MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100723_033SIK.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100723_033SIK.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	51.0	null	333-UNIMOD:510,353-UNIMOD:21	0.07	51.0	2	2	2
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	null	228-UNIMOD:510	0.09	45.0	2	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	180-UNIMOD:510,182-UNIMOD:21,186-UNIMOD:21,183-UNIMOD:21,131-UNIMOD:510,137-UNIMOD:21,145-UNIMOD:510,135-UNIMOD:21	0.03	45.0	5	2	0
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	null	306-UNIMOD:510,312-UNIMOD:21,315-UNIMOD:35,175-UNIMOD:510,177-UNIMOD:21,181-UNIMOD:35	0.14	44.0	5	2	0
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	null	321-UNIMOD:510,323-UNIMOD:21,318-UNIMOD:510	0.03	44.0	2	2	2
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	198-UNIMOD:510,202-UNIMOD:21	0.05	43.0	1	1	1
PRT	sp|Q27J81-2|INF2_HUMAN	Isoform 2 of Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	1192-UNIMOD:510,1206-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	172-UNIMOD:510,187-UNIMOD:21	0.09	40.0	1	1	1
PRT	sp|Q15021|CND1_HUMAN	Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	1325-UNIMOD:510,1333-UNIMOD:21	0.01	40.0	1	1	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	158-UNIMOD:510,160-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q53EL6-2|PDCD4_HUMAN	Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	27-UNIMOD:510,35-UNIMOD:21,38-UNIMOD:21	0.04	38.0	2	1	0
PRT	sp|P30622-2|CLIP1_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	191-UNIMOD:510,195-UNIMOD:21,206-UNIMOD:510	0.01	38.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	207-UNIMOD:510	0.14	38.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|Q9Y4E1-5|WAC2C_HUMAN	Isoform 5 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	452-UNIMOD:510,454-UNIMOD:21,468-UNIMOD:510	0.01	37.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	795-UNIMOD:510,800-UNIMOD:510,816-UNIMOD:21,824-UNIMOD:510,734-UNIMOD:510,739-UNIMOD:21,744-UNIMOD:4,871-UNIMOD:510,885-UNIMOD:21,886-UNIMOD:21,329-UNIMOD:510,335-UNIMOD:21,336-UNIMOD:4,337-UNIMOD:4	0.06	37.0	5	4	3
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	383-UNIMOD:510,389-UNIMOD:21,398-UNIMOD:510	0.01	36.0	1	1	1
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	174-UNIMOD:510,178-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	230-UNIMOD:510,231-UNIMOD:21,232-UNIMOD:21,358-UNIMOD:510,362-UNIMOD:21	0.07	36.0	3	2	1
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	610-UNIMOD:510,612-UNIMOD:21,625-UNIMOD:510	0.02	36.0	1	1	0
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	22-UNIMOD:510,37-UNIMOD:21	0.09	36.0	1	1	1
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	53-UNIMOD:510,63-UNIMOD:21,68-UNIMOD:510	0.04	35.0	1	1	1
PRT	sp|Q9P2N2-2|RHG28_HUMAN	Isoform 2 of Rho GTPase-activating protein 28 OS=Homo sapiens OX=9606 GN=ARHGAP28	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	15-UNIMOD:510,17-UNIMOD:21	0.03	35.0	1	1	0
PRT	sp|Q15185-4|TEBP_HUMAN	Isoform 4 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	108-UNIMOD:510	0.12	34.0	1	1	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	122-UNIMOD:510,126-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P04075-2|ALDOA_HUMAN	Isoform 2 of Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	83-UNIMOD:510,93-UNIMOD:21,96-UNIMOD:510,90-UNIMOD:21,228-UNIMOD:510,230-UNIMOD:21,232-UNIMOD:4,254-UNIMOD:510,91-UNIMOD:21	0.10	34.0	4	2	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	120-UNIMOD:510,123-UNIMOD:21,145-UNIMOD:510	0.11	34.0	1	1	1
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	656-UNIMOD:510,658-UNIMOD:21,669-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q96PC5-6|MIA2_HUMAN	Isoform 5 of Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	99-UNIMOD:510,101-UNIMOD:21,109-UNIMOD:4,112-UNIMOD:510	0.02	34.0	1	1	0
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	446-UNIMOD:510,448-UNIMOD:21,462-UNIMOD:510	0.02	34.0	1	1	0
PRT	sp|P17544-5|ATF7_HUMAN	Isoform 5 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	42-UNIMOD:510,44-UNIMOD:21	0.14	34.0	1	1	1
PRT	sp|Q6PID6|TTC33_HUMAN	Tetratricopeptide repeat protein 33 OS=Homo sapiens OX=9606 GN=TTC33 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	null	17-UNIMOD:510,19-UNIMOD:21,30-UNIMOD:510	0.06	34.0	1	1	1
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	null	331-UNIMOD:510,343-UNIMOD:21,349-UNIMOD:510	0.04	34.0	1	1	1
PRT	sp|Q9Y664|KPTN_HUMAN	KICSTOR complex protein kaptin OS=Homo sapiens OX=9606 GN=KPTN PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	22-UNIMOD:510,24-UNIMOD:21,23-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	20-UNIMOD:510,40-UNIMOD:21,325-UNIMOD:510,336-UNIMOD:510,63-UNIMOD:510,75-UNIMOD:21,72-UNIMOD:21,73-UNIMOD:35	0.13	33.0	6	3	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	204-UNIMOD:510,206-UNIMOD:21,182-UNIMOD:510,184-UNIMOD:21,192-UNIMOD:510	0.12	33.0	2	2	2
PRT	sp|O75179-6|ANR17_HUMAN	Isoform 6 of Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	1204-UNIMOD:510,1206-UNIMOD:21,1216-UNIMOD:510	0.01	33.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	239-UNIMOD:510,360-UNIMOD:510,216-UNIMOD:510,217-UNIMOD:4,232-UNIMOD:21,238-UNIMOD:510	0.14	33.0	3	3	3
PRT	sp|Q7Z2W4-2|ZCCHV_HUMAN	Isoform 2 of Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	486-UNIMOD:510,492-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	58-UNIMOD:510,65-UNIMOD:21,63-UNIMOD:21,74-UNIMOD:21,86-UNIMOD:4	0.18	32.0	4	2	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	439-UNIMOD:510,443-UNIMOD:21,456-UNIMOD:510	0.03	32.0	1	1	1
