MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100519_032PIM2.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100519_032PIM2.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null	180-UNIMOD:510,182-UNIMOD:21,183-UNIMOD:21,178-UNIMOD:510,186-UNIMOD:21	0.02	44.0	4	2	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	43.0	null	228-UNIMOD:510	0.09	43.0	7	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	223-UNIMOD:510,28-UNIMOD:510	0.16	43.0	4	2	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	204-UNIMOD:510,222-UNIMOD:510,213-UNIMOD:35	0.09	42.0	2	1	0
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,466-UNIMOD:35	0.03	41.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	39.0	null	16-UNIMOD:510,17-UNIMOD:21,31-UNIMOD:510	0.09	39.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	581-UNIMOD:510,591-UNIMOD:4,593-UNIMOD:21,594-UNIMOD:510	0.02	35.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,36-UNIMOD:21	0.04	35.0	2	1	0
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	108-UNIMOD:510,128-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	null	329-UNIMOD:510,331-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q5T5C0-3|STXB5_HUMAN	Isoform 3 of Syntaxin-binding protein 5 OS=Homo sapiens OX=9606 GN=STXBP5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	688-UNIMOD:510,692-UNIMOD:21,697-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	239-UNIMOD:510,240-UNIMOD:21,19-UNIMOD:510	0.07	34.0	3	2	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	1297-UNIMOD:510,1301-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	223-UNIMOD:510	0.09	33.0	3	1	0
PRT	sp|A0MZ66-7|SHOT1_HUMAN	Isoform 7 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	72-UNIMOD:510,73-UNIMOD:510,75-UNIMOD:21,93-UNIMOD:510	0.11	33.0	1	1	1
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	933-UNIMOD:510,935-UNIMOD:21,941-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	43-UNIMOD:510,57-UNIMOD:510,100-UNIMOD:510,105-UNIMOD:4,248-UNIMOD:510	0.15	32.0	3	3	2
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	129-UNIMOD:510,131-UNIMOD:21,150-UNIMOD:510	0.02	32.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	221-UNIMOD:510	0.03	32.0	1	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	235-UNIMOD:510,241-UNIMOD:21,247-UNIMOD:4,201-UNIMOD:510,210-UNIMOD:21,211-UNIMOD:21,215-UNIMOD:510,237-UNIMOD:21	0.09	32.0	4	2	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	33-UNIMOD:510,37-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	24-UNIMOD:510,29-UNIMOD:21,38-UNIMOD:510,28-UNIMOD:21,432-UNIMOD:510,434-UNIMOD:21	0.06	31.0	3	2	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	119-UNIMOD:510,136-UNIMOD:21,137-UNIMOD:510	0.06	31.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	39-UNIMOD:510,40-UNIMOD:21	0.09	30.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	396-UNIMOD:510	0.05	30.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510,47-UNIMOD:510,55-UNIMOD:21,58-UNIMOD:510	0.06	30.0	2	2	2
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	512-UNIMOD:510,514-UNIMOD:21,519-UNIMOD:21,435-UNIMOD:510	0.04	30.0	3	2	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	188-UNIMOD:510,200-UNIMOD:4,201-UNIMOD:510	0.02	30.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	30.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	539-UNIMOD:510,550-UNIMOD:510,457-UNIMOD:510,459-UNIMOD:21,466-UNIMOD:35,457-UNIMOD:21,492-UNIMOD:510	0.06	29.0	4	3	2
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	97-UNIMOD:510	0.05	29.0	1	1	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	52-UNIMOD:510,54-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.05	29.0	1	1	0
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	29.0	1	1	1
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	null	224-UNIMOD:510	0.03	29.0	1	1	0
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	null	328-UNIMOD:510,330-UNIMOD:21	0.04	29.0	1	1	0
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	129-UNIMOD:510,137-UNIMOD:21,139-UNIMOD:21	0.09	29.0	2	1	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	223-UNIMOD:510,237-UNIMOD:4	0.10	28.0	2	1	0
PRT	sp|Q15366-7|PCBP2_HUMAN	Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	122-UNIMOD:510,126-UNIMOD:21,137-UNIMOD:35,125-UNIMOD:510	0.08	28.0	2	2	2
