MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100519_012CaMK1d_CAMK1D.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100519_012CaMK1d_CAMK1D.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	46.0	null	228-UNIMOD:510,29-UNIMOD:510	0.15	46.0	7	2	1
PRT	sp|P63104-2|1433Z_HUMAN	Isoform 2 of 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	148-UNIMOD:510	0.14	40.0	2	1	0
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	321-UNIMOD:510,323-UNIMOD:21,328-UNIMOD:21	0.03	40.0	2	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	204-UNIMOD:510,222-UNIMOD:510,213-UNIMOD:35,121-UNIMOD:510,131-UNIMOD:510	0.14	39.0	4	2	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	239-UNIMOD:510,19-UNIMOD:510,197-UNIMOD:510	0.10	38.0	3	3	3
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	207-UNIMOD:510	0.14	38.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	223-UNIMOD:510	0.09	36.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	300-UNIMOD:510,314-UNIMOD:510,500-UNIMOD:510,251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510	0.08	35.0	4	4	4
PRT	sp|Q8N8S7-3|ENAH_HUMAN	Isoform 3 of Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	123-UNIMOD:510,125-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	392-UNIMOD:510,394-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	476-UNIMOD:510,368-UNIMOD:510,295-UNIMOD:510,305-UNIMOD:510	0.07	33.0	3	3	3
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	379-UNIMOD:510,292-UNIMOD:510,306-UNIMOD:510,492-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510	0.09	32.0	5	5	5
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	228-UNIMOD:510	0.08	31.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	253-UNIMOD:510,265-UNIMOD:510,103-UNIMOD:510,114-UNIMOD:510,435-UNIMOD:510	0.05	31.0	3	3	3
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	193-UNIMOD:510	0.12	30.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510	0.06	30.0	2	2	2
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	29-UNIMOD:510,42-UNIMOD:510	0.04	30.0	1	1	1
PRT	sp|Q99618|CDCA3_HUMAN	Cell division cycle-associated protein 3 OS=Homo sapiens OX=9606 GN=CDCA3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	92-UNIMOD:510,94-UNIMOD:21,103-UNIMOD:510	0.05	30.0	1	1	1
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	79-UNIMOD:510	0.07	30.0	1	1	1
PRT	sp|P17544-5|ATF7_HUMAN	Isoform 5 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	42-UNIMOD:510,44-UNIMOD:21	0.14	30.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	29.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	28-UNIMOD:510	0.06	29.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510	0.02	29.0	1	1	1
PRT	sp|Q8IU85-2|KCC1D_HUMAN	Isoform 2 of Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens OX=9606 GN=CAMK1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	61-UNIMOD:510,62-UNIMOD:510,64-UNIMOD:21,346-UNIMOD:510,347-UNIMOD:4,352-UNIMOD:510,355-UNIMOD:21,357-UNIMOD:21	0.08	29.0	3	2	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	221-UNIMOD:510,37-UNIMOD:510	0.05	29.0	2	2	2
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	241-UNIMOD:510,244-UNIMOD:21,246-UNIMOD:4,253-UNIMOD:510,243-UNIMOD:21	0.02	29.0	2	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	25-UNIMOD:510,34-UNIMOD:21,35-UNIMOD:21,99-UNIMOD:510,105-UNIMOD:4,111-UNIMOD:510	0.06	29.0	3	2	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	null	158-UNIMOD:510,189-UNIMOD:510	0.11	29.0	1	1	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	223-UNIMOD:510,237-UNIMOD:4,104-UNIMOD:510,115-UNIMOD:510	0.15	28.0	3	2	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	2207-UNIMOD:510,2215-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	28.0	1	1	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	1369-UNIMOD:510,1375-UNIMOD:21,1376-UNIMOD:4,1381-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	97-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	115-UNIMOD:510,118-UNIMOD:21	0.09	27.0	2	1	0
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	27.0	1	1	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	82-UNIMOD:510,96-UNIMOD:510,50-UNIMOD:510,102-UNIMOD:510,113-UNIMOD:510	0.06	27.0	3	3	3
