MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100625_002MAP2K2.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100625_002MAP2K2.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	228-UNIMOD:510,29-UNIMOD:510,31-UNIMOD:21	0.15	44.0	8	2	1
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21	0.03	43.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	6-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510,30-UNIMOD:510,38-UNIMOD:21	0.09	43.0	2	2	2
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	230-UNIMOD:510,241-UNIMOD:21,231-UNIMOD:21,232-UNIMOD:21	0.04	40.0	3	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	239-UNIMOD:510,19-UNIMOD:510	0.07	40.0	2	2	2
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	203-UNIMOD:510,205-UNIMOD:21,221-UNIMOD:510,93-UNIMOD:510,100-UNIMOD:21,103-UNIMOD:510,94-UNIMOD:35	0.07	39.0	3	2	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	204-UNIMOD:510,213-UNIMOD:35,222-UNIMOD:510,85-UNIMOD:510,96-UNIMOD:510	0.14	38.0	2	2	2
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	129-UNIMOD:510,140-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	309-UNIMOD:510,321-UNIMOD:21,325-UNIMOD:510,309-UNIMOD:35	0.04	38.0	2	1	0
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	221-UNIMOD:510,57-UNIMOD:510,61-UNIMOD:35,66-UNIMOD:21,71-UNIMOD:510,160-UNIMOD:510,163-UNIMOD:21,37-UNIMOD:510,45-UNIMOD:21	0.12	37.0	5	4	3
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	75-UNIMOD:510,84-UNIMOD:35	0.13	36.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	142-UNIMOD:510,176-UNIMOD:510,578-UNIMOD:510,589-UNIMOD:510	0.07	36.0	2	2	2
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	99-UNIMOD:510,109-UNIMOD:35	0.16	36.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	1072-UNIMOD:510,1084-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	28-UNIMOD:510,30-UNIMOD:21,28-UNIMOD:21	0.06	35.0	3	1	0
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	43-UNIMOD:510,57-UNIMOD:510,175-UNIMOD:510,185-UNIMOD:510,248-UNIMOD:510	0.14	34.0	3	3	3
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	210-UNIMOD:510,211-UNIMOD:4,222-UNIMOD:21,226-UNIMOD:21,274-UNIMOD:510,293-UNIMOD:21,295-UNIMOD:21	0.12	34.0	3	2	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	207-UNIMOD:510	0.14	34.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	33.0	1	1	0
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	337-UNIMOD:510,349-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	14-UNIMOD:510	0.06	33.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	162-UNIMOD:510,167-UNIMOD:21,168-UNIMOD:4,179-UNIMOD:510	0.10	32.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	292-UNIMOD:510,306-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,613-UNIMOD:510,617-UNIMOD:35,620-UNIMOD:35,621-UNIMOD:35,623-UNIMOD:510,551-UNIMOD:510	0.08	32.0	5	5	5
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	82-UNIMOD:510,91-UNIMOD:21,96-UNIMOD:510,186-UNIMOD:510,189-UNIMOD:21,196-UNIMOD:35,85-UNIMOD:21,102-UNIMOD:510,113-UNIMOD:510	0.06	32.0	5	3	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	158-UNIMOD:510,160-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	32.0	1	1	1
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	158-UNIMOD:510,168-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	31.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	418-UNIMOD:510,435-UNIMOD:21,441-UNIMOD:510	0.05	31.0	1	1	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	8-UNIMOD:510,23-UNIMOD:510,18-UNIMOD:21	0.05	31.0	2	1	0
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	496-UNIMOD:510,498-UNIMOD:21,500-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	31.0	1	1	0
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	44-UNIMOD:510,55-UNIMOD:21,48-UNIMOD:21	0.10	30.0	2	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510,20-UNIMOD:510	0.09	30.0	4	3	2
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	30.0	1	1	1
PRT	sp|Q15427|SF3B4_HUMAN	Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	10-UNIMOD:510,14-UNIMOD:21,23-UNIMOD:510	0.04	30.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	445-UNIMOD:510,449-UNIMOD:21,453-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,47-UNIMOD:510,52-UNIMOD:21,58-UNIMOD:510	0.05	28.0	3	2	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:510,7-UNIMOD:21	0.13	28.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	305-UNIMOD:510,307-UNIMOD:21,318-UNIMOD:510	0.05	28.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	462-UNIMOD:510,466-UNIMOD:21,468-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	null	350-UNIMOD:510,350-UNIMOD:35,364-UNIMOD:21,366-UNIMOD:510	0.04	28.0	1	1	0