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	202-UNIMOD:510,213-UNIMOD:21,314-UNIMOD:510,315-UNIMOD:35,332-UNIMOD:21	0.12	28.0	2	2	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	140-UNIMOD:510,142-UNIMOD:21,162-UNIMOD:4,141-UNIMOD:21	0.19	28.0	2	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	null	799-UNIMOD:510,832-UNIMOD:510	0.04	28.0	1	1	1
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	223-UNIMOD:510	0.05	27.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	469-UNIMOD:510,495-UNIMOD:35,502-UNIMOD:510	0.07	27.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	189-UNIMOD:510,202-UNIMOD:21,206-UNIMOD:510	0.04	27.0	1	1	1
PRT	sp|P55735-2|SEC13_HUMAN	Isoform 2 of Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	167-UNIMOD:510,170-UNIMOD:21,173-UNIMOD:4,178-UNIMOD:510	0.04	27.0	1	1	1
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	247-UNIMOD:510,251-UNIMOD:21	0.05	27.0	1	1	0
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	488-UNIMOD:510,490-UNIMOD:21,500-UNIMOD:35,505-UNIMOD:4	0.03	27.0	1	1	0
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	161-UNIMOD:510,163-UNIMOD:21,171-UNIMOD:510	0.06	26.0	2	1	0
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	70-UNIMOD:510,78-UNIMOD:21,80-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	208-UNIMOD:510,210-UNIMOD:21,207-UNIMOD:510	0.00	26.0	2	2	2
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	null	257-UNIMOD:510,260-UNIMOD:4,272-UNIMOD:21	0.04	26.0	1	1	0
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	193-UNIMOD:510	0.12	25.0	2	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	125-UNIMOD:510	0.01	25.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	301-UNIMOD:510,312-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	395-UNIMOD:510,398-UNIMOD:21,207-UNIMOD:510,212-UNIMOD:21	0.04	25.0	2	2	2
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	null	567-UNIMOD:510,567-UNIMOD:21,579-UNIMOD:35,584-UNIMOD:4	0.03	25.0	1	1	0
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	129-UNIMOD:510,130-UNIMOD:21,144-UNIMOD:510,145-UNIMOD:510,133-UNIMOD:21	0.07	24.0	3	2	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	74-UNIMOD:510,76-UNIMOD:35	0.11	24.0	1	1	1
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	47-UNIMOD:510,55-UNIMOD:21,58-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	23-UNIMOD:510,27-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|P09661|RU2A_HUMAN	U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	222-UNIMOD:510,226-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	542-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1153-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	144-UNIMOD:510,148-UNIMOD:21,149-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	179-UNIMOD:510,183-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	82-UNIMOD:510,85-UNIMOD:21,96-UNIMOD:510,47-UNIMOD:510	0.05	23.0	2	2	2
PRT	sp|P49419-4|AL7A1_HUMAN	Isoform 4 of Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	82-UNIMOD:510,84-UNIMOD:21,93-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	240-UNIMOD:510,242-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	608-UNIMOD:510,608-UNIMOD:21,622-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P34932-2|HSP74_HUMAN	Isoform 2 of Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	74-UNIMOD:510,76-UNIMOD:21,84-UNIMOD:510	0.08	22.0	1	1	1
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	71-UNIMOD:510,74-UNIMOD:21,77-UNIMOD:4,78-UNIMOD:21	0.13	22.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	77-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	519-UNIMOD:510,521-UNIMOD:21,532-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	220-UNIMOD:510,227-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	99-UNIMOD:510,109-UNIMOD:35	0.16	22.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	158-UNIMOD:510,189-UNIMOD:510	0.13	22.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	232-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	232-UNIMOD:510,233-UNIMOD:21,245-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	1083-UNIMOD:510,1085-UNIMOD:21,1099-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	158-UNIMOD:510,161-UNIMOD:21,163-UNIMOD:4	0.04	22.0	1	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	326-UNIMOD:510,327-UNIMOD:35,347-UNIMOD:21	0.07	22.0	1	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	134-UNIMOD:510,142-UNIMOD:510,145-UNIMOD:21,154-UNIMOD:510	0.07	22.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	42-UNIMOD:510,44-UNIMOD:21,47-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	130-UNIMOD:510,136-UNIMOD:21,142-UNIMOD:510	0.05	21.0	2	1	0