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	219-UNIMOD:510,226-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	35-UNIMOD:510,37-UNIMOD:21,42-UNIMOD:21,49-UNIMOD:510,35-UNIMOD:21,34-UNIMOD:510	0.04	32.0	5	2	1
PRT	sp|Q86W92|LIPB1_HUMAN	Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	null	599-UNIMOD:510,599-UNIMOD:21,615-UNIMOD:510	0.02	32.0	1	1	0
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	81-UNIMOD:510,83-UNIMOD:21,86-UNIMOD:21,93-UNIMOD:510,91-UNIMOD:35	0.09	31.0	2	1	0
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	2105-UNIMOD:510,2113-UNIMOD:21,2115-UNIMOD:4,2120-UNIMOD:510	0.01	31.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	169-UNIMOD:510,185-UNIMOD:21,186-UNIMOD:510,410-UNIMOD:510,417-UNIMOD:21,197-UNIMOD:510	0.09	31.0	3	3	2
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	92-UNIMOD:510,97-UNIMOD:21,107-UNIMOD:510	0.03	31.0	1	1	1
PRT	sp|Q8WWH5|TRUB1_HUMAN	Probable tRNA pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	265-UNIMOD:510,268-UNIMOD:21,269-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q9GZS3|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens OX=9606 GN=WDR61 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	30-UNIMOD:510,39-UNIMOD:21,45-UNIMOD:510,37-UNIMOD:21	0.06	31.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	581-UNIMOD:510,587-UNIMOD:21,591-UNIMOD:4,594-UNIMOD:510,593-UNIMOD:21,33-UNIMOD:510,38-UNIMOD:21,41-UNIMOD:4,42-UNIMOD:510	0.03	31.0	3	2	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	4-UNIMOD:510,6-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	186-UNIMOD:510,189-UNIMOD:21,193-UNIMOD:35	0.03	31.0	2	1	0
PRT	sp|Q9UGP4|LIMD1_HUMAN	LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	314-UNIMOD:510,316-UNIMOD:21,328-UNIMOD:510	0.02	31.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	345-UNIMOD:510,349-UNIMOD:21,352-UNIMOD:21,360-UNIMOD:4	0.02	31.0	1	1	0
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	240-UNIMOD:510,242-UNIMOD:21,238-UNIMOD:510,240-UNIMOD:21	0.07	31.0	2	2	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	193-UNIMOD:510,199-UNIMOD:21,205-UNIMOD:4,195-UNIMOD:21	0.05	31.0	3	1	0
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	null	174-UNIMOD:510,174-UNIMOD:21,178-UNIMOD:4,200-UNIMOD:510,29-UNIMOD:510,36-UNIMOD:21,39-UNIMOD:21,42-UNIMOD:510	0.12	31.0	3	2	0
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	null	716-UNIMOD:510,716-UNIMOD:21,731-UNIMOD:510	0.02	31.0	1	1	0
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	44-UNIMOD:510,55-UNIMOD:21	0.10	30.0	1	1	1
PRT	sp|P46976-2|GLYG_HUMAN	Isoform GN-1 of Glycogenin-1 OS=Homo sapiens OX=9606 GN=GYG1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	306-UNIMOD:510,320-UNIMOD:21,325-UNIMOD:510	0.06	30.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	73-UNIMOD:510,83-UNIMOD:35,79-UNIMOD:21	0.20	30.0	3	1	0
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	262-UNIMOD:510,267-UNIMOD:21,270-UNIMOD:21,264-UNIMOD:510,31-UNIMOD:510,33-UNIMOD:21,37-UNIMOD:21,265-UNIMOD:21	0.20	30.0	5	3	2
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	241-UNIMOD:510,243-UNIMOD:21,246-UNIMOD:4,253-UNIMOD:510	0.02	30.0	1	1	0
PRT	sp|Q9P2N2|RHG28_HUMAN	Rho GTPase-activating protein 28 OS=Homo sapiens OX=9606 GN=ARHGAP28 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	null	67-UNIMOD:510,67-UNIMOD:21	0.02	30.0	1	1	0
PRT	sp|Q3SY69|AL1L2_HUMAN	Mitochondrial 10-formyltetrahydrofolate dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH1L2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	null	848-UNIMOD:510,850-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	1369-UNIMOD:510,1375-UNIMOD:21,1376-UNIMOD:4,1381-UNIMOD:510	0.01	29.0	1	1	1
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	214-UNIMOD:510,218-UNIMOD:4,219-UNIMOD:21,226-UNIMOD:510,223-UNIMOD:35	0.04	29.0	2	1	0
PRT	sp|Q16513-5|PKN2_HUMAN	Isoform 5 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	255-UNIMOD:510,257-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	208-UNIMOD:510,213-UNIMOD:21,220-UNIMOD:510,217-UNIMOD:21	0.05	29.0	2	1	0
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	16-UNIMOD:510,35-UNIMOD:21,47-UNIMOD:4,48-UNIMOD:510	0.05	29.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	208-UNIMOD:510,218-UNIMOD:21	0.00	29.0	1	1	1
PRT	sp|P28838-2|AMPL_HUMAN	Isoform 2 of Cytosol aminopeptidase OS=Homo sapiens OX=9606 GN=LAP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	146-UNIMOD:510,149-UNIMOD:21,157-UNIMOD:510	0.03	29.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	128-UNIMOD:510,132-UNIMOD:21,150-UNIMOD:510,131-UNIMOD:21	0.02	29.0	2	1	0
PRT	sp|P13674|P4HA1_HUMAN	Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	383-UNIMOD:510,395-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q96N67-4|DOCK7_HUMAN	Isoform 4 of Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	1390-UNIMOD:510,1398-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q96EP5-2|DAZP1_HUMAN	Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	195-UNIMOD:510,208-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	102-UNIMOD:510,102-UNIMOD:21,118-UNIMOD:510,99-UNIMOD:510	0.06	29.0	6	2	0
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	465-UNIMOD:510,465-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q9H0H5|RGAP1_HUMAN	Rac GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RACGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	249-UNIMOD:510,257-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q9UKX7-2|NUP50_HUMAN	Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	187-UNIMOD:510,199-UNIMOD:21,201-UNIMOD:510	0.04	29.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	47-UNIMOD:510,52-UNIMOD:21,58-UNIMOD:510	0.02	29.0	1	1	0
