MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100630_020SRPK1.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100630_020SRPK1.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	42.0	null	228-UNIMOD:510,29-UNIMOD:510	0.15	42.0	4	2	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	180-UNIMOD:510,186-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	57-UNIMOD:510,63-UNIMOD:21,73-UNIMOD:510,60-UNIMOD:21	0.10	41.0	3	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null	39-UNIMOD:510,41-UNIMOD:21,40-UNIMOD:21,43-UNIMOD:21	0.06	41.0	3	1	0
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	75-UNIMOD:510,84-UNIMOD:35	0.13	39.0	2	1	0
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	39.0	null	108-UNIMOD:510,113-UNIMOD:21	0.10	39.0	1	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	39-UNIMOD:510,42-UNIMOD:21	0.09	38.0	1	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	292-UNIMOD:510,306-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,492-UNIMOD:510,613-UNIMOD:510,617-UNIMOD:35,620-UNIMOD:35,621-UNIMOD:35,623-UNIMOD:510,187-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510	0.12	37.0	7	7	7
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	120-UNIMOD:510,138-UNIMOD:21,145-UNIMOD:510	0.11	35.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	431-UNIMOD:510	0.04	34.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	228-UNIMOD:510	0.08	33.0	2	1	0
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,446-UNIMOD:510,466-UNIMOD:35	0.03	33.0	2	2	2
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	323-UNIMOD:510	0.06	32.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	396-UNIMOD:510	0.05	31.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	73-UNIMOD:510,83-UNIMOD:35,79-UNIMOD:21	0.20	31.0	4	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	239-UNIMOD:510,19-UNIMOD:510	0.07	31.0	2	2	2
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	223-UNIMOD:510,237-UNIMOD:4	0.10	30.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	223-UNIMOD:510	0.09	30.0	2	1	0
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	14-UNIMOD:510	0.06	30.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	28-UNIMOD:510,223-UNIMOD:510	0.16	30.0	3	2	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	30.0	1	1	1
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	193-UNIMOD:510	0.12	29.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	418-UNIMOD:510,435-UNIMOD:21,441-UNIMOD:510,420-UNIMOD:35	0.05	28.0	2	1	0
PRT	sp|Q9UJ70|NAGK_HUMAN	N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	70-UNIMOD:510,76-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510,482-UNIMOD:510,493-UNIMOD:510	0.05	28.0	2	2	2
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	1928-UNIMOD:510,1942-UNIMOD:21,2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510,1948-UNIMOD:21	0.01	28.0	3	2	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	27.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	27.0	1	1	1
PRT	sp|P18858-2|DNLI1_HUMAN	Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	41-UNIMOD:510,51-UNIMOD:21,54-UNIMOD:510	0.02	27.0	1	1	0
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510,595-UNIMOD:21,598-UNIMOD:510	0.02	26.0	2	2	2
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510,82-UNIMOD:510,92-UNIMOD:510	0.15	26.0	2	2	2
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	221-UNIMOD:510,37-UNIMOD:510	0.06	26.0	2	2	2
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	494-UNIMOD:510,498-UNIMOD:21,500-UNIMOD:21,496-UNIMOD:510	0.02	26.0	2	2	2
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	204-UNIMOD:510,222-UNIMOD:510,223-UNIMOD:510,213-UNIMOD:35	0.13	25.0	3	2	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	500-UNIMOD:510,251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,270-UNIMOD:510	0.05	25.0	2	2	2
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	542-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	495-UNIMOD:510,497-UNIMOD:510,507-UNIMOD:4,514-UNIMOD:21,517-UNIMOD:510	0.05	25.0	2	1	0
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	161-UNIMOD:510,171-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	689-UNIMOD:510,697-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	41-UNIMOD:510,49-UNIMOD:21,54-UNIMOD:510	0.02	25.0	1	1	0
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	74-UNIMOD:510,95-UNIMOD:510,101-UNIMOD:4,76-UNIMOD:35	0.23	24.0	3	2	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	469-UNIMOD:510,502-UNIMOD:510	0.07	24.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	140-UNIMOD:510,152-UNIMOD:510	0.09	24.0	1	1	1
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	142-UNIMOD:510,149-UNIMOD:21,154-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	26-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	96-UNIMOD:510	0.09	23.0	1	1	1