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	3-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:21,13-UNIMOD:510	0.08	21.0	1	1	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	151-UNIMOD:510,168-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	44-UNIMOD:510	0.12	21.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	11-UNIMOD:510,13-UNIMOD:21,19-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	143-UNIMOD:510,152-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	853-UNIMOD:510,855-UNIMOD:21,862-UNIMOD:35,863-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	33-UNIMOD:510,34-UNIMOD:510,36-UNIMOD:21,46-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1130-UNIMOD:510,1132-UNIMOD:21,1146-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|Q8N2K0-3|ABD12_HUMAN	Isoform 3 of Lysophosphatidylserine lipase ABHD12 OS=Homo sapiens OX=9606 GN=ABHD12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	5-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:35,21-UNIMOD:510	0.05	21.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	INSSGESGDESDEFLQSR	1	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2848	34.94266333333333	2	2069.8621	2069.8634	R	K	180	198
PSM	INSSGESGDESDEFLQSR	2	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	44.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=2848	34.94266333333333	2	2069.862626	2069.863906	R	K	180	198
PSM	DNLTLWTSDQQDDDGGEGNN	3	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=4219	49.266	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDTQGDEAEAGEGGEN	4	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=4170	48.701	2	2442.0519	2442.0519	R	-	223	246
PSM	DNLTLWTSDMQGDGEEQNK	5	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3969	46.464	2	2248.059	2248.0590	R	E	204	223
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	6	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=1676	25.169	3	2863.2161	2863.2161	K	M	445	470
PSM	DNLTLWTSDQQDDDGGEGNN	7	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=4134	48.239	2	2226.9361	2226.9361	R	-	228	248
PSM	QYTSPEEIDAQLQAEK	8	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=3488	41.41676666666667	2	1996.9654	1996.9662	R	Q	16	32
PSM	DNLTLWTSDMQGDGEEQNK	9	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3380	40.33	2	2264.0539	2264.0539	R	E	204	223
PSM	ETVSEESNVLCLSK	10	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,11-UNIMOD:4,13-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3197	38.198	2	1741.8482	1741.8482	R	S	581	595
PSM	GILAADESTGSIAK	11	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2482	31.71	2	1479.7858	1479.7858	K	R	29	43
PSM	TDLNPDNLQGGDDLDPNYVLSSR	12	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=4308	50.304	3	2631.1914	2631.1914	K	V	108	131
PSM	THSTSSSLGSGESPFSR	13	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2010	27.829043333333335	2	1836.810062	1836.810354	R	S	329	346
PSM	SRQPSGAGLCDISEGTVVPEDR	14	sp|Q5T5C0-3|STXB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=2979	36.155	3	2443.1263	2443.1263	K	C	688	710
PSM	SYELPDGQVITIGNER	15	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3951	46.25	2	1903.9141	1903.9141	K	F	239	255
PSM	VANPSGNLTETYVQDR	16	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2698	33.605	2	1876.878	1876.8780	R	G	1297	1313
PSM	DNLTLWTSDQQDDDGGEGNN	17	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510	ms_run[1]:scan=4410	51.59517666666667	2	2226.9351	2226.9356	R	-	228	248
PSM	DNLTLWTSENQGDEGDAGEGEN	18	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4019	47.068	2	2384.01	2384.0100	R	-	223	245
PSM	DNLTLWTSENQGDEGDAGEGEN	19	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4123	48.111	2	2384.01	2384.0100	R	-	223	245