PRT	sp|Q8IX94|CTGE4_HUMAN	cTAGE family member 4 OS=Homo sapiens OX=9606 GN=CTAGE4 PE=2 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	null	138-UNIMOD:510,138-UNIMOD:21,148-UNIMOD:4,151-UNIMOD:510	0.02	29.0	1	1	0
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	166-UNIMOD:510	0.03	28.0	1	1	1
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	169-UNIMOD:510,175-UNIMOD:21,180-UNIMOD:510,422-UNIMOD:510,431-UNIMOD:21,436-UNIMOD:510	0.03	28.0	2	2	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	174-UNIMOD:510,190-UNIMOD:21,191-UNIMOD:510	0.04	28.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	482-UNIMOD:510,488-UNIMOD:21,493-UNIMOD:510	0.02	28.0	1	1	1
PRT	sp|P52298-3|NCBP2_HUMAN	Isoform 3 of Nuclear cap-binding protein subunit 2 OS=Homo sapiens OX=9606 GN=NCBP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	11-UNIMOD:510,13-UNIMOD:21,8-UNIMOD:510	0.15	28.0	2	2	2
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	448-UNIMOD:510,448-UNIMOD:21,464-UNIMOD:510,61-UNIMOD:510,64-UNIMOD:21,354-UNIMOD:510,365-UNIMOD:21,47-UNIMOD:510,50-UNIMOD:510	0.09	28.0	5	5	5
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	100-UNIMOD:510,102-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	6-UNIMOD:510,13-UNIMOD:21,25-UNIMOD:510	0.05	28.0	1	1	1
PRT	sp|Q13439-3|GOGA4_HUMAN	Isoform 3 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	39-UNIMOD:510,40-UNIMOD:21	0.01	28.0	1	1	0
PRT	sp|Q92538|GBF1_HUMAN	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	null	345-UNIMOD:510,345-UNIMOD:21,352-UNIMOD:21,360-UNIMOD:4	0.02	28.0	1	1	0
PRT	sp|Q9P260|RELCH_HUMAN	RAB11-binding protein RELCH OS=Homo sapiens OX=9606 GN=RELCH PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	178-UNIMOD:510,180-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	239-UNIMOD:510,247-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|P25054-2|APC_HUMAN	Isoform 2 of Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	1286-UNIMOD:510,1286-UNIMOD:4,1288-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	303-UNIMOD:510,315-UNIMOD:21,326-UNIMOD:510	0.08	27.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	512-UNIMOD:510,514-UNIMOD:21,169-UNIMOD:510,171-UNIMOD:21,177-UNIMOD:510	0.04	27.0	2	2	2
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	16-UNIMOD:510,27-UNIMOD:21,28-UNIMOD:510,203-UNIMOD:510,221-UNIMOD:510	0.08	27.0	2	2	2
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	27.0	1	1	1
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	306-UNIMOD:510,308-UNIMOD:21	0.03	27.0	1	1	0
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	22-UNIMOD:510,24-UNIMOD:21,35-UNIMOD:510	0.03	27.0	1	1	1
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	139-UNIMOD:510,146-UNIMOD:21	0.10	27.0	1	1	1
PRT	sp|Q13243-3|SRSF5_HUMAN	Isoform SRP40-4 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	141-UNIMOD:510,150-UNIMOD:21,155-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	111-UNIMOD:510,115-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|Q9UBU9-2|NXF1_HUMAN	Isoform 2 of Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	219-UNIMOD:510,223-UNIMOD:21,230-UNIMOD:510	0.04	27.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	80-UNIMOD:510,82-UNIMOD:21,92-UNIMOD:510,67-UNIMOD:510,80-UNIMOD:21	0.05	27.0	2	2	2
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	308-UNIMOD:510,314-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	456-UNIMOD:510,458-UNIMOD:21,546-UNIMOD:510,550-UNIMOD:21	0.02	27.0	2	2	2
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	1592-UNIMOD:510,1594-UNIMOD:21,1601-UNIMOD:35	0.01	27.0	2	1	0
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	379-UNIMOD:510,380-UNIMOD:21	0.02	27.0	1	1	0
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	181-UNIMOD:510,187-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	41-UNIMOD:510,43-UNIMOD:21,48-UNIMOD:4,52-UNIMOD:4,56-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P60891|PRPS1_HUMAN	Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	6-UNIMOD:510,11-UNIMOD:21,18-UNIMOD:510,10-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|P20020-5|AT2B1_HUMAN	Isoform E of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	49-UNIMOD:510,52-UNIMOD:21,60-UNIMOD:4,62-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|Q8IZP0-11|ABI1_HUMAN	Isoform 11 of Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	17-UNIMOD:510,22-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	240-UNIMOD:510,242-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	340-UNIMOD:510,344-UNIMOD:21,353-UNIMOD:510	0.04	26.0	1	1	0
PRT	sp|Q5VWQ8-3|DAB2P_HUMAN	Isoform 3 of Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	552-UNIMOD:510,554-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q86WR7-2|PRSR2_HUMAN	Isoform 2 of Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	41-UNIMOD:510,43-UNIMOD:21,52-UNIMOD:510	0.04	26.0	1	1	0
PRT	sp|Q01433-3|AMPD2_HUMAN	Isoform Ex1A-3 of AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	69-UNIMOD:510,71-UNIMOD:21,79-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	761-UNIMOD:510,765-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9HAU0-3|PKHA5_HUMAN	Isoform 3 of Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	408-UNIMOD:510,410-UNIMOD:21,419-UNIMOD:510,411-UNIMOD:35	0.02	26.0	2	1	0
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	518-UNIMOD:510,520-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P25789|PSA4_HUMAN	Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	5-UNIMOD:510,7-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	379-UNIMOD:510,391-UNIMOD:21,539-UNIMOD:510,550-UNIMOD:510,492-UNIMOD:510,187-UNIMOD:510	0.07	26.0	4	4	4