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	100-UNIMOD:510,105-UNIMOD:4,175-UNIMOD:510,185-UNIMOD:510	0.09	27.0	2	2	2
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	114-UNIMOD:510	0.13	27.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	98-UNIMOD:510,108-UNIMOD:35	0.16	27.0	1	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	167-UNIMOD:510,186-UNIMOD:510	0.09	26.0	2	2	2
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	82-UNIMOD:510	0.09	26.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	39-UNIMOD:510,43-UNIMOD:21	0.09	26.0	1	1	0
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	74-UNIMOD:510,76-UNIMOD:35,82-UNIMOD:35	0.11	26.0	3	1	0
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	241-UNIMOD:510,243-UNIMOD:21,273-UNIMOD:510	0.08	26.0	1	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	39-UNIMOD:510,41-UNIMOD:21	0.06	26.0	1	1	0
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	96-UNIMOD:510	0.09	25.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	7-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	110-UNIMOD:510,113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4,128-UNIMOD:510	0.07	25.0	1	1	1
PRT	sp|Q8WVC0-2|LEO1_HUMAN	Isoform 2 of RNA polymerase-associated protein LEO1 OS=Homo sapiens OX=9606 GN=LEO1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	415-UNIMOD:510,417-UNIMOD:21,426-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	25.0	1	1	1
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	715-UNIMOD:510,719-UNIMOD:21,731-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.04	25.0	1	1	0
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	44-UNIMOD:510,52-UNIMOD:510	0.07	24.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	237-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	482-UNIMOD:510,493-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|Q15172-2|2A5A_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	413-UNIMOD:510,415-UNIMOD:21,419-UNIMOD:35	0.04	24.0	1	1	1
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	232-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	273-UNIMOD:510,279-UNIMOD:21,281-UNIMOD:4	0.02	24.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	395-UNIMOD:510,398-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	125-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	8-UNIMOD:510	0.07	23.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	411-UNIMOD:510,334-UNIMOD:510	0.03	23.0	3	2	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	132-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	11-UNIMOD:510,14-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	158-UNIMOD:510,189-UNIMOD:510	0.13	23.0	1	1	0
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	161-UNIMOD:510,171-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	108-UNIMOD:510,110-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	494-UNIMOD:510,495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21,521-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	40-UNIMOD:510,50-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	109-UNIMOD:510,111-UNIMOD:21,121-UNIMOD:510	0.04	23.0	1	1	0
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	null	486-UNIMOD:510,490-UNIMOD:35,493-UNIMOD:35,494-UNIMOD:35,496-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	105-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P28072|PSB6_HUMAN	Proteasome subunit beta type-6 OS=Homo sapiens OX=9606 GN=PSMB6 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	210-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	257-UNIMOD:510,260-UNIMOD:4,272-UNIMOD:21	0.05	22.0	1	1	0
PRT	sp|Q8NC51-2|PAIRB_HUMAN	Isoform 2 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	235-UNIMOD:510,241-UNIMOD:21,267-UNIMOD:510	0.08	22.0	1	1	0