PSM	RKVTAEADSSSPTGILATSESK	20	sp|A0MZ66-7|SHOT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,2-UNIMOD:510,4-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=1968	27.483	3	2416.2947	2416.2947	R	S	72	94
PSM	RNTTQNTGYSSGTQNANYPVR	21	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1301	22.295	3	2442.1137	2442.1137	R	A	933	954
PSM	SRINSSGESGDESDEFLQSR	22	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2386	30.906	3	2312.997	2312.9970	R	K	178	198
PSM	SVTEQGAELSNEER	23	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=1406	23.102	2	1581.7695	1581.7695	K	N	28	42
PSM	DNLTLWTSDTQGDEAEAGEGGEN	24	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:510	ms_run[1]:scan=4165	48.647315	3	2442.052105	2442.051903	R	-	223	246
PSM	DLADELALVDVIEDK	25	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=5381	66.464	2	1724.972	1724.9720	K	L	43	58
PSM	HASSSDDFSDFSDDSDFSPSEK	26	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=3461	41.109	3	2556.0126	2556.0126	R	G	129	151
PSM	STAGDTHLGGEDFDNR	27	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=1544	24.169	2	1724.7814	1724.7814	K	M	221	237
PSM	VPTANVSVVDLTCR	28	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3359	40.153	2	1643.8166	1643.8166	R	L	235	249
PSM	AAVPSGASTGIYEALELR	29	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4646	55.013	2	1917.9661	1917.9661	R	D	33	51
PSM	ADVLTTGAGNPVGDK	30	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2315	30.353	2	1561.8025	1561.8025	K	L	24	39
PSM	DNLTLWTSDQQDDDGGEGNN	31	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=4305	50.28	2	2226.9361	2226.9361	R	-	228	248
PSM	GAEAANVTGPGGVPVQGSK	32	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,18-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=1899	26.953	2	1842.9513	1842.9513	K	Y	119	138
PSM	DSSTSPGDYVLSVSENSR	33	sp|P46108-2|CRK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3895	45.589	2	2012.8788	2012.8788	R	V	39	57
PSM	DYEEVGVDSVEGEGEEEGEEY	34	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=3929	46.033	2	2381.9607	2381.9607	K	-	396	417
PSM	EVDEQMLNVQNK	35	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1515	23.949	2	1529.8032	1529.8032	K	N	325	337
PSM	FQSSHHPTDITSLDQYVER	36	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3261	38.991	3	2373.0851	2373.0851	R	M	512	531
PSM	QDENDDDDDWNPCK	37	sp|Q14974-2|IMB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,13-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=2102	28.53	2	1832.7432	1832.7432	K	A	188	202
PSM	RVSVCAETYNPDEEEEDTDPR	38	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2392	30.953	3	2624.0798	2624.0798	R	V	97	118
PSM	EGLELPEDEEEK	39	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2555	32.385	2	1483.7566	1483.7566	K	K	539	551
PSM	ISVYYNEATGGK	40	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2429	31.231	2	1448.7225	1448.7225	R	Y	47	59
PSM	LVQDVANNTNEEAGDGTTTATVLAR	41	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=2642	33.11	3	2593.3044	2593.3044	K	S	97	122
PSM	NVSSFPDDATSPLQENR	42	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3374	40.283	2	1989.8893	1989.8893	R	N	52	69
PSM	QENCGAQQVPAGPGTSTPPSSPVR	43	sp|Q96G46-2|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=2100	28.515	3	2535.1637	2535.1637	R	T	257	281
PSM	TAFQEALDAAGDK	44	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2898	35.369	2	1403.7569	1403.7569	K	L	9	22
PSM	STAGDTHLGGEDFDNR	45	sp|P54652|HSP72_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510	ms_run[1]:scan=1534	24.09369333333333	3	1724.780296	1724.781423	K	M	224	240
PSM	TASGSSVTSLDGTR	46	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1682	25.217403333333333	2	1451.671634	1451.671735	R	S	328	342
PSM	IEDVTPIPSDSTR	47	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=2556	32.39168166666666	2	1542.7387	1542.7386	R	R	129	142
PSM	DNLTLWTSDSAGEECDAAEGAEN	48	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=4245	49.569	3	2488.0396	2488.0396	R	-	223	246
PSM	DNLTLWTSENQGDEGDAGEGEN	49	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=4217	49.249	2	2384.01	2384.0100	R	-	223	245
PSM	EIRESTGAQVQVAGDMLPNSTER	50	sp|Q15366-7|PCBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=2424	31.193	3	2617.2267	2617.2267	K	A	122	145
PSM	GGGGNFGPGPGSNFR	51	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2390	30.936	2	1490.6516	1490.6516	R	G	202	217