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	846-UNIMOD:510,854-UNIMOD:21,1101-UNIMOD:510,1103-UNIMOD:21,1099-UNIMOD:510,1102-UNIMOD:21	0.01	26.0	3	3	3
PRT	sp|Q15751|HERC1_HUMAN	Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	1510-UNIMOD:510,1510-UNIMOD:21,1514-UNIMOD:21	0.00	26.0	2	1	0
PRT	sp|Q13439|GOGA4_HUMAN	Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	39-UNIMOD:510,39-UNIMOD:21	0.01	26.0	1	1	0
PRT	sp|O95155|UBE4B_HUMAN	Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	103-UNIMOD:510,105-UNIMOD:21,106-UNIMOD:35,113-UNIMOD:4,115-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	null	329-UNIMOD:510,338-UNIMOD:21	0.05	26.0	1	1	0
PRT	sp|P10768|ESTD_HUMAN	S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	187-UNIMOD:510,189-UNIMOD:21,198-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	250-UNIMOD:510,251-UNIMOD:510,252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4,281-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|Q9HCN4-3|GPN1_HUMAN	Isoform 3 of GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	203-UNIMOD:510,206-UNIMOD:21,215-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|Q9C0C2-2|TB182_HUMAN	Isoform 2 of 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	550-UNIMOD:510,554-UNIMOD:21,114-UNIMOD:510,120-UNIMOD:4,123-UNIMOD:21	0.05	25.0	2	2	2
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	371-UNIMOD:510,374-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	11-UNIMOD:510,14-UNIMOD:21,142-UNIMOD:510,152-UNIMOD:21,153-UNIMOD:4,157-UNIMOD:510	0.11	25.0	2	2	2
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 3 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	125-UNIMOD:510,130-UNIMOD:21,136-UNIMOD:4,137-UNIMOD:510	0.08	25.0	1	1	1
PRT	sp|Q13347|EIF3I_HUMAN	Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	214-UNIMOD:510,217-UNIMOD:21,224-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	213-UNIMOD:510,215-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q15172-2|2A5A_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	413-UNIMOD:510,415-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	995-UNIMOD:510,999-UNIMOD:21,1013-UNIMOD:510	0.01	25.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	65-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510,66-UNIMOD:510	0.09	25.0	2	2	2
PRT	sp|P07910-4|HNRPC_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	99-UNIMOD:510,107-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	359-UNIMOD:510,362-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q96FC9-4|DDX11_HUMAN	Isoform 4 of ATP-dependent DNA helicase DDX11 OS=Homo sapiens OX=9606 GN=DDX11	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	274-UNIMOD:510,277-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	6-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q13247-3|SRSF6_HUMAN	Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	295-UNIMOD:510,297-UNIMOD:21,299-UNIMOD:21,303-UNIMOD:21,311-UNIMOD:510	0.05	25.0	1	1	0
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	25.0	1	1	1
PRT	sp|Q9H788-2|SH24A_HUMAN	Isoform 2 of SH2 domain-containing protein 4A OS=Homo sapiens OX=9606 GN=SH2D4A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	268-UNIMOD:510,270-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	19-UNIMOD:510,19-UNIMOD:21,50-UNIMOD:510,273-UNIMOD:510,279-UNIMOD:21,281-UNIMOD:4	0.09	25.0	2	2	2
PRT	sp|Q96EY7-2|PTCD3_HUMAN	Isoform 2 of Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	240-UNIMOD:510,242-UNIMOD:21,251-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	72-UNIMOD:510,73-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|Q08380|LG3BP_HUMAN	Galectin-3-binding protein OS=Homo sapiens OX=9606 GN=LGALS3BP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	442-UNIMOD:510,444-UNIMOD:21,443-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	392-UNIMOD:510,395-UNIMOD:21	0.03	25.0	1	1	0
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	null	571-UNIMOD:510,574-UNIMOD:21,584-UNIMOD:510	0.03	25.0	1	1	0
PRT	sp|O60291-4|MGRN1_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase MGRN1 OS=Homo sapiens OX=9606 GN=MGRN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	491-UNIMOD:510,493-UNIMOD:21,506-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	144-UNIMOD:510,146-UNIMOD:21,148-UNIMOD:35,156-UNIMOD:510	0.04	24.0	1	1	0
PRT	sp|P54252-5|ATX3_HUMAN	Isoform 5 of Ataxin-3 OS=Homo sapiens OX=9606 GN=ATXN3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	73-UNIMOD:510,78-UNIMOD:35,81-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|Q9H0P0-3|5NT3A_HUMAN	Isoform 4 of Cytosolic 5'-nucleotidase 3A OS=Homo sapiens OX=9606 GN=NT5C3A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	217-UNIMOD:510,227-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	10-UNIMOD:510,12-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	392-UNIMOD:510,396-UNIMOD:21	0.03	24.0	1	1	0
PRT	sp|Q9P265|DIP2B_HUMAN	Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	199-UNIMOD:510,203-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9Y4B5|MTCL1_HUMAN	Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	203-UNIMOD:510,204-UNIMOD:21,215-UNIMOD:4,213-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|O75822-2|EIF3J_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	122-UNIMOD:510,127-UNIMOD:21,133-UNIMOD:510	0.06	24.0	1	1	1
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	100-UNIMOD:510,105-UNIMOD:21,158-UNIMOD:510,163-UNIMOD:4,43-UNIMOD:510,57-UNIMOD:510,161-UNIMOD:21	0.13	24.0	4	3	2