PRT	sp|Q9BQA1-2|MEP50_HUMAN	Isoform 2 of Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	116-UNIMOD:510,122-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	25-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	466-UNIMOD:510,475-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	414-UNIMOD:510,418-UNIMOD:21,416-UNIMOD:510,420-UNIMOD:21	0.03	22.0	2	2	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	295-UNIMOD:510,305-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,37-UNIMOD:21	0.04	22.0	2	1	0
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	273-UNIMOD:510,279-UNIMOD:21,281-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	591-UNIMOD:510,599-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	69-UNIMOD:510,74-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4	0.20	21.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	30-UNIMOD:510,38-UNIMOD:21,41-UNIMOD:510	0.09	21.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	20-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q9UQ35-2|SRRM2_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	2272-UNIMOD:510,2274-UNIMOD:21,2276-UNIMOD:21	0.00	21.0	2	1	0
PRT	sp|O43852-2|CALU_HUMAN	Isoform 2 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	60-UNIMOD:510,65-UNIMOD:21,70-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	385-UNIMOD:510,398-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	114-UNIMOD:510	0.13	21.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	225-UNIMOD:510,227-UNIMOD:21,242-UNIMOD:510,226-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	104-UNIMOD:510,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:510	0.12	20.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	8-UNIMOD:510	0.07	20.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	334-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	305-UNIMOD:510,305-UNIMOD:21,307-UNIMOD:21,318-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q6UN15|FIP1_HUMAN	Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	490-UNIMOD:510,492-UNIMOD:21	0.03	20.0	1	1	0
PRT	sp|Q7Z7L1|SLN11_HUMAN	Schlafen family member 11 OS=Homo sapiens OX=9606 GN=SLFN11 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	49-UNIMOD:510,51-UNIMOD:4,56-UNIMOD:21,63-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	151-UNIMOD:510,160-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	215-UNIMOD:510,221-UNIMOD:21,227-UNIMOD:510	0.06	19.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	125-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	173-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	91-UNIMOD:510,94-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	186-UNIMOD:510	0.06	19.0	1	1	1
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	172-UNIMOD:510,177-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	64-UNIMOD:510,68-UNIMOD:4,75-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.18	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:510	ms_run[1]:scan=4054	47.997539999999994	2	2226.9323	2226.9356	R	-	228	248
PSM	INSSGESGDESDEFLQSR	2	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2878	35.534	2	2069.8639	2069.8639	R	K	180	198
PSM	SLDSDESEDEEDDYQQK	3	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,7-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1792	26.318	2	2178.8638	2178.8638	K	R	57	74
PSM	DSSTSPGDYVLSVSENSR	4	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3918	46.30687666666667	2	2012.8760	2012.8783	R	V	39	57
PSM	DWEDDSDEDMSNFDR	5	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2747	34.313	2	1924.7117	1924.7117	K	F	75	90
PSM	DWEDDSDEDMSNFDR	6	sp|Q15185|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=3798	44.844545000000004	2	1989.6842	1988.6822	K	F	108	123
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	7	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=2938	35.988	3	3112.2782	3112.2782	K	L	595	622
PSM	DSSTSPGDYVLSVSENSR	8	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3918	46.307	2	2012.8788	2012.8788	R	V	39	57
PSM	NPDDITQEEYGEFYK	9	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3479	41.307	2	1914.916	1914.9160	R	S	292	307
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	10	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,19-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3576	42.378	3	3090.3451	3090.3451	K	E	120	146
PSM	DYEEVGADSADGEDEGEEY	11	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=3157	38.055	2	2111.8027	2111.8027	K	-	431	450
PSM	DNLTLWTSDQQDEEAGEGN	12	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4111	48.567	2	2154.9402	2154.9402	R	-	228	247
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	13	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2164	29.253	3	2847.2212	2847.2212	K	M	445	470
PSM	TAENATSGETLEENEAGD	14	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=1688	25.497	2	1870.8128	1870.8128	K	-	323	341