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	91-UNIMOD:510,93-UNIMOD:21,100-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|Q9UQ35-2|SRRM2_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	846-UNIMOD:510,848-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	240-UNIMOD:510,250-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	154-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	908-UNIMOD:510,910-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	87-UNIMOD:510,95-UNIMOD:35,96-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	413-UNIMOD:510,426-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	78-UNIMOD:510,88-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|P22492|H1T_HUMAN	Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	69-UNIMOD:510,79-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	175-UNIMOD:510,177-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P31327-3|CPSM_HUMAN	Isoform 3 of Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	926-UNIMOD:510,926-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	126-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	20-UNIMOD:510,30-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	143-UNIMOD:510,152-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	61-UNIMOD:510,62-UNIMOD:35,65-UNIMOD:21	0.14	21.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	320-UNIMOD:510,323-UNIMOD:21,329-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	97-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	47-UNIMOD:510,59-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P23526-2|SAHH_HUMAN	Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	187-UNIMOD:510,198-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q9Y281-3|COF2_HUMAN	Isoform 3 of Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	65-UNIMOD:510,75-UNIMOD:510	0.08	21.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	221-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	306-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	158-UNIMOD:510,167-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	61-UNIMOD:510,63-UNIMOD:21,71-UNIMOD:510	0.11	20.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	128-UNIMOD:510,128-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	8-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	434-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	142-UNIMOD:510,149-UNIMOD:21,154-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P28074-3|PSB5_HUMAN	Isoform 3 of Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	63-UNIMOD:510	0.09	20.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	65-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510	0.09	20.0	1	1	1
PRT	sp|P62899-3|RL31_HUMAN	Isoform 3 of 60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	15-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|P62910|RL32_HUMAN	60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	94-UNIMOD:510,96-UNIMOD:4,106-UNIMOD:510	0.10	20.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	98-UNIMOD:510,107-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	235-UNIMOD:510,241-UNIMOD:21,247-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	33-UNIMOD:510,37-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P15056|BRAF_HUMAN	Serine/threonine-protein kinase B-raf OS=Homo sapiens OX=9606 GN=BRAF PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	444-UNIMOD:510,446-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	322-UNIMOD:510,322-UNIMOD:21,334-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|Q8N2K0-3|ABD12_HUMAN	Isoform 3 of Lysophosphatidylserine lipase ABHD12 OS=Homo sapiens OX=9606 GN=ABHD12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	5-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:35,21-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	144-UNIMOD:510,147-UNIMOD:21,156-UNIMOD:510	0.03	20.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:510	ms_run[2]:scan=4077	48.035	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:510	ms_run[1]:scan=3993	47.02741833333334	2	2226.9334	2226.9356	R	-	228	248
PSM	DNLTLWTSDTQGDEAEAGEGGEN	3	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=4121	48.553	2	2442.0519	2442.0519	R	-	148	171