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	2779-UNIMOD:510,2781-UNIMOD:21,2790-UNIMOD:510	0.00	24.0	1	1	1
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	378-UNIMOD:510,380-UNIMOD:21,390-UNIMOD:510,379-UNIMOD:35	0.04	24.0	2	1	0
PRT	sp|Q6GYQ0-3|RGPA1_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	842-UNIMOD:510,844-UNIMOD:21	0.01	24.0	1	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	86-UNIMOD:510,89-UNIMOD:21,87-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	3255-UNIMOD:510,3257-UNIMOD:21,3266-UNIMOD:510	0.00	24.0	1	1	1
PRT	sp|P42694|HELZ_HUMAN	Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	1736-UNIMOD:510,1738-UNIMOD:21,1739-UNIMOD:21,1741-UNIMOD:21	0.01	24.0	3	1	0
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	530-UNIMOD:510,535-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	295-UNIMOD:510,295-UNIMOD:21,297-UNIMOD:21,303-UNIMOD:21,311-UNIMOD:510	0.05	24.0	1	1	0
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	172-UNIMOD:510,175-UNIMOD:21,176-UNIMOD:35,184-UNIMOD:510,174-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|O94875|SRBS2_HUMAN	Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	299-UNIMOD:21,301-UNIMOD:21,302-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	62-UNIMOD:510,69-UNIMOD:21,70-UNIMOD:4,74-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|Q15642-5|CIP4_HUMAN	Isoform 5 of Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	294-UNIMOD:510,296-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	254-UNIMOD:510,256-UNIMOD:21,263-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	228-UNIMOD:510	0.08	23.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1531-UNIMOD:510,1535-UNIMOD:21,1541-UNIMOD:510	0.00	23.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1343-UNIMOD:510,1349-UNIMOD:21,1353-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	94-UNIMOD:510,97-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|P57059|SIK1_HUMAN	Serine/threonine-protein kinase SIK1 OS=Homo sapiens OX=9606 GN=SIK1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	165-UNIMOD:510,175-UNIMOD:510,176-UNIMOD:21,181-UNIMOD:21,184-UNIMOD:4,198-UNIMOD:510,176-UNIMOD:510	0.04	23.0	2	2	2
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	134-UNIMOD:510,139-UNIMOD:21,138-UNIMOD:21,141-UNIMOD:21	0.04	23.0	3	1	0
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	309-UNIMOD:510,317-UNIMOD:21,325-UNIMOD:510	0.04	23.0	1	1	0
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1444-UNIMOD:510,1447-UNIMOD:21,1453-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	109-UNIMOD:510,111-UNIMOD:21,121-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	411-UNIMOD:510,416-UNIMOD:21,422-UNIMOD:510,413-UNIMOD:510,414-UNIMOD:35,420-UNIMOD:35	0.03	23.0	4	2	1
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	328-UNIMOD:510,330-UNIMOD:21	0.04	23.0	1	1	0
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	161-UNIMOD:510,164-UNIMOD:21,237-UNIMOD:510,239-UNIMOD:21,257-UNIMOD:510,163-UNIMOD:21	0.07	23.0	3	2	1
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	null	259-UNIMOD:510,263-UNIMOD:21,264-UNIMOD:4,271-UNIMOD:510	0.02	23.0	1	1	0
PRT	sp|Q96D15|RCN3_HUMAN	Reticulocalbin-3 OS=Homo sapiens OX=9606 GN=RCN3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	90-UNIMOD:510,98-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	1175-UNIMOD:510,1181-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P46379-5|BAG6_HUMAN	Isoform 5 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	957-UNIMOD:510,967-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	300-UNIMOD:510,300-UNIMOD:4,306-UNIMOD:21,310-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	50-UNIMOD:510,54-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q5HYK3|COQ5_HUMAN	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	154-UNIMOD:510,165-UNIMOD:21,170-UNIMOD:4,174-UNIMOD:510	0.07	22.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	28-UNIMOD:510,32-UNIMOD:21	0.09	22.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	153-UNIMOD:510,156-UNIMOD:21,164-UNIMOD:510	0.08	22.0	1	1	1
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	360-UNIMOD:510,369-UNIMOD:21,374-UNIMOD:4,377-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	48-UNIMOD:510,52-UNIMOD:21,62-UNIMOD:510,51-UNIMOD:21	0.09	22.0	2	1	0
PRT	sp|Q7Z460-2|CLAP1_HUMAN	Isoform 2 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	542-UNIMOD:510,545-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	496-UNIMOD:510,498-UNIMOD:21,500-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P48637-2|GSHB_HUMAN	Isoform 2 of Glutathione synthetase OS=Homo sapiens OX=9606 GN=GSS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	163-UNIMOD:510,165-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	2141-UNIMOD:510,2144-UNIMOD:21,2150-UNIMOD:21,2152-UNIMOD:4,2157-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	1173-UNIMOD:510,1176-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O15013-7|ARHGA_HUMAN	Isoform 3 of Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	1216-UNIMOD:510,1219-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	13-UNIMOD:510,13-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	592-UNIMOD:510,597-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q8IVT5-4|KSR1_HUMAN	Isoform 4 of Kinase suppressor of Ras 1 OS=Homo sapiens OX=9606 GN=KSR1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	267-UNIMOD:510,269-UNIMOD:21,266-UNIMOD:510	0.02	22.0	2	2	2