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	null	424-UNIMOD:510,443-UNIMOD:21,447-UNIMOD:510	0.05	28.0	1	1	0
PRT	sp|P04049|RAF1_HUMAN	RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=RAF1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	628-UNIMOD:510,637-UNIMOD:4,638-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P22492|H1T_HUMAN	Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	69-UNIMOD:510,79-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	228-UNIMOD:510	0.08	27.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	82-UNIMOD:510,85-UNIMOD:21,89-UNIMOD:21	0.09	27.0	2	1	0
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	29-UNIMOD:510,42-UNIMOD:510,39-UNIMOD:21,36-UNIMOD:21	0.04	27.0	3	1	0
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 3 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	125-UNIMOD:510,135-UNIMOD:21,136-UNIMOD:4,137-UNIMOD:510	0.08	27.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	323-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	494-UNIMOD:510,495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21,521-UNIMOD:510	0.05	27.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	235-UNIMOD:510,241-UNIMOD:21,247-UNIMOD:4,246-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|P05976|MYL1_HUMAN	Myosin light chain 1/3, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=MYL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	null	142-UNIMOD:510,146-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	463-UNIMOD:510,473-UNIMOD:21,482-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	435-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510	0.08	26.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	11-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	4-UNIMOD:510,11-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	44-UNIMOD:510,49-UNIMOD:4,50-UNIMOD:21,152-UNIMOD:510,152-UNIMOD:4,162-UNIMOD:510,368-UNIMOD:510	0.07	26.0	3	3	3
PRT	sp|Q9BQ70|TCF25_HUMAN	Transcription factor 25 OS=Homo sapiens OX=9606 GN=TCF25 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	81-UNIMOD:510,83-UNIMOD:4,86-UNIMOD:21,94-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	40-UNIMOD:510,48-UNIMOD:21	0.05	26.0	2	1	0
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	26.0	1	1	0
PRT	sp|Q9NZZ3-2|CHMP5_HUMAN	Isoform 2 of Charged multivesicular body protein 5 OS=Homo sapiens OX=9606 GN=CHMP5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	12-UNIMOD:510,18-UNIMOD:21,20-UNIMOD:4	0.10	25.0	2	1	0
PRT	sp|Q9H2H8|PPIL3_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 3 OS=Homo sapiens OX=9606 GN=PPIL3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	151-UNIMOD:510,153-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	161-UNIMOD:510,171-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	340-UNIMOD:510,344-UNIMOD:21,353-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	86-UNIMOD:510,87-UNIMOD:21,395-UNIMOD:510,398-UNIMOD:21	0.04	25.0	2	2	2
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	201-UNIMOD:510,205-UNIMOD:21	0.02	25.0	1	1	0
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	90-UNIMOD:510,96-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	184-UNIMOD:510,194-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	97-UNIMOD:510,100-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	80-UNIMOD:510,82-UNIMOD:21,92-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	70-UNIMOD:510,77-UNIMOD:21	0.04	24.0	1	1	0
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	40-UNIMOD:510,50-UNIMOD:510,58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.12	24.0	2	2	2
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	227-UNIMOD:510,232-UNIMOD:21,237-UNIMOD:510	0.02	24.0	1	1	0