PSM	VDSEGDFSENDDAAGDFR	4	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3116	37.265	2	2058.7904	2058.7904	R	S	321	339
PSM	DNLTLWTSDMQGDGEEQNK	5	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3950	46.479	2	2248.059	2248.0590	R	E	204	223
PSM	DNLTLWTSDQQDDDGGEGNN	6	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=4156	49.053	2	2226.9361	2226.9361	R	-	228	248
PSM	SYELPDGQVITIGNER	7	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=4078	48.043	2	1823.9478	1823.9478	K	F	239	255
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	8	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=4032	47.482	3	3490.5054	3490.5054	R	-	207	238
PSM	TPEELDDSDFETEDFDVR	9	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4173	49.254	2	2271.9157	2271.9157	R	S	264	282
PSM	DNLTLWTSENQGDEGDAGEGEN	10	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=3981	46.914	2	2384.01	2384.0100	R	-	223	245
PSM	NPDDITNEEYGEFYK	11	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3416	40.18	2	1900.9003	1900.9003	R	S	300	315
PSM	QNSQLPAQVQNGPSQEELEIQR	12	sp|Q8N8S7-3|ENAH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3259	38.58	3	2606.255	2606.2550	R	R	123	145
PSM	ALSSDSILSPAPDAR	13	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3308	39.068	2	1612.7922	1612.7922	R	A	392	407
PSM	DNLTLWTSDQQDDDGGEGNN	14	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4080	48.06	3	2226.9361	2226.9361	R	-	228	248
PSM	DPVQEAWAEDVDLR	15	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4151	48.996	2	1675.8266	1675.8266	K	V	476	490
PSM	DNLTLWTSDTQGDEAEAGEGGEN	16	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=4118	48.528	3	2442.0519	2442.0519	R	-	148	171
PSM	GVVDSEDLPLNISR	17	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510	ms_run[1]:scan=3582	41.97159	2	1546.8415	1546.8410	R	E	379	393
PSM	DNLTLWTSDQQDDDGGEGNN	18	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=4258	50.501	3	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDQQDEEAGEGN	19	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=4046	47.654	2	2154.9402	2154.9402	R	-	228	247
PSM	EEASDYLELDTIK	20	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3756	43.902	2	1592.8458	1592.8458	K	N	253	266
PSM	ELISNASDALDK	21	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2493	31.911	2	1342.7616	1342.7616	R	I	103	115
PSM	NPDDITQEEYGEFYK	22	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3473	40.821	2	1914.916	1914.9160	R	S	292	307
PSM	DNLTLWTADNAGEEGGEAPQEPQS	23	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=4133	48.721	3	2562.157	2562.1570	R	-	193	217
PSM	EVDEQMLNVQNK	24	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1498	24.256	2	1529.8032	1529.8032	K	N	325	337
PSM	GILAADESTGSIAK	25	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=2165	29.304	2	1399.8195	1399.8195	K	R	29	43
PSM	QLSEVFETEDSK	26	sp|Q99618|CDCA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3312	39.099	2	1558.744	1558.7440	K	S	92	104
PSM	TAVVVGTITDDVR	27	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=2952	35.854	2	1378.788	1378.7880	K	V	79	92
PSM	TDSVIIADQTPTPTR	28	sp|P17544-5|ATF7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2528	32.19	2	1727.8555	1727.8555	R	F	42	57
PSM	VDSEGDFSENDDAAGDFR	29	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=3116	37.26493333333333	2	2058.791003	2058.790407	R	S	321	339
PSM	DVIELTDDSFDK	30	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3884	45.541	2	1463.7668	1463.7668	K	N	158	170
PSM	ELAEDGYSGVEVR	31	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=2376	30.967	2	1456.7258	1456.7258	R	V	28	41
PSM	ETVSEESNVLCLSK	32	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=2968	35.976	2	1661.8818	1661.8818	R	S	581	595
PSM	GKESSIENEIAVLR	33	sp|Q8IU85-2|KCC1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3662	42.817	2	1691.9131	1691.9132	K	K	61	75
PSM	NVTELNEPLSNEER	34	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=2410	31.242	2	1676.843	1676.8430	K	N	29	43
PSM	STAGDTHLGGEDFDNR	35	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=1520	24.42	3	1724.7814	1724.7814	K	M	221	237