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	159-UNIMOD:510,166-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	22.0	null	200-UNIMOD:510,200-UNIMOD:21,202-UNIMOD:21	0.07	22.0	2	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P47756|CAPZB_HUMAN	F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	182-UNIMOD:510,192-UNIMOD:21	0.05	22.0	1	1	0
PRT	sp|Q5VSL9-3|STRP1_HUMAN	Isoform 3 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	69-UNIMOD:510,71-UNIMOD:21,85-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	69-UNIMOD:510,73-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4	0.20	21.0	1	1	1
PRT	sp|P34932-2|HSP74_HUMAN	Isoform 2 of Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	74-UNIMOD:510,76-UNIMOD:21,84-UNIMOD:510	0.08	21.0	1	1	1
PRT	sp|Q9NPF0-2|CD320_HUMAN	Isoform 2 of CD320 antigen OS=Homo sapiens OX=9606 GN=CD320	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	97-UNIMOD:510,97-UNIMOD:4,100-UNIMOD:21,103-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4,625-UNIMOD:21,630-UNIMOD:510,623-UNIMOD:21	0.03	21.0	3	2	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	318-UNIMOD:510,319-UNIMOD:35,321-UNIMOD:21,322-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|P61081|UBC12_HUMAN	NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	170-UNIMOD:510,175-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	17-UNIMOD:510,21-UNIMOD:21,22-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q10471|GALT2_HUMAN	Polypeptide N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=GALNT2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	533-UNIMOD:510,536-UNIMOD:21,539-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|O94903|PLPHP_HUMAN	Pyridoxal phosphate homeostasis protein OS=Homo sapiens OX=9606 GN=PLPBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	242-UNIMOD:510,244-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1855-UNIMOD:510,1859-UNIMOD:21,1869-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	373-UNIMOD:510,376-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	57-UNIMOD:510,66-UNIMOD:21,71-UNIMOD:510,221-UNIMOD:510,37-UNIMOD:510	0.10	21.0	3	3	3
PRT	sp|P33527-8|MRP1_HUMAN	Isoform 8 of Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	798-UNIMOD:510,800-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	303-UNIMOD:510,304-UNIMOD:21,316-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	291-UNIMOD:510,294-UNIMOD:21,295-UNIMOD:35,301-UNIMOD:510	0.02	21.0	2	1	0
PRT	sp|Q9UKV8-2|AGO2_HUMAN	Isoform 2 of Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	385-UNIMOD:510,387-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	182-UNIMOD:510,194-UNIMOD:21	0.06	21.0	1	1	0
PRT	sp|Q6NW29|RWDD4_HUMAN	RWD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RWDD4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	16-UNIMOD:510,28-UNIMOD:21	0.11	21.0	1	1	1
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	119-UNIMOD:510,119-UNIMOD:21,121-UNIMOD:21,142-UNIMOD:510	0.13	21.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	356-UNIMOD:510,358-UNIMOD:21,369-UNIMOD:510,607-UNIMOD:510,608-UNIMOD:21,622-UNIMOD:510,821-UNIMOD:510,823-UNIMOD:21	0.05	21.0	3	3	2
PRT	sp|P31327-2|CPSM_HUMAN	Isoform 2 of Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	82-UNIMOD:510,86-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q15818|NPTX1_HUMAN	Neuronal pentraxin-1 OS=Homo sapiens OX=9606 GN=NPTX1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	86-UNIMOD:510,89-UNIMOD:4,91-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	41-UNIMOD:510,41-UNIMOD:21,52-UNIMOD:510	0.03	21.0	1	1	0
PRT	sp|Q969M2|CXA10_HUMAN	Gap junction alpha-10 protein OS=Homo sapiens OX=9606 GN=GJA10 PE=2 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	241-UNIMOD:21,247-UNIMOD:21,262-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	511-UNIMOD:510,521-UNIMOD:21	0.02	21.0	1	1	0
PRT	sp|Q6GYQ0|RGPA1_HUMAN	Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	795-UNIMOD:510,798-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	121-UNIMOD:510,123-UNIMOD:21,127-UNIMOD:35,128-UNIMOD:510	0.05	20.0	2	1	0
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	392-UNIMOD:510,394-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	129-UNIMOD:510,130-UNIMOD:21,144-UNIMOD:510	0.07	20.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	90-UNIMOD:510,91-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q96GM8-2|TOE1_HUMAN	Isoform 2 of Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	338-UNIMOD:510,339-UNIMOD:21	0.05	20.0	1	1	0
PRT	sp|Q9Y4X5|ARI1_HUMAN	E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	512-UNIMOD:510,517-UNIMOD:21,522-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	146-UNIMOD:510,150-UNIMOD:21,158-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	25-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	324-UNIMOD:510,326-UNIMOD:21,328-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	129-UNIMOD:510,133-UNIMOD:21	0.09	20.0	1	1	1
PRT	sp|Q8N257|H2B3B_HUMAN	Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	35-UNIMOD:510,37-UNIMOD:21,44-UNIMOD:510	0.09	20.0	1	1	1
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	108-UNIMOD:510,113-UNIMOD:21,129-UNIMOD:510	0.17	20.0	1	1	1
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	182-UNIMOD:510,196-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|O00273-2|DFFA_HUMAN	Isoform DFF35 of DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	249-UNIMOD:510,256-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	387-UNIMOD:510,390-UNIMOD:21,392-UNIMOD:4,397-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|Q9Y580|RBM7_HUMAN	RNA-binding protein 7 OS=Homo sapiens OX=9606 GN=RBM7 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	134-UNIMOD:510,136-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q08AD1-2|CAMP2_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	435-UNIMOD:510,437-UNIMOD:21,450-UNIMOD:510,1284-UNIMOD:510,1286-UNIMOD:21	0.02	20.0	2	2	2