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	37-UNIMOD:510,41-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	99-UNIMOD:510,103-UNIMOD:21,105-UNIMOD:35	0.09	24.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	326-UNIMOD:510,332-UNIMOD:21,336-UNIMOD:510	0.02	24.0	1	1	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	159-UNIMOD:510,166-UNIMOD:21,168-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	301-UNIMOD:510,312-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P21980-2|TGM2_HUMAN	Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2 OS=Homo sapiens OX=9606 GN=TGM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	365-UNIMOD:510,368-UNIMOD:21,370-UNIMOD:4,371-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q8NBS9-2|TXND5_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	137-UNIMOD:510,139-UNIMOD:4,140-UNIMOD:21,146-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|Q9BTA9|WAC_HUMAN	WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	523-UNIMOD:510,525-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9NZZ3|CHMP5_HUMAN	Charged multivesicular body protein 5 OS=Homo sapiens OX=9606 GN=CHMP5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	12-UNIMOD:510,16-UNIMOD:21,20-UNIMOD:4	0.08	23.0	1	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	151-UNIMOD:510,160-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|O60716-24|CTND1_HUMAN	Isoform 3 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	149-UNIMOD:510,151-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	162-UNIMOD:510,168-UNIMOD:21	0.03	22.0	1	1	0
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	414-UNIMOD:510,418-UNIMOD:21,420-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	61-UNIMOD:510,66-UNIMOD:21,71-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	665-UNIMOD:510,670-UNIMOD:21,676-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	117-UNIMOD:510,120-UNIMOD:21,128-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	95-UNIMOD:510,101-UNIMOD:4	0.11	22.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	402-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	219-UNIMOD:510,223-UNIMOD:4,229-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	107-UNIMOD:510,109-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9C0C2-2|TB182_HUMAN	Isoform 2 of 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	114-UNIMOD:510,120-UNIMOD:4,123-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	475-UNIMOD:510,479-UNIMOD:21,494-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	2022-UNIMOD:35	0.01	22.0	2	1	0
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	327-UNIMOD:510,331-UNIMOD:21	0.05	22.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510	ms_run[2]:scan=4791	48.166	2	2226.9361	2226.9361	R	-	228	248
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	2	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2494	29.244	3	2847.2212	2847.2212	K	M	445	470
PSM	TIGGGDDSFNTFFSETGAGK	3	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5349	54.255	2	2154.9783	2154.9783	K	H	6	26
PSM	DNLTLWTSDQQDDDGGEGNN	4	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510	ms_run[2]:scan=4901	49.168	2	2226.9361	2226.9361	R	-	228	248
PSM	SSSPAPADIAQTVQEDLR	5	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4256	43.059	2	1997.9519	1997.9519	K	T	230	248
PSM	SSSPAPADIAQTVQEDLR	6	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=5236	52.815	2	1997.9519	1997.9519	K	T	230	248
PSM	SYELPDGQVITIGNER	7	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=4873	48.906	2	1823.9478	1823.9478	K	F	239	255
PSM	SSSPAPADIAQTVQEDLR	8	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=5236	52.81524666666667	2	1997.9575	1997.9514	K	T	230	248
PSM	DATNVGDEGGFAPNILENK	9	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,3-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=4918	49.306	2	2108.01	2108.0100	K	E	203	222
PSM	DNLTLWTSDQQDDDGGEGNN	10	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=5137	51.752	2	2226.9361	2226.9361	R	-	228	248
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	11	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=3399	36.053	3	3112.2782	3112.2782	K	L	595	622
PSM	DNLTLWTSDMQGDGEEQNK	12	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=4033	41.191	2	2264.0539	2264.0539	R	E	204	223
PSM	LGDVYVNDAFGTAHR	13	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3773	39.06	2	1747.8143	1747.8143	K	A	129	144
PSM	MSASDPNSSIFLTDTAK	14	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,13-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4136	42.038	2	1931.9224	1931.9224	K	Q	309	326
PSM	STAGDTHLGGEDFDNR	15	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=1880	24.859	2	1724.7814	1724.7814	K	M	221	237
PSM	DWEDDSDEDMSNFDR	16	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=3205	34.472	2	1924.7117	1924.7117	K	F	75	90
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	17	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,35-UNIMOD:510	ms_run[2]:scan=3212	34.524	3	4220.6251	4220.6251	K	A	142	177