PSM	VDSTTCLFPVEEK	36	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=3755	43.895	2	1671.8103	1671.8103	R	A	241	254
PSM	EQFLDGDGWTSR	37	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=3659	42.792545000000004	2	1523.650843	1523.650606	K	W	25	37
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	38	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,32-UNIMOD:510	ms_run[1]:scan=2902	35.41981333333333	3	3790.316023	3790.321301	K	A	158	190
PSM	DNLTLWTSDSAGEECDAAEGAEN	39	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=4195	49.496	2	2488.0396	2488.0396	R	-	223	246
PSM	EDGLAQQQTQLNLR	40	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2668	33.373	2	1726.8463	1726.8463	K	S	2207	2221
PSM	ESLKEEDESDDDNM	41	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=879	19.031	2	1738.7364	1738.7364	K	-	235	249
PSM	GVVDSDDLPLNVSR	42	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=3294	38.948	2	1518.8102	1518.8102	K	E	435	449
PSM	AELFTQSCADLDK	43	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=3370	39.694	2	1644.7743	1644.7743	K	W	1369	1382
PSM	EALTYDGALLGDR	44	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=3404	40.043	2	1426.7516	1426.7516	K	S	97	110
PSM	EQISDIDDAVR	45	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=2449	31.534	2	1293.6625	1293.6625	K	K	115	126
PSM	KEESEESDDDMGFGLFD	46	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=3838	44.97	2	2032.8732	2032.8732	K	-	73	90
PSM	NQLTSNPENTVFDAK	47	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=2753	34.175	2	1744.9268	1744.9268	K	R	82	97
PSM	VIGSGCNLDSAR	48	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1255	22.399	2	1281.656	1281.6560	R	F	100	112
PSM	VEIIANDQGNR	49	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510	ms_run[1]:scan=1387	23.395133333333334	2	1261.683662	1261.683881	R	I	50	61
PSM	FASENDLPEWK	50	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=3782	44.27948666666666	2	1482.7062	1482.7063	R	E	58	69
PSM	YFQINQDEEEEEDED	51	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510	ms_run[1]:scan=2921	35.564418333333336	2	1965.7882	1964.7852	R	-	114	129
PSM	KEESEESDDDMGFGLFD	52	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[1]:scan=3838	44.96963833333333	2	2032.8724	2032.8727	K	-	98	115
PSM	DITSDTSGDFR	53	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=2241	29.92	2	1246.589	1246.5890	K	N	167	178
PSM	DNLTLWTSENQGDEGDAGEGEN	54	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=3979	46.897	3	2384.01	2384.0100	R	-	223	245
PSM	DQGTYEDYVEGLR	55	sp|P60660-2|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=3712	43.414	2	1577.7422	1577.7422	K	V	82	95
PSM	DQVANSAFVER	56	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1846	26.824	2	1268.6573	1268.6573	K	L	500	511
PSM	DSSTSPGDYVLSVSENSR	57	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3887	45.566	2	2012.8788	2012.8788	R	V	39	57
PSM	EGMNIVEAMER	58	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=3545	41.608	2	1311.6375	1311.6375	K	F	74	85
PSM	EQFLDGDGWTSR	59	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3659	42.793	2	1523.6506	1523.6506	K	W	25	37
PSM	EQISDIDDAVR	60	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3007	36.312	2	1373.6288	1373.6288	K	K	115	126
PSM	EQVANSAFVER	61	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1578	24.84	2	1282.673	1282.6730	K	V	492	503
PSM	ISVYYNEATGGK	62	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2193	29.545	2	1368.7562	1368.7562	R	Y	47	59
PSM	NNSGEEFDCAFR	63	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2549	32.384	2	1478.6309	1478.6309	R	L	355	367
PSM	VDSTTCLFPVEEK	64	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=3736	43.672	2	1671.8103	1671.8103	R	A	241	254
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	65	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,33-UNIMOD:510	ms_run[1]:scan=3167	37.652765	4	3922.7320	3922.7326	K	E	241	274
PSM	DSSTSPGDYVLSVSENSR	66	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3887	45.56588333333333	2	2012.8782	2012.8783	R	V	39	57
PSM	DCAYVAKPESLS	67	sp|Q8IU85-2|KCC1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:4,7-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2470	31.698	2	1486.7051	1486.7051	K	-	346	358