PSM	KYTELPHGAISEDQAVGPADIPCDSTGQTST	52	sp|Q9H773|DCTP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,23-UNIMOD:4	ms_run[2]:scan=3360	40.16	3	3392.5756	3392.5756	R	-	140	171
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	53	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,34-UNIMOD:510	ms_run[1]:scan=2018	27.88608	3	3433.5749	3433.5773	K	K	799	833
PSM	ATAGDTHLGGEDFDNR	54	sp|P48741|HSP77_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=1573	24.395	3	1708.7865	1708.7865	K	L	223	239
PSM	ESTGAQVQVAGDMLPNSTER	55	sp|Q15366-7|PCBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=2450	31.423	3	2218.999	2218.9990	R	A	125	145
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	56	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,27-UNIMOD:35,34-UNIMOD:510	ms_run[2]:scan=4062	47.455	3	3840.56	3840.5600	K	A	469	503
PSM	GADFLVTEVENGGSLGSK	57	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,14-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4221	49.281	2	1926.9612	1926.9612	K	K	189	207
PSM	RFASGGCDNLIK	58	sp|P55735-2|SEC13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=2029	27.97	2	1484.7483	1484.7483	K	L	167	179
PSM	TASGSSVTSLDGTR	59	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1682	25.217	2	1451.6717	1451.6717	R	S	247	261
PSM	YRTTSSANNPNLMYQDECDR	60	sp|Q92841-1|DDX17_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:35,18-UNIMOD:4	ms_run[2]:scan=1600	24.592	3	2564.0521	2564.0521	R	R	488	508
PSM	RNTTQNTGYSSGTQNANYPVR	61	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=1301	22.295121666666667	3	2442.1144	2442.1132	R	A	933	954
PSM	GILAADESTGSIAK	62	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2482	31.70996666666667	2	1479.785834	1479.785825	K	R	29	43
PSM	SRINSSGESGDESDEFLQSR	63	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=2386	30.906218333333335	3	2312.996796	2312.997045	R	K	178	198
PSM	DNLTLWTSDQQDDDGGEGNN	64	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4137	48.276	3	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDSAGEECDAAEGAEN	65	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=4246	49.577	2	2488.0396	2488.0396	R	-	223	246
PSM	FQSSHHPTDITSLDQYVER	66	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=3505	41.558	3	2453.0514	2453.0514	R	M	512	531
PSM	IEDVTPIPSDSTR	67	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2556	32.392	2	1542.7391	1542.7391	R	R	129	142
PSM	NFSDNQLQEGK	68	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2036	28.025	2	1426.6766	1426.6766	R	N	161	172
PSM	NVDGVNYASITR	69	sp|Q9UBR2|CATZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2741	34.023	2	1421.6764	1421.6764	R	N	70	82
PSM	QQSEISAAVER	70	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1692	25.293	2	1330.6342	1330.6342	R	A	208	219
PSM	SYELPDGQVITIGNER	71	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4097	47.827	2	1823.9478	1823.9478	K	F	239	255
PSM	VIGSGCNLDSAR	72	sp|P00338-4|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1276	22.099	2	1281.656	1281.6560	R	F	100	112
PSM	YHTSQSGDEMTSLSEYVSR	73	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=2629	32.993	3	2305.9622	2305.9622	R	M	457	476
PSM	YHTSQSGDEMTSLSEYVSR	74	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=2629	32.992975	3	2305.962219	2305.962240	R	M	457	476
PSM	QENCGAQQVPAGPGTSTPPSSPVR	75	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,4-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=2100	28.51473	3	2535.163740	2535.163734	R	T	257	281
PSM	AGFAGDDAPR	76	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1063	20.36	2	1009.5041	1009.5041	K	A	19	29
PSM	DNLTLWTADNAGEEGGEAPQEPQS	77	sp|P31947-2|1433S_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=4187	48.875	2	2562.157	2562.1570	R	-	193	217
PSM	DNNQFASASLDR	78	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=2104	28.546	2	1370.6639	1370.6639	K	T	125	137
PSM	NNASTDYDLSDK	79	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1350	22.669	2	1409.6947	1409.6947	K	S	301	313
PSM	NNSGEEFDCAFR	80	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2519	32.055	2	1478.6309	1478.6309	R	L	355	367
PSM	RQQSEISAAVER	81	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1207	21.508	2	1486.7353	1486.7353	R	A	207	219