PSM	KEESEESDDDMGFGLFD	18	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4549	45.859	2	2032.8732	2032.8732	K	-	99	116
PSM	AFGPGLQGGSAGSPAR	19	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2612	30.099	2	1542.7404	1542.7404	K	F	1072	1088
PSM	SVTEQGAELSNEER	20	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=1693	23.501	2	1581.7695	1581.7695	K	N	28	42
PSM	DLADELALVDVIEDK	21	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6362	68.186	2	1724.972	1724.9720	K	L	43	58
PSM	LCDFGVSGQLIDSMANSFVGTR	22	sp|P36507|MP2K2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=6301	67.251	2	2567.1051	2567.1051	K	S	210	232
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	23	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4820	48.398	3	3490.5054	3490.5054	R	-	207	238
PSM	DSSTSPGDYVLSVSENSR	24	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4587	46.321	2	2012.8788	2012.8788	R	V	39	57
PSM	ESEPAPASVTALTDAR	25	sp|Q00613-2|HSF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2929	32.39	2	1727.8191	1727.8191	R	G	337	353
PSM	IQALQQQADEAEDR	26	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=2081	26.294	2	1647.8276	1647.8276	K	A	14	28
PSM	SVTEQGAELSNEER	27	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2296	27.827	2	1661.7358	1661.7358	K	N	28	42
PSM	APVAGTCYQAEWDDYVPK	28	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:21,7-UNIMOD:4,18-UNIMOD:510	ms_run[2]:scan=4981	49.992	2	2217.0126	2217.0126	R	L	162	180
PSM	NPDDITQEEYGEFYK	29	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=4060	41.415	2	1914.916	1914.9160	R	S	292	307
PSM	NQLTSNPENTVFDAK	30	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3229	34.648	2	1824.8931	1824.8931	K	R	82	97
PSM	SSTPLPTISSSAENTR	31	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2738	31.014	2	1760.8406	1760.8406	R	Q	158	174
PSM	SVTEQGAELSNEER	32	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=2060	26.143	2	1661.7358	1661.7358	K	N	28	42
PSM	TAFQEALDAAGDK	33	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3417	36.185	2	1403.7569	1403.7569	K	L	9	22
PSM	EAINVEQAFQTIAR	34	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=4865	48.834	2	1702.8504	1702.8504	K	N	158	172
PSM	ESLKEEDESDDDNM	35	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=1100	19.126	2	1738.7364	1738.7364	K	-	235	249
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	36	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2748	31.087	3	2810.1902	2810.1902	R	E	418	442
PSM	LIAPVAEEEATVPNNK	37	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=3088	33.59	2	1762.0149	1762.0149	K	I	8	24
PSM	LIAPVAEEEATVPNNK	38	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3241	34.736	2	1841.9812	1841.9812	K	I	8	24
PSM	MSASDPNSSIFLTDTAK	39	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,1-UNIMOD:35,13-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3670	38.179	2	1947.9173	1947.9173	K	Q	309	326
PSM	QRSPSPAPAPAPAAAAGPPTR	40	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=1705	23.586	3	2161.0295	2161.0295	R	K	496	517
PSM	DSSTSPGDYVLSVSENSR	41	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4587	46.32129833333333	2	2012.8840	2012.8783	R	V	39	57
PSM	AVFVDLEPTVIDEVR	42	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=5668	58.481	2	1814.9279	1814.9279	R	T	30	45
PSM	EGLELPEDEEEK	43	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3036	33.161	2	1483.7566	1483.7566	K	K	539	551
PSM	ELAPYDENWFYTR	44	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=5372	54.54	2	1816.7922	1816.7922	K	A	44	57
PSM	ELEAIFGRPVVDGEEGEPHSISPR	45	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,20-UNIMOD:21,22-UNIMOD:21	ms_run[2]:scan=4736	47.633	3	2813.2887	2813.2887	K	P	274	298
PSM	EVDEQMLNVQNK	46	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1825	24.451	2	1529.8032	1529.8032	K	N	325	337
PSM	EVDEQMLNVQNK	47	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2852	31.842	2	1513.8083	1513.8083	K	N	325	337
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	48	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=5075	51	3	2995.386	2995.3860	R	G	2913	2938
PSM	NQDATVYVGGLDEK	49	sp|Q15427|SF3B4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3428	36.267	2	1655.808	1655.8080	R	V	10	24
PSM	NQVAMNPTNTVFDAK	50	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:35,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2679	30.579	2	1812.8754	1812.8754	K	R	57	72
PSM	DNLTLWTSDQQDDDGGEGNN	51	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=5583	57.314	2	2226.9361	2226.9361	R	-	228	248