PSM	DGNGYISAAELR	68	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=2850	35.019	2	1298.6679	1298.6679	K	H	96	108
PSM	GTVTDFPGFDER	69	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3380	39.801	2	1373.6676	1373.6676	R	A	7	19
PSM	HTGCCGDNDPIDVCEIGSK	70	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4,19-UNIMOD:510	ms_run[2]:scan=2368	30.909	3	2200.9824	2200.9824	K	V	110	129
PSM	QGTGLQGQAVFK	71	sp|Q8WVC0-2|LEO1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2473	31.721	2	1380.7439	1380.7439	R	T	415	427
PSM	SIYYITGESK	72	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2495	31.925	2	1227.7023	1227.7023	K	E	482	492
PSM	TAFQEALDAAGDK	73	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2925	35.597	2	1403.7569	1403.7569	K	L	9	22
PSM	RSYSSPDITQAIQEEEK	74	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=3238	38.382171666666665	3	2128.0360	2128.0357	K	R	715	732
PSM	QENCGAQQVPAGPGTSTPPSSPVR	75	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=2084	28.612178333333333	3	2535.1638	2535.1632	R	T	257	281
PSM	AGFAGDDAPR	76	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1031	20.559	2	1009.5041	1009.5041	K	A	19	29
PSM	DCAYVAKPESLS	77	sp|Q8IU85-2|KCC1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:4,7-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2335	30.659	2	1486.7051	1486.7051	K	-	346	358
PSM	DLSLEEIQK	78	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=3079	36.972	2	1141.6867	1141.6867	K	K	44	53
PSM	EGMNIVEAMER	79	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:35	ms_run[2]:scan=2652	33.243	2	1327.6324	1327.6324	K	F	74	85
PSM	ESEDKPEIEDVGSDEEEEK	80	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=1814	26.587	3	2294.1022	2294.1022	K	K	251	270
PSM	GGIVDEGALLR	81	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=3100	37.141	2	1132.6664	1132.6664	R	A	237	248
PSM	NAGVEGSLIVEK	82	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2283	30.237	2	1282.7769	1282.7769	K	I	482	494
PSM	QNSAYNMHSILSNTSAE	83	sp|Q15172-2|2A5A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=2482	31.825	2	1995.8458	1995.8458	K	-	413	430
PSM	SNVSDAVAQSTR	84	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1203	21.967	2	1267.6581	1267.6581	K	I	232	244
PSM	TTPSYVAFTDTER	85	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510	ms_run[1]:scan=2917	35.53418166666666	2	1520.7566	1520.7566	R	L	37	50
PSM	GEPNVSYICSR	86	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=2118	28.87283833333333	2	1394.6110	1394.6109	R	Y	273	284
PSM	VQQTVQDLFGR	87	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=3465	40.725654999999996	2	1403.7020	1403.7017	K	A	395	406
PSM	DNNQFASASLDR	88	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2100	28.735	2	1370.6639	1370.6639	K	T	125	137
PSM	DVNQQEFVR	89	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1838	26.767	2	1167.6097	1167.6097	K	A	8	17
PSM	EGMNIVEAMER	90	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=1149	21.537	2	1343.6274	1343.6274	K	F	74	85
PSM	EVFEDAAEIR	91	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2603	32.844	2	1211.6246	1211.6246	K	L	411	421
PSM	GDRSEDFGVNEDLADSDAR	92	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2608	32.887	3	2100.9408	2100.9408	K	A	186	205
PSM	GDYPLEAVR	93	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2295	30.331	2	1052.5715	1052.5715	K	M	368	377
PSM	GEFVTTVQQR	94	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1564	24.736	2	1197.6566	1197.6566	K	G	132	142
PSM	HGESAWNLENR	95	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2101	28.742	2	1425.6251	1425.6251	R	F	11	22
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	96	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,32-UNIMOD:510	ms_run[2]:scan=2747	34.126	3	3790.3213	3790.3213	K	A	158	190
PSM	NFSDNQLQEGK	97	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1572	24.796	2	1346.7103	1346.7103	R	N	161	172
PSM	STSQGSINSPVYSR	98	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1805	26.518	2	1595.7405	1595.7405	R	H	108	122