PSM	VQQTVQDLFGR	82	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3410	40.588	2	1403.7022	1403.7022	K	A	395	406
PSM	YRTTSSANNPNLMYQDECDR	83	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,13-UNIMOD:35,18-UNIMOD:4	ms_run[1]:scan=1600	24.592098333333333	3	2564.051689	2564.052135	R	R	567	587
PSM	ASGNYATVISHNPETK	84	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2044	28.086	3	1835.9091	1835.9091	R	K	129	145
PSM	EGMNIVEAMER	85	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:35	ms_run[2]:scan=2660	33.264	2	1327.6324	1327.6324	K	F	74	85
PSM	EQVANSAFVER	86	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1582	24.461	2	1282.673	1282.6730	K	V	492	503
PSM	GALQNIIPASTGAAK	87	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3542	41.935	2	1638.842	1638.8420	R	A	201	216
PSM	INVYYNEATGGK	88	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2423	31.186	2	1475.7334	1475.7334	R	Y	47	59
PSM	KYTELPHGAISEDQAVGPADIPCDSTGQTST	89	sp|Q9H773|DCTP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,23-UNIMOD:4	ms_run[1]:scan=3360	40.15997333333333	3	3392.573103	3392.575582	R	-	140	171
PSM	ADVLTTGAGNPVGDK	90	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2793	34.47	2	1641.7689	1641.7689	K	L	24	39
PSM	DNLTLWTSDQQDDDGGEGNN	91	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=4223	49.297	3	2226.9361	2226.9361	R	-	228	248
PSM	ELLLTGPGLEER	92	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3944	46.168	2	1439.7485	1439.7485	R	V	23	35
PSM	FASENDLPEWK	93	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3773	44.263	2	1482.7068	1482.7068	R	E	58	69
PSM	GLLQSGQIPGR	94	sp|P09661|RU2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2804	34.583	2	1238.6597	1238.6597	K	E	222	233
PSM	HGSYEDAVHSGALND	95	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1613	24.688	2	1604.7279	1604.7279	K	-	542	557
PSM	IAQLEEELEEEQGNTELINDR	96	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=4009	46.962	3	2505.2295	2505.2295	R	L	1153	1174
PSM	LFNLSKEDDVR	97	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:510	ms_run[2]:scan=2801	34.561	2	1482.7756	1482.7756	K	Q	144	155
PSM	LHQLSGSDQLESTAHSR	98	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1592	24.532	3	1978.9322	1978.9322	K	I	179	196
PSM	NQLTSNPENTVFDAK	99	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3298	39.391	2	1824.8931	1824.8931	K	R	82	97
PSM	QASVADYEETVK	100	sp|P49419-4|AL7A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2267	29.978	2	1486.7229	1486.7229	R	K	82	94
PSM	RVSHQGYSTEAEFEEPR	101	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1730	25.617	3	2134.9533	2134.9533	R	V	240	257
PSM	STQGVTLTDLQEAEK	102	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3394	40.454	2	1766.8976	1766.8976	R	T	608	623
PSM	VPTANVSVVDLTCR	103	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3697	43.474	2	1723.783	1723.7830	R	L	235	249
PSM	DNLTLWTSDTQGDEAEAGEGGEN	104	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510	ms_run[1]:scan=4257	49.70547833333333	3	2442.0516	2442.0514	R	-	223	246
PSM	FNTANDDNVTQVR	105	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1836	26.473779999999998	2	1607.7212	1606.7192	R	A	432	445
PSM	AFSDPFVEAEK	106	sp|P34932-2|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3860	45.22	2	1386.6745	1386.6745	R	S	74	85
PSM	ARLTEGCSFR	107	sp|P42677|RS27_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=1841	26.512	2	1389.5726	1389.5726	K	R	71	81
PSM	DLIHDQDEDEEEEEGQR	108	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1808	26.26	3	2118.9038	2118.9038	R	F	77	94
PSM	DNLTLWTADNAGEEGGEAPQEPQS	109	sp|P31947-2|1433S_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4176	48.762	3	2562.157	2562.1570	R	-	193	217
PSM	DVTPPPETEVVLIK	110	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4011	46.977	2	1683.9372	1683.9372	K	N	519	533
PSM	ESLKEEDESDDDNM	111	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=908	18.984	2	1738.7364	1738.7364	K	-	235	249
PSM	GALQNIIPASTGAAK	112	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3167	37.927	2	1558.8756	1558.8756	R	A	201	216
PSM	HWILPQDYDHAQAEAR	113	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2742	34.03	3	2062.9475	2062.9475	R	H	220	236
PSM	KEESEESDDDMGFGLFD	114	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=3823	44.867	2	2032.8732	2032.8732	K	-	99	116