PSM	DWEDDSDEDMSNFDR	15	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=3563	42.263	2	1908.7168	1908.7168	K	F	75	90
PSM	DYEEVGVDSVEGEGEEEGEEY	16	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=3935	46.496	3	2381.9607	2381.9607	K	-	396	417
PSM	KEESEESDDDMGFGLFD	17	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=3863	45.586	2	2032.8732	2032.8732	K	-	73	90
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	18	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=2047	28.297	3	2701.0581	2701.0581	K	M	446	470
PSM	SYELPDGQVITIGNER	19	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=4145	48.955	2	1823.9478	1823.9478	K	F	239	255
PSM	DNLTLWTSDSAGEECDAAEGAEN	20	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=4268	50.413	3	2488.0396	2488.0396	R	-	223	246
PSM	DNLTLWTSENQGDEGDAGEGEN	21	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=4044	47.894	3	2384.01	2384.0100	R	-	223	245
PSM	IQALQQQADEAEDR	22	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=1766	26.107	2	1647.8276	1647.8276	K	A	14	28
PSM	SVTEQGAELSNEER	23	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=1406	23.286	2	1581.7695	1581.7695	K	N	28	42
PSM	TAFQEALDAAGDK	24	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2955	36.119	2	1403.7569	1403.7569	K	L	9	22
PSM	DNLTLWTADNAGEEGGEAPQEPQS	25	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=4220	49.814	3	2562.157	2562.1570	R	-	193	217
PSM	DNLTLWTSDQQDDDGGEGNN	26	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=4152	49.01	2	2226.9361	2226.9361	R	-	228	248
PSM	EGLELPEDEEEK	27	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2604	33.007	2	1483.7566	1483.7566	K	K	539	551
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	28	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2380	31.08	3	2810.1902	2810.1902	R	E	418	442
PSM	SLGLSLSGGDQEDAGR	29	sp|Q9UJ70|NAGK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3394	40.494	2	1674.7674	1674.7674	R	I	70	86
PSM	TVIIEQSWGSPK	30	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3453	41.08	2	1491.8011	1491.8011	R	V	61	73
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	31	sp|O95714|HERC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[1]:scan=3017	36.646946666666665	3	3088.3045	3088.3089	K	N	1928	1956
PSM	AFLAELEQNSPK	32	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3623	42.877	2	1493.7803	1493.7803	K	I	2424	2436
PSM	DNLTLWTSDQQDDDGGEGNN	33	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4155	49.034	3	2226.9361	2226.9361	R	-	228	248
PSM	DVIELTDDSFDK	34	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3924	46.382	2	1463.7668	1463.7668	K	N	158	170
PSM	EWNGVVSESDSPVK	35	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2789	34.684	2	1679.808	1679.8080	K	R	41	55
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	36	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=1952	27.56	3	2826.1852	2826.1852	R	E	418	442
PSM	QENCGAQQVPAGPGTSTPPSSPVR	37	sp|Q96G46|DUS3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=2150	29.147145000000002	3	2535.1591	2535.1632	R	T	257	281
PSM	ETVSEESNVLCLSK	38	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3004	36.548	2	1661.8818	1661.8818	R	S	581	595
PSM	ETVSEESNVLCLSKSPNK	39	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510,15-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2832	35.129	3	2202.134	2202.1340	R	H	581	599
PSM	HELQANCYEEVK	40	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1359	22.928	2	1586.8035	1586.8035	K	D	133	145
PSM	STAGDTHLGGEDFDNR	41	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1587	24.717	2	1724.7814	1724.7814	K	M	221	237
PSM	TPEELDDSDFETEDFDVR	42	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4261	50.333	2	2271.9157	2271.9157	R	S	264	282
PSM	YRQRSPSPAPAPAPAAAAGPPTR	43	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=1337	22.761	3	2480.1939	2480.1939	R	K	494	517
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	44	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=4314	51.054203333333334	3	2996.3842	2995.3852	R	G	2913	2938
PSM	DNLTLWTSDMQGDGEEQNK	45	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3997	47.253	3	2248.059	2248.0590	R	E	204	223
PSM	DNLTLWTSDQQDEEAGEGN	46	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=4117	48.668	3	2154.9402	2154.9402	R	-	228	247
PSM	DQVANSAFVER	47	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1894	27.127	2	1268.6573	1268.6573	K	L	500	511
PSM	ELISNASDALDK	48	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2521	32.293	2	1342.7616	1342.7616	R	I	42	54
PSM	ESLKEEDESDDDNM	49	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=947	18.927	2	1738.7364	1738.7364	K	-	235	249
PSM	EVDEQMLNVQNK	50	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1537	24.33	2	1529.8032	1529.8032	K	N	325	337
PSM	HGSYEDAVHSGALND	51	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1658	25.276	2	1604.7279	1604.7279	K	-	542	557