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	99	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510	ms_run[2]:scan=1002	20.307	4	3246.2875	3246.2875	R	K	494	522
PSM	TLEEDEEELFK	100	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3368	39.677	2	1448.7559	1448.7559	K	M	40	51
PSM	TPSSDVLVFDYTK	101	sp|Q09028-4|RBBP4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4063	47.865	2	1618.8168	1618.8168	K	H	109	122
PSM	TWNDPSVQQDIK	102	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2431	31.397	2	1497.81	1497.8100	R	F	102	114
PSM	DNSTMGYMMAK	103	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:510	ms_run[1]:scan=759	17.585526666666667	2	1363.609537	1363.609444	R	K	486	497
PSM	GEPNVSYICSR	104	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=2215	29.714986666666665	2	1394.6110	1394.6109	R	Y	273	284
PSM	DNLTLWTSDQQDDDGGEGNN	105	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4260	50.519	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDSAGEECDAAEGAEN	106	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=4199	49.559	3	2488.0396	2488.0396	R	-	223	246
PSM	ELISNSSDALDK	107	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2007	28.022	2	1358.7566	1358.7566	R	I	47	59
PSM	GYSFTTTAER	108	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1789	26.405	2	1165.5828	1165.5828	R	E	197	207
PSM	HEQNIDCGGGYVK	109	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1014	20.397	3	1543.7726	1543.7726	K	L	99	112
PSM	IFRDGEEAGAYDGPR	110	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1601	25.009	3	1685.8222	1685.8222	K	T	105	120
PSM	LAAIAESGVER	111	sp|P28072|PSB6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1705	25.778	2	1148.6614	1148.6614	R	Q	210	221
PSM	NDLAVVDVR	112	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2390	31.074	2	1033.598	1033.5980	K	I	334	343
PSM	QENCGAQQVPAGPGTSTPPSSPVR	113	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=2084	28.612	3	2535.1637	2535.1637	R	T	257	281
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	114	sp|Q8NC51-2|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,33-UNIMOD:510	ms_run[2]:scan=3167	37.653	4	3922.7331	3922.7331	K	E	235	268
PSM	QVVESAYEVIK	115	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2697	33.644	2	1331.7973	1331.7973	K	L	175	186
PSM	RASAYEALEK	116	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1435	23.761	2	1284.6752	1284.6752	R	Y	91	101
PSM	SGTPPRQGSITSPQANEQSVTPQR	117	sp|Q9UQ35-2|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1607	25.054	3	2636.2768	2636.2768	K	R	846	870
PSM	TGLYNYYDDEK	118	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2661	33.318	2	1447.7144	1447.7144	R	E	240	251
PSM	TNQELQEINR	119	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1291	22.668	2	1277.6788	1277.6788	R	V	154	164
PSM	YLIANATNPESK	120	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1992	27.905	2	1387.7984	1387.7984	K	V	104	116
PSM	EVFEDAAEIR	121	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510	ms_run[1]:scan=2589	32.73187	2	1212.6382	1211.6242	K	L	411	421
PSM	SGSYSYLEER	122	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2439	31.457123333333335	2	1303.5546	1303.5541	R	K	908	918
PSM	SGQGAFGNMCR	123	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,9-UNIMOD:35,10-UNIMOD:4	ms_run[1]:scan=822	18.410571666666666	2	1233.544262	1233.544293	R	G	87	98
PSM	VPSPLEGSEGDGDTD	124	sp|Q9Y606|TRUA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[1]:scan=2777	34.38243833333333	2	1587.640423	1587.640160	K	-	413	428
PSM	AGNFYVPAEPK	125	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2438	31.45	2	1259.7187	1259.7187	K	L	78	89
PSM	ALAAAGYDVEK	126	sp|P22492|H1T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1861	26.932	2	1174.687	1174.6870	K	N	69	80
PSM	ALSRQEMQEVQSSR	127	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1581	24.861	3	1761.8293	1761.8293	K	S	175	189
PSM	CLGLTEAQTR	128	sp|P31327-3|CPSM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=1666	25.488	2	1181.6287	1181.6287	K	E	926	936
PSM	DNLTLWTSDMQGDGEEQNK	129	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3432	40.368	3	2264.0539	2264.0539	R	E	204	223