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	115	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,32-UNIMOD:510	ms_run[2]:scan=2938	35.801	3	3790.3213	3790.3213	K	A	158	190
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	116	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=1667	25.101	3	2318.9224	2318.9224	R	S	314	339
PSM	RLSQSDEDVIR	117	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1599	24.585	2	1430.6979	1430.6979	K	L	119	130
PSM	SNVSDAVAQSTR	118	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1241	21.773	2	1267.6581	1267.6581	K	I	232	244
PSM	SSGPYGGGGQYFAK	119	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2571	32.521	2	1522.713	1522.7130	R	P	232	246
PSM	TASETRSEGSEYEEIPK	120	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1861	26.663	3	2059.9623	2059.9623	R	R	1083	1100
PSM	VIGSGCNLDSAR	121	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1792	26.138405	2	1361.6216	1361.6218	R	F	158	170
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	122	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,2-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1667	25.100898333333333	3	2318.9222	2318.9219	R	S	326	351
PSM	NGSLDSPGKQDTEEDEEEDEK	123	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,9-UNIMOD:510,12-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=1147	21.017025	3	2532.1117	2532.1120	K	D	134	155
PSM	ASGNYATVISHNPETKK	124	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510,17-UNIMOD:510	ms_run[2]:scan=1624	24.773	3	1998.0672	1998.0672	R	T	129	146
PSM	DAGQISGLNVLR	125	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3887	45.512	2	1355.7022	1355.7022	K	V	207	219
PSM	DFTPVCTTELGR	126	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=3367	40.214	2	1508.6795	1508.6795	R	A	42	54
PSM	EFHLNESGDPSSK	127	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1876	26.776	3	1593.7349	1593.7349	K	S	130	143
PSM	EFHLNESGDPSSK	128	sp|Q01105-3|SET_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1886	26.85	2	1593.7349	1593.7349	K	S	130	143
PSM	FNPFVTSDRSK	129	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3334	39.852	2	1524.7051	1524.7051	K	N	3	14
PSM	GAEAANVTGPDGVPVEGSRYAADR	130	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=2422	31.178	3	2472.1495	2472.1495	K	R	151	175
PSM	GEPNVSYICSR	131	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2119	28.706	2	1394.6114	1394.6114	R	Y	210	221
PSM	GVVDSDDLPLNVSR	132	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3234	38.679	2	1518.8102	1518.8102	K	E	435	449
PSM	HGYIGEFEIIDDHR	133	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3180	38.056	3	1733.8586	1733.8586	K	A	44	58
PSM	MESALDQLK	134	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2792	34.464	2	1181.604	1181.6040	R	Q	11	20
PSM	NFSDNQLQEGK	135	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1588	24.505	2	1346.7103	1346.7103	R	N	161	172
PSM	NGRVEIIANDQGNR	136	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1119	20.794	3	1588.8494	1588.8494	K	I	47	61
PSM	NLQYYDISAK	137	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2701	33.628	2	1281.7241	1281.7241	K	S	143	153
PSM	NSSGPQSGWMK	138	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=1342	22.607	2	1341.6061	1341.6061	R	Q	853	864
PSM	RKASGPPVSELITK	139	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:510,4-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1942	27.289	3	1664.0123	1664.0123	K	A	33	47
PSM	VASETHSEGSEYEELPK	140	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1958	27.41	3	2038.9409	2038.9409	R	R	1130	1147
PSM	VTLTSEEEAR	141	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1296	22.257	2	1167.6195	1167.6195	K	L	248	258
PSM	DNLTLWTSDQQDDDGGEGNN	142	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=4035	47.23411	2	2226.933654	2226.936145	R	-	228	248
PSM	TEPVALEPRCAADAGMKR	143	sp|Q8N2K0-3|ABD12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:4,16-UNIMOD:35,17-UNIMOD:510	ms_run[1]:scan=3883	45.48067666666667	2	2137.0522	2135.0532	R	A	5	23
PSM	NVDGVNYASITR	144	sp|Q9UBR2|CATZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=2741	34.02260166666667	2	1421.676099	1421.676427	R	N	70	82
PSM	ASGNYATVISHNPETK	145	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=2044	28.085843333333337	3	1835.908554	1835.909128	R	K	129	145