PSM	HIKEEPLSEEEPCTSTAIASPEK	52	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:510,13-UNIMOD:4,20-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=2372	31.02	3	2763.3774	2763.3774	K	K	495	518
PSM	NFSDNQLQEGK	53	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1595	24.778	2	1346.7103	1346.7103	R	N	161	172
PSM	SLPTTVPESPNYR	54	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2750	34.337	2	1573.7602	1573.7602	R	N	689	702
PSM	EWNGVVSESDSPVK	55	sp|P18858|DNLI1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2789	34.684425	2	1679.8060	1679.8075	K	R	41	55
PSM	EALQDVEDENQ	56	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2015	28.045	2	1322.605	1322.6050	K	-	223	234
PSM	EGMNIVEAMER	57	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=3578	42.392	2	1311.6375	1311.6375	K	F	74	85
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	58	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,34-UNIMOD:510	ms_run[2]:scan=4300	50.885	4	3824.5651	3824.5651	K	A	469	503
PSM	KEESEESDDDMGFGLFD	59	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4774	58.261	2	2096.8446	2096.8446	K	-	73	90
PSM	LAPDYDALDVANK	60	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3259	39.077	2	1471.8195	1471.8195	R	I	140	153
PSM	NNAYLAQSPQLYK	61	sp|P14868-2|SYDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2941	36.011	2	1656.8549	1656.8549	K	Q	142	155
PSM	VEIIANDQGNR	62	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510	ms_run[1]:scan=1438	23.527694999999998	2	1261.6825	1261.6834	K	T	26	37
PSM	DGNGYISAAELR	63	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2866	35.444	2	1298.6679	1298.6679	K	H	96	108
PSM	DSVFLSCSEDNR	64	sp|Q9BQA1-2|MEP50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2542	32.454	2	1461.6618	1461.6618	K	I	116	128
PSM	EQFLDGDGWTSR	65	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=3369	40.172	2	1443.6843	1443.6843	K	W	25	37
PSM	EQVANSAFVER	66	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1617	24.969	2	1282.673	1282.6730	K	V	492	503
PSM	KEESEESDDDMGFGLFD	67	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4309	51.014	2	2112.8395	2112.8395	K	-	73	90
PSM	RLSQSDEDVIR	68	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1629	25.058	2	1430.6979	1430.6979	K	L	119	130
PSM	RVSVCAETYNPDEEEEDTDPR	69	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2412	31.35	3	2624.0798	2624.0798	R	V	97	118
PSM	TTPSYVAFTDTER	70	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2954	36.112	2	1520.7571	1520.7571	R	L	37	50
PSM	AEEDEILNRSPR	71	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1692	25.527	2	1541.7299	1541.7299	K	N	466	478
PSM	DNLTLWTSDMQGDGEEQNK	72	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3442	40.993	3	2264.0539	2264.0539	R	E	204	223
PSM	DNLTLWTSDTQGDEAEAGEGGEN	73	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4190	49.482	3	2442.0519	2442.0519	R	-	223	246
PSM	ERDHSPTPSVFNSDEER	74	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1606	24.875	3	2114.9119	2114.9119	R	Y	414	431
PSM	ESEDKPEIEDVGSDEEEEKK	75	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510,20-UNIMOD:510	ms_run[2]:scan=1592	24.755	4	2456.2603	2456.2603	K	D	251	271
PSM	GDLGIEIPAEK	76	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3201	38.442	2	1208.7289	1208.7289	R	V	295	306
PSM	GILAADESTGSIAK	77	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2557	32.58	2	1479.7858	1479.7858	K	R	29	43
PSM	KITIADCGQLE	78	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2471	31.812	2	1314.749	1314.7490	K	-	95	106
PSM	YALYDATYETK	79	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2768	34.47	2	1404.7449	1404.7449	R	E	82	93
PSM	GEPNVSYICSR	80	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=2148	29.13163833333333	2	1394.6098	1394.6109	R	Y	273	284
PSM	SLDSDESEDEEDDYQQK	81	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=1789	26.294506666666663	3	2178.8605	2178.8633	K	R	57	74
PSM	NNSGEEFDCAFR	82	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[1]:scan=2557	32.580268333333336	2	1478.6298	1478.6303	R	L	591	603
PSM	GILAADESTGSIAK	83	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2557	32.580268333333336	2	1479.7851	1479.7853	K	R	29	43
PSM	AFGESSTESDEEEEEGCGHTHCVR	84	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=1432	23.481	3	2852.0751	2852.0751	R	G	69	93
PSM	EGMNIVEAMER	85	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:35	ms_run[2]:scan=2681	33.684	2	1327.6324	1327.6324	K	F	74	85
PSM	ESVPEFPLSPPK	86	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3939	46.527	2	1473.7793	1473.7793	K	K	30	42
PSM	EVYELLDSPGK	87	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3398	40.525	2	1396.7163	1396.7163	K	V	20	31
PSM	NVTELNEPLSNEER	88	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2430	31.501	2	1676.843	1676.8430	K	N	29	43