PSM	FFPASADRTVIDYNGER	52	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3606	37.685	2	2070.9624	2070.9624	K	T	445	462
PSM	DAGTIAGLNVLR	53	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=5034	50.554	2	1312.6964	1312.6964	K	I	160	172
PSM	DAGTIAGLNVMR	54	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=3628	37.854	2	1346.6478	1346.6478	K	I	186	198
PSM	ESEDKPEIEDVGSDEEEEK	55	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=2166	26.902	3	2294.1022	2294.1022	K	K	251	270
PSM	GVQVETISPGDGR	56	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2368	28.344	2	1427.687	1427.6870	M	T	2	15
PSM	NQLTSNPENTVFDAK	57	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3917	40.236	2	1824.8931	1824.8931	K	R	82	97
PSM	SRSPESQVIGENTK	58	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1490	22.046	2	1678.8564	1678.8564	R	Q	305	319
PSM	YEQGTGCWQGPNR	59	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2154	26.817	2	1665.6819	1665.6819	K	S	462	475
PSM	DNLTLWTSDQQDDDGGEGNN	60	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510	ms_run[1]:scan=4907	49.22452833333333	3	2226.9427	2226.9356	R	-	228	248
PSM	FFPASADRTVIDYNGER	61	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=3606	37.68476	2	2070.9666	2070.9619	K	T	445	462
PSM	MSASDPNSSIFLTDTAK	62	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,1-UNIMOD:35,15-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=3670	38.17913833333333	2	1947.922379	1947.917310	K	Q	350	367
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	63	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,20-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=2748	31.087461666666663	3	2810.195683	2810.190250	R	E	424	448
PSM	AAHTEDINACTLTTSPR	64	sp|P04049|RAF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=2114	26.532	3	1970.8981	1970.8981	R	L	628	645
PSM	ALAAAGYDVEK	65	sp|P22492|H1T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2224	27.316	2	1174.687	1174.6870	K	N	69	80
PSM	DAGTIAGLNVMR	66	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4621	46.597	2	1330.6529	1330.6529	K	I	186	198
PSM	DNLTLWTSDQQDEEAGEGN	67	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4854	48.753	2	2154.9402	2154.9402	R	-	228	247
PSM	DQGTYEDYVEGLR	68	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4596	46.388	2	1657.7085	1657.7085	K	V	82	95
PSM	DQGTYEDYVEGLR	69	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4082	41.575	2	1657.7085	1657.7085	K	V	82	95
PSM	GILAADESTGSIAK	70	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=2572	29.807	2	1399.8195	1399.8195	K	R	29	43
PSM	GILAADESTGSIAK	71	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2962	32.627	2	1479.7858	1479.7858	K	R	29	43
PSM	IIYGGSVTGATCK	72	sp|P60174-4|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2522	29.443	2	1473.7575	1473.7575	R	E	125	138
PSM	TAENATSGETLEENEAGD	73	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=2009	25.781	2	1870.8128	1870.8128	K	-	323	341
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	74	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510	ms_run[2]:scan=1255	20.312	4	3246.2875	3246.2875	R	K	494	522
PSM	VPTANVSVVDLTCR	75	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4042	41.282	2	1643.8166	1643.8166	R	L	235	249
PSM	EGNGTVMGAELR	76	sp|P05976|MYL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=2743	31.049858333333333	2	1346.615290	1346.611384	K	H	142	154
PSM	AGEEDEGEEDSDSDYEISAK	77	sp|A2RRP1-2|NBAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2528	29.488	2	2321.9221	2321.9221	R	A	463	483
PSM	ELISNASDALDK	78	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2934	32.426	2	1342.7616	1342.7616	R	I	42	54
PSM	GVVDSDDLPLNVSR	79	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=3848	39.654	2	1518.8102	1518.8102	K	E	435	449
PSM	HELQANCYEEVK	80	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1620	22.978	2	1586.8035	1586.8035	K	D	133	145
PSM	HGESAWNLENR	81	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1993	25.666	2	1345.6587	1345.6587	R	F	11	22
PSM	NQYDNDVTVWSPQGR	82	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3769	39.032	2	1891.8314	1891.8314	R	I	4	19
PSM	NTGIICTIGPASR	83	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=3269	34.939	2	1472.7271	1472.7271	R	S	44	57
PSM	NVTELNEPLSNEER	84	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3366	35.814	2	1756.8093	1756.8093	K	N	29	43
PSM	SGCALTDAVAPGNK	85	sp|Q9BQ70|TCF25_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:4,6-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2450	28.931	2	1507.7378	1507.7378	R	G	81	95