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	192-UNIMOD:510,194-UNIMOD:21,207-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	247-UNIMOD:510,251-UNIMOD:21	0.05	20.0	1	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	73-UNIMOD:510,74-UNIMOD:4,75-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	350-UNIMOD:510,357-UNIMOD:21,366-UNIMOD:510	0.04	20.0	1	1	0
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	98-UNIMOD:510,101-UNIMOD:21	0.16	20.0	1	1	0
PRT	sp|Q96GM8|TOE1_HUMAN	Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	418-UNIMOD:510,425-UNIMOD:21	0.05	20.0	1	1	0
PRT	sp|O75436|VP26A_HUMAN	Vacuolar protein sorting-associated protein 26A OS=Homo sapiens OX=9606 GN=VPS26A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	94-UNIMOD:510,102-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	225-UNIMOD:510,227-UNIMOD:21,242-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	423-UNIMOD:510,424-UNIMOD:35,427-UNIMOD:21,435-UNIMOD:510	0.03	20.0	1	1	0
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	694-UNIMOD:510,696-UNIMOD:21,709-UNIMOD:510	0.02	20.0	1	1	0
PRT	sp|Q9NS91|RAD18_HUMAN	E3 ubiquitin-protein ligase RAD18 OS=Homo sapiens OX=9606 GN=RAD18 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	140-UNIMOD:510,144-UNIMOD:21,151-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|Q9UIQ6-3|LCAP_HUMAN	Isoform 3 of Leucyl-cystinyl aminopeptidase OS=Homo sapiens OX=9606 GN=LNPEP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	14-UNIMOD:510,16-UNIMOD:4,32-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P39748-2|FEN1_HUMAN	Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	189-UNIMOD:510,190-UNIMOD:510,191-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	480-UNIMOD:510,483-UNIMOD:21,491-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P61326-2|MGN_HUMAN	Isoform 2 of Protein mago nashi homolog OS=Homo sapiens OX=9606 GN=MAGOH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	67-UNIMOD:510,69-UNIMOD:21,77-UNIMOD:510	0.11	19.0	1	1	1
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	72-UNIMOD:510,75-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|P10696|PPBN_HUMAN	Alkaline phosphatase, germ cell type OS=Homo sapiens OX=9606 GN=ALPG PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	186-UNIMOD:510,189-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|A1L390-2|PKHG3_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	271-UNIMOD:510,274-UNIMOD:21,280-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|P11532-9|DMD_HUMAN	Isoform 16 of Dystrophin OS=Homo sapiens OX=9606 GN=DMD	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	443-UNIMOD:510,445-UNIMOD:21,449-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|Q07666-3|KHDR1_HUMAN	Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	18-UNIMOD:510,20-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	451-UNIMOD:510,453-UNIMOD:21,458-UNIMOD:35,459-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	900-UNIMOD:510,902-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P55196-2|AFAD_HUMAN	Isoform 1 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	213-UNIMOD:510,215-UNIMOD:21,222-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|Q9ULU4-4|PKCB1_HUMAN	Isoform 4 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	133-UNIMOD:510,136-UNIMOD:21	0.02	19.0	1	1	0
PRT	sp|P46459-2|NSF_HUMAN	Isoform 2 of Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	200-UNIMOD:510,204-UNIMOD:21,210-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	null	26-UNIMOD:510,38-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q9ULU4|PKCB1_HUMAN	Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	509-UNIMOD:510,511-UNIMOD:21	0.01	19.0	1	1	0
PRT	sp|Q13275|SEM3F_HUMAN	Semaphorin-3F OS=Homo sapiens OX=9606 GN=SEMA3F PE=2 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	412-UNIMOD:4,418-UNIMOD:21,421-UNIMOD:35,422-UNIMOD:510,423-UNIMOD:21,424-UNIMOD:21,425-UNIMOD:510	0.02	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	SSGSPYGGGYGSGGGSGGYGSR	1	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	51.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=1851	25.073	2	2023.8121	2023.8121	R	R	333	355
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510	ms_run[2]:scan=4864	47.316	2	2226.9361	2226.9361	R	-	228	248
PSM	INSSGESGDESDEFLQSR	3	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=3884	39.967	2	2149.8302	2149.8302	R	K	180	198
PSM	INSSGESGDESDEFLQSR	4	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	45.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=3884	39.966818333333336	2	2149.820850	2149.830237	R	K	180	198
PSM	DNLTLWTSDQQDDDGGEGNN	5	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510	ms_run[2]:scan=4997	48.344	2	2226.9361	2226.9361	R	-	228	248
PSM	SGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGR	6	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2836	32.259	3	3065.2684	3065.2684	K	S	306	339
PSM	VDSEGDFSENDDAAGDFR	7	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3444	36.717	2	2058.7904	2058.7904	R	S	321	339
PSM	AEDGSVIDYELIDQDAR	8	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4929	47.832	2	2021.9043	2021.9043	R	D	198	215
PSM	INSSGESGDESDEFLQSR	9	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3175	34.728	2	2069.8639	2069.8639	R	K	180	198