PSM	DNLTLWTSDMQGDGEEQNK	130	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3945	46.409	3	2248.059	2248.0590	R	E	204	223
PSM	EGYSGVGLLSR	131	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2778	34.39	2	1170.6457	1170.6457	K	Q	126	137
PSM	EVYELLDSPGK	132	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3073	36.927	2	1316.75	1316.7500	K	V	20	31
PSM	NLQYYDISAK	133	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2722	33.886	2	1281.7241	1281.7241	K	S	143	153
PSM	RMGESDDSILR	134	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=1300	22.737	2	1407.6278	1407.6278	R	L	61	72
PSM	SADTLWDIQK	135	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3698	43.26	2	1323.6748	1323.6748	K	D	320	330
PSM	SLQSVAEER	136	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1429	23.718	2	1051.5722	1051.5722	R	A	97	106
PSM	VAEDEAEAAAAAK	137	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=1177	21.77	2	1312.7147	1312.7147	K	F	47	60
PSM	VAVVAGYGDVGK	138	sp|P23526-2|SAHH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2184	29.459	2	1201.7343	1201.7343	K	G	187	199
PSM	YALYDATYETK	139	sp|Q9Y281-3|COF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2739	34.06	2	1404.7449	1404.7449	R	E	65	76
PSM	EGLELPEDEEEK	140	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=2573	32.60912666666667	2	1483.7561	1483.7561	K	K	539	551
PSM	ATAGDTHLGGEDFDNR	141	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=1559	24.70125	3	1708.785841	1708.786508	K	L	221	237
PSM	VTLTSEEEAR	142	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=1273	22.533915	2	1167.6188	1167.6190	K	L	306	316
PSM	AGDLLEDSPK	143	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=1770	26.257	2	1111.6397	1111.6397	R	R	158	168
PSM	AQSREQLAALK	144	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1354	23.149	2	1361.7704	1361.7704	R	K	61	72
PSM	CYEMASHLR	145	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=1395	23.453	3	1199.564	1199.5640	K	R	128	137
PSM	DTLYEAVR	146	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2076	28.537	2	999.54493	999.5449	R	E	8	16
PSM	EAAENSLVAYK	147	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1876	27.041	2	1261.7191	1261.7191	K	A	121	132
PSM	EQLAIAEFAR	148	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3413	40.156	2	1180.6664	1180.6664	R	S	434	444
PSM	GDLGIEIPAEK	149	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3175	37.715	2	1208.7289	1208.7289	R	V	295	306
PSM	NNAYLAQSPQLYK	150	sp|P14868-2|SYDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2913	35.502	2	1656.8549	1656.8549	K	Q	142	155
PSM	RGPGLYYVDSEGNR	151	sp|P28074-3|PSB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1919	27.35	3	1615.8167	1615.8167	K	I	63	77
PSM	RNQSFCPTVNLDK	152	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2360	30.851	2	1725.8546	1725.8546	K	L	65	78
PSM	SAINEVVTR	153	sp|P62899-3|RL31_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1391	23.423	2	1021.598	1021.5980	R	E	15	24
PSM	SYCAEIAHNVSSK	154	sp|P62910|RL32_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1575	24.817	3	1532.793	1532.7930	K	N	94	107
PSM	VEVTEFEDIK	155	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3317	39.138	2	1275.7235	1275.7235	R	S	98	108
PSM	VPTANVSVVDLTCR	156	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3427	40.311	2	1643.8166	1643.8166	R	L	235	249
PSM	LDIDSPPITAR	157	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3385	39.86993	2	1310.6694	1310.6690	R	N	33	44
PSM	RDSSDDWEIPDGQITVGQR	158	sp|P15056|BRAF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3729	43.61343833333333	3	2287.0384	2287.0325	R	I	444	463
PSM	SSSSVTTSETQPCTPSSSDYSDLQR	159	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=2596	32.78598833333333	3	2820.1853	2820.1852	K	V	322	347
PSM	TEPVALEPRCAADAGMKR	160	sp|Q8N2K0-3|ABD12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:4,16-UNIMOD:35,17-UNIMOD:510	ms_run[1]:scan=3893	45.62968833333333	2	2137.0522	2135.0532	R	A	5	23
PSM	TPSSDVLVFDYTK	161	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4063	47.86514833333333	2	1618.817181	1618.816791	K	H	144	157