PSM	TLHSDDEGTVLDDSR	86	sp|O00170|AIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=1943	25.308	2	1772.7678	1772.7678	R	A	40	55
PSM	TDYNASVSVPDSSGPER	87	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=2774	31.275534999999998	2	1893.8251	1893.8201	R	I	70	87
PSM	APPPSLTDCIGTVDSR	88	sp|Q9NZZ3-2|CHMP5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=4006	40.996	2	1798.8385	1798.8385	K	A	12	28
PSM	APPPSLTDCIGTVDSR	89	sp|Q9NZZ3-2|CHMP5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=4017	41.076	2	1798.8385	1798.8385	K	A	12	28
PSM	CDENILWLDYK	90	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=5050	50.78	2	1535.7966	1535.7967	K	N	152	163
PSM	DITIHANPFAQ	91	sp|Q9H2H8|PPIL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4841	48.604	2	1339.6386	1339.6386	K	-	151	162
PSM	NFSDNQLQEGK	92	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1891	24.938	2	1346.7103	1346.7103	R	N	161	172
PSM	SGSSSPDSEITELK	93	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3160	34.124	2	1583.7604	1583.7604	R	F	340	354
PSM	TLHSDDEGTVLDDSR	94	sp|O00170|AIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=1930	25.213	3	1772.7678	1772.7678	R	A	40	55
PSM	TTPSVVAFTADGER	95	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4049	41.335	2	1563.7394	1563.7394	R	L	86	100
PSM	TTPSYVAFTDTER	96	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3613	37.736	2	1600.7234	1600.7234	R	L	37	50
PSM	VQQTVQDLFGR	97	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4083	41.582	2	1403.7022	1403.7022	K	A	395	406
PSM	ARPATDSFDDYPPR	98	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=2598	29.997956666666663	3	1720.7716	1720.7665	R	R	201	215
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	99	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2890	32.11	3	2483.1113	2483.1113	R	A	90	114
PSM	DNSTMGYMMAK	100	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=936	17.612	2	1363.6094	1363.6094	R	K	613	624
PSM	DSSDSADGRATPSENLVPSSAR	101	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2484	29.171	3	2332.0392	2332.0392	R	V	184	206
PSM	EALTYDGALLGDR	102	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4444	44.843	2	1506.718	1506.7180	K	S	97	110
PSM	ELAPYDENWFYTR	103	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=5192	52.295	2	1816.7922	1816.7922	K	A	44	57
PSM	ELISNSSDALDK	104	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2843	31.779	2	1438.7229	1438.7229	R	I	47	59
PSM	ISVYYNEATGGK	105	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2591	29.947	2	1368.7562	1368.7562	R	Y	47	59
PSM	LMIEMDGTENK	106	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3708	38.454	2	1427.6714	1427.6714	K	S	93	104
PSM	NNSGEEFDCAFR	107	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2973	32.705	2	1478.6309	1478.6309	R	L	355	367
PSM	QVVESAYEVIK	108	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3173	34.215	2	1331.7973	1331.7973	K	L	175	186
PSM	SPSPEPIYNSEGK	109	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2104	26.461	2	1551.7494	1551.7494	R	R	80	93
PSM	TDYNASVSVPDSSGPER	110	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2774	31.276	2	1893.8206	1893.8206	R	I	70	87
PSM	TLEEDEEELFK	111	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3936	40.374	2	1448.7559	1448.7559	K	M	40	51
PSM	TLNMTTSPEEK	112	sp|P49915-2|GUAA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2121	26.581	2	1397.6786	1397.6786	K	R	227	238
PSM	VNFATWNQAR	113	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4007	41.004	2	1319.6236	1319.6236	K	L	37	47
PSM	VPTANVSVVDLTCR	114	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3916	40.228	2	1643.8166	1643.8166	R	L	235	249
PSM	FWEVISDEHGID	115	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510	ms_run[1]:scan=4518	45.565781666666666	2	1479.7139	1479.7089	K	P	20	32
PSM	EGNGTVMGAEIR	116	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1523	22.28376833333333	2	1362.6097	1362.6058	K	H	99	111
PSM	TLNMTTSPEEK	117	sp|P49915|GUAA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2121	26.581201666666665	2	1397.6811	1397.6781	K	R	326	337
PSM	DNLTLWTSDQQDDDGGEGNN	118	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=5001	50.191	2	2226.9361	2226.9361	R	-	228	248
PSM	ELISNSSDALDK	119	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2377	28.41	2	1358.7566	1358.7566	R	I	47	59
PSM	FASENDLPEWK	120	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4486	45.267	2	1482.7068	1482.7068	R	E	58	69
PSM	GILAADESTGSIAK	121	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3151	34.059	2	1479.7858	1479.7858	K	R	29	43