PSM	QRSPSPAPAPAPAAAAGPPTR	89	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=1451	23.624	3	2161.0295	2161.0295	R	K	496	517
PSM	SLSYSPVER	90	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2250	29.994	2	1150.5484	1150.5484	R	R	2272	2281
PSM	TFDQLTPEESK	91	sp|O43852-2|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2306	30.407	2	1441.7014	1441.7014	K	E	60	71
PSM	VPSPLEGSEGDGDTD	92	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2688	33.736	2	1587.6402	1587.6402	K	-	385	400
PSM	YFQINQDEEEEEDED	93	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2924	35.88	2	1964.786	1964.7860	R	-	114	129
PSM	DSSTSPGDYVLSVSENSR	94	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3913	46.255873333333334	3	2012.8778	2012.8783	R	V	39	57
PSM	STTPPPAEPVSLPQEPPKPR	95	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2615	33.116234999999996	3	2272.2123	2272.2136	K	V	225	245
PSM	AGFAGDDAPR	96	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1092	20.497	2	1009.5041	1009.5041	K	A	19	29
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	97	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=3203	38.456	4	3527.556	3527.5560	K	L	104	135
PSM	DNLTLWTSENQGDEGDAGEGEN	98	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4036	47.832	2	2384.01	2384.0100	R	-	223	245
PSM	DNSTMGYMMAK	99	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=823	17.172	2	1363.6094	1363.6094	R	K	613	624
PSM	DVNQQEFVR	100	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1871	26.954	2	1167.6097	1167.6097	K	A	8	17
PSM	KEESEESDDDMGFGLFD	101	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4435	52.697	2	2016.8783	2016.8783	K	-	73	90
PSM	NAGVEGSLIVEK	102	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2341	30.706	2	1282.7769	1282.7769	K	I	482	494
PSM	NDLAVVDVR	103	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2439	31.571	2	1033.598	1033.5980	K	I	334	343
PSM	SLDSDESEDEEDDYQQK	104	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1789	26.295	3	2178.8638	2178.8638	K	R	57	74
PSM	SRSPESQVIGENTKQP	105	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1961	27.63	3	1983.934	1983.9340	R	-	305	321
PSM	DHSPTPSVFNSDEER	106	sp|Q6UN15|FIP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2122	28.939881666666665	3	1829.7661	1829.7676	R	Y	490	505
PSM	AACALLNSGGGVIRMAK	107	sp|Q7Z7L1|SLN11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:4,8-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=4164	49.13073833333333	2	1817.9144	1817.9100	R	K	49	66
PSM	AGDLLEDSPK	108	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=1814	26.481	2	1111.6397	1111.6397	R	R	151	161
PSM	DEILPTTPISEQK	109	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3260	39.084	2	1617.8539	1617.8539	K	G	215	228
PSM	DHSPTPSVFNSDEER	110	sp|Q6UN15-3|FIP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2122	28.94	3	1829.7682	1829.7682	R	Y	416	431
PSM	DNLTLWTSDTQGDEAEAGEGGEN	111	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=4189	49.475	2	2442.0519	2442.0519	R	-	223	246
PSM	DNNQFASASLDR	112	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2123	28.947	2	1370.6639	1370.6639	K	T	125	137
PSM	DYTYEELLNR	113	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=3835	45.256	2	1348.6723	1348.6723	R	V	173	183
PSM	EDQTEYLEER	114	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1757	26.039	2	1344.6258	1344.6258	K	R	187	197
PSM	GDFCIQVGR	115	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=2657	33.49	2	1084.5548	1084.5548	R	N	91	100
PSM	GDRSEDFGVNEDLADSDAR	116	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2624	33.211	3	2100.9408	2100.9408	K	A	186	205
PSM	HIKEEPLSEEEPCTSTAIASPEK	117	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:510,13-UNIMOD:4,20-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=2363	30.954	4	2763.3774	2763.3774	K	K	495	518
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	118	sp|O95714|HERC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=3017	36.647	3	3088.3094	3088.3094	K	N	1928	1956
PSM	LTWHSCPEDEAQ	119	sp|Q13185|CBX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=2200	29.526	2	1505.6669	1505.6669	R	-	172	184
PSM	NQDECVIALHDCNGDVNR	120	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=2109	28.813	3	2161.9693	2161.9693	K	A	64	82
PSM	SIYYITGESK	121	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2518	32.271	2	1227.7023	1227.7023	K	E	482	492
PSM	SLSYSPVER	122	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2592	32.874	2	1230.5147	1230.5147	R	R	2272	2281
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	123	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2799	34.774	3	3223.2305	3223.2305	K	-	122	148
PSM	STTPPPAEPVSLPQEPPKPR	124	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2615	33.116	3	2272.2141	2272.2141	K	V	225	245
PSM	DSSTSPGDYVLSVSENSR	125	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3913	46.255873333333334	3	2012.878294	2012.878828	R	V	39	57