	183	220
PSM	RSRPLSHYSSFGSSGGSGGGSMMGGESADK	171	sp|Q7LFL8|CXXC5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,13-UNIMOD:21,23-UNIMOD:35,27-UNIMOD:21	ms_run[1]:scan=3220	35.207295	3	3223.226196	3222.239842	R	A	75	105
PSM	AGDLLEDSPK	172	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2055	26.619	2	1111.6397	1111.6397	R	R	151	161
PSM	DAHNALLDIQSSGR	173	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3335	36.155	2	1609.7674	1609.7674	K	A	618	632
PSM	DNLTLWTSDQQDDDGGEGNN	174	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=5368	55.677	2	2226.9361	2226.9361	R	-	228	248
PSM	DRSSFYVNGLTLGGQK	175	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4560	46.733	3	1968.9384	1968.9384	K	C	55	71
PSM	DYEEVGADSADGEDEGEEY	176	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3635	38.477	2	2111.8027	2111.8027	K	-	431	450
PSM	ELISNSSDALDK	177	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2302	28.419	2	1358.7566	1358.7566	R	I	169	181
PSM	ESYSVYVYK	178	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3444	36.974	2	1284.6316	1284.6316	K	V	36	45
PSM	GAEAANVTGPGGVPVQGSK	179	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,18-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2187	27.571	3	1842.9513	1842.9513	K	Y	119	138
PSM	GLDEDRGSWR	180	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=1863	25.235	2	1303.577	1303.5770	R	T	987	997
PSM	HRTLTAEEAEEEWER	181	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2840	32.351	3	1998.8897	1998.8897	R	R	152	167
PSM	IEDVTPIPSDSTRR	182	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2410	29.2	3	1698.8402	1698.8402	R	K	129	143
PSM	NVYSSSRYDDYDR	183	sp|O75494-5|SRS10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2013	26.313	2	1752.7205	1752.7205	R	Y	103	116
PSM	QQLSAEELDAQLDAYNAR	184	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4645	47.617	3	2147.9949	2147.9949	K	M	236	254
PSM	QRIDEFESM	185	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=2458	29.547	2	1283.5317	1283.5317	K	-	569	578
PSM	SGSYSYLEER	186	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2783	31.92	2	1303.5546	1303.5546	R	K	821	831
PSM	SLSYSPVER	187	sp|Q9UQ35-2|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2547	30.206	2	1150.5484	1150.5484	R	R	2272	2281
PSM	SLYESFVSSSDR	188	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=4453	45.702	2	1569.6214	1569.6214	K	L	131	143
PSM	TESPATAAETASEELDNR	189	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3686	38.92	3	1924.9074	1924.9074	R	S	39	57
PSM	VDNDENEHQLSLR	190	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1579	23.18	3	1601.7858	1601.7858	K	T	33	46
PSM	VTDSSVSVQLRE	191	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3053	33.949	2	1432.7023	1432.7023	R	-	264	276
PSM	STTPPPAEPVSLPQEPPKPR	192	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2933	33.03104666666667	3	2272.2115	2272.2136	K	V	225	245