PSM	GLSEDTTEETLK	122	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2090	26.359	2	1389.7511	1389.7511	K	E	578	590
PSM	LMIEMDGTENK	123	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:35,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3207	34.488	2	1443.6663	1443.6663	K	S	93	104
PSM	LVQAFQFTDK	124	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4105	41.77	2	1343.7163	1343.7163	R	H	159	169
PSM	NNASTDYDLSDK	125	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1626	23.022	2	1409.6947	1409.6947	K	S	301	313
PSM	RLSQSDEDVIR	126	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1932	25.227	2	1430.6979	1430.6979	K	L	119	130
PSM	SEGTYCCGPVPVR	127	sp|P21980-2|TGM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=2540	29.574	2	1594.6733	1594.6733	K	A	365	378
PSM	TTPSYVAFTDTER	128	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=3408	36.12	2	1520.7571	1520.7571	R	L	37	50
PSM	VDCTQHYELCSGNQVR	129	sp|Q8NBS9-2|TXND5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:4,4-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=2141	26.725	3	2078.8763	2078.8763	K	G	137	153
PSM	SPSPGPNHTSNSSNASNATVVPQNSSAR	130	sp|Q9BTA9|WAC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1350	21.016319999999997	3	2878.3086	2878.3050	R	S	523	551
PSM	APPPSLTDCIGTVDSR	131	sp|Q9NZZ3|CHMP5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=4017	41.07566333333333	2	1798.8429	1798.8380	K	A	12	28
PSM	AGDLLEDSPK	132	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2137	26.696	2	1111.6397	1111.6397	R	R	151	161
PSM	AGFAGDDAPR	133	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1307	20.709	2	1009.5041	1009.5041	K	A	19	29
PSM	APSRQDVYGPQPQVR	134	sp|O60716-24|CTND1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1748	23.888	3	1810.894	1810.8940	R	V	149	164
PSM	ARPATDSFDDYPPR	135	sp|P23588-2|IF4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2598	29.998	3	1720.767	1720.7670	R	R	162	176
PSM	DNLTLWTSDQQDDDGGEGNN	136	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=5479	55.93	2	2226.9361	2226.9361	R	-	228	248
PSM	EGLELPEDEEEKK	137	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2479	29.136	3	1645.9147	1645.9147	K	K	539	552
PSM	ERDHSPTPSVFNSDEER	138	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=2111	26.51	3	2194.8782	2194.8782	R	Y	414	431
PSM	FNVWDTAGQEK	139	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3981	40.788	2	1441.6915	1441.6915	K	F	61	72
PSM	FQQVPTDALANK	140	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2946	32.51	2	1478.7807	1478.7807	R	L	665	677
PSM	GDYPLEAVR	141	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2710	30.813	2	1052.5715	1052.5715	K	M	368	377
PSM	GFPTDATLDDIK	142	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4611	46.51	2	1439.7222	1439.7222	K	E	117	129
PSM	HLIPAANTGESK	143	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1171	19.688	2	1304.7725	1304.7725	K	V	85	97
PSM	KITIADCGQLE	144	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2853	31.849	2	1314.749	1314.7490	K	-	95	106
PSM	LDPGSEETQTLVR	145	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2752	31.117	2	1477.7837	1477.7837	K	E	402	415
PSM	LQIQCVVEDDK	146	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=3379	35.906	2	1413.781	1413.7810	K	V	219	230
PSM	QASTDAGTAGALTPQHVR	147	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1786	24.165	3	1893.9158	1893.9158	R	A	107	125
PSM	TEAQDLCRASPEPPGPESSSR	148	sp|Q9C0C2-2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=2000	25.717	3	2384.0528	2384.0528	R	W	114	135
PSM	TGRDTPENGETAIGAENSEK	149	sp|Q8N3X1|FNBP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=1416	21.507	3	2223.0329	2223.0329	K	I	475	495
PSM	TWNDPSVQQDIK	150	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2854	31.856	2	1497.81	1497.8100	R	F	102	114
PSM	VTLTSEEEAR	151	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1588	22.749	2	1167.6195	1167.6195	K	L	248	258
PSM	LCDFGVSGQLIDSMANSFVGTR	152	sp|P36507|MP2K2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=6292	67.12559	3	2567.1114	2567.1046	K	S	210	232
PSM	PGTETEESMGGGEGNHR	153	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0		ms_run[1]:scan=912	17.305586666666667	3	1743.7150	1743.7113	D	A	2014	2031
PSM	PGTETEESMGGGEGNHR	154	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	9-UNIMOD:35	ms_run[1]:scan=703	14.137463333333333	3	1759.7100	1759.7062	D	A	2014	2031
PSM	SRTHSTSSSLGSGESPFSR	155	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=1948	25.34427833333333	3	2079.9484	2079.9430	R	S	327	346