PSM	SFSEDAVTDSSGSGTLPR	10	sp|Q27J81-2|INF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3239	35.198	2	1925.8468	1925.8468	K	A	1192	1210
PSM	LATQSNEITIPVTFESR	11	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=5062	48.859	2	2019.0138	2019.0138	K	A	172	189
PSM	YQPLASTASDNDFVTPEPR	12	sp|Q15021|CND1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4210	42.38	2	2221.0153	2221.0153	R	R	1325	1344
PSM	SSTPLPTISSSAENTR	13	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2601	30.544	2	1760.8406	1760.8406	R	Q	158	174
PSM	NEINGNWISASSINEAR	14	sp|Q53EL6-2|PDCD4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4270	42.825	2	1987.9213	1987.9213	K	I	27	44
PSM	TASESISNLSEAGSIK	15	sp|P30622-2|CLIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3281	35.513	2	1740.8819	1740.8819	K	K	191	207
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	16	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=4907	47.665	3	3490.5054	3490.5054	R	-	207	238
PSM	TPEELDDSDFETEDFDVR	17	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=5102	49.165	2	2271.9157	2271.9157	R	S	264	282
PSM	VQSTADIFGDEEGDLFK	18	sp|Q9Y4E1-5|WAC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=5954	56.862	2	2017.9558	2017.9558	K	E	452	469
PSM	TGQEYKPGNPPAEIGQNISSNSSASILESK	19	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:510,6-UNIMOD:510,22-UNIMOD:21,30-UNIMOD:510	ms_run[1]:scan=3934	40.33733833333333	3	3285.6552	3284.6662	K	S	795	825
PSM	ASNLENSTYDLYTIPK	20	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,7-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4584	45.207	2	1975.9816	1975.9816	R	D	383	399
PSM	ELTVSNNDINEAGVR	21	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3062	33.903	2	1743.8253	1743.8253	K	V	174	189
PSM	SSSPAPADIAQTVQEDLR	22	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=5499	52.332	2	1997.9519	1997.9519	K	T	230	248
PSM	SYSSPDITQAIQEEEK	23	sp|P40818-2|UBP8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4537	44.817	2	1971.9351	1971.9351	R	R	610	626
PSM	VWLDPNETNEIANANSR	24	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=4332	43.285	2	2055.9475	2055.9475	K	Q	22	39
PSM	SSSPAPADIAQTVQEDLR	25	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=5499	52.33208	2	1997.9490	1997.9514	K	T	230	248
PSM	QSGEAFVELGSEDDVK	26	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,11-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3966	40.571	2	1856.8717	1856.8717	R	M	53	69
PSM	SNSEASVDSASMEDFWR	27	sp|Q9P2N2-2|RHG28_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5425	51.743	2	2030.8141	2030.8141	R	E	15	32
PSM	DWEDDSDEDMSNFDR	28	sp|Q15185-4|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4097	41.538	2	1908.7168	1908.7168	K	F	108	123
PSM	EMDESLANLSEDEYYSEEER	29	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4844	47.165	2	2551.0046	2551.0046	R	N	122	142
PSM	GILAADESTGSIAK	30	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2773	31.801	2	1479.7858	1479.7858	K	R	83	97
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	31	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4179	42.149	3	3090.3451	3090.3451	K	E	120	146
PSM	NDSPTQIPVSSDVCR	32	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=2753	31.653	2	1787.7973	1787.7973	R	L	656	671
PSM	SGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGR	33	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=2431	29.305	3	3081.2633	3081.2633	K	S	306	339
PSM	SNSELEDEILCLEK	34	sp|Q96PC5-6|MIA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=5972	57.028	2	1825.8693	1825.8693	R	E	99	113
PSM	SQSTTFNPDDMSEPEFK	35	sp|Q86W92-3|LIPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4419	43.93	2	2106.913	2106.9130	R	R	446	463
PSM	TDSVIIADQTPTPTR	36	sp|P17544-5|ATF7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2833	32.237	2	1727.8555	1727.8555	R	F	42	57
PSM	VTSQQFEAEAADEK	37	sp|Q6PID6|TTC33_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2723	31.434293333333336	2	1700.797186	1699.797847	K	D	17	31
PSM	GSLESPATDVFGSTEEGEK	38	sp|O00232|PSD12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,13-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=4147	41.911811666666665	2	2087.9602	2086.9612	K	R	331	350
PSM	ERPTPSLNNNCTTSEDSLVLYNR	39	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3609	37.932	3	2793.2853	2793.2853	K	V	734	757
PSM	FSSQSNVYGLAGGAGGR	40	sp|Q9Y664|KPTN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3331	35.881	2	1740.8045	1740.8045	R	G	22	39
PSM	FWEVISDEHGIDPTGTYHGDSDLQLDR	41	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=5192	49.872	3	3215.4297	3215.4297	K	I	20	47
PSM	GASQAGMTGYGMPR	42	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2827	32.195	2	1496.6366	1496.6366	R	Q	204	218
PSM	NASILLEELDLEK	43	sp|O75179-6|ANR17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=6486	62.447	2	1633.8852	1633.8852	K	L	1204	1217
PSM	SYELPDGQVITIGNER	44	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4985	48.253	2	1823.9478	1823.9478	K	F	239	255
PSM	VALVNDSLSDVTSTTSSR	45	sp|Q7Z2W4-2|ZCCHV_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3986	40.72	2	1964.9516	1964.9516	R	V	486	504
PSM	DFFQSYGNVVELR	46	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=6040	57.671	2	1686.7867	1686.7867	K	I	358	371
PSM	GILAADESTGSIAK	47	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2957	33.147	2	1479.7858	1479.7858	K	R	83	97
PSM	INPDGSQSVVEVPYAR	48	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3732	38.84	2	1843.893	1843.8930	R	S	58	74
PSM	RVSVCAETYNPDEEEEDTDPR	49	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2622	30.698	3	2624.0798	2624.0798	R	V	97	118
PSM	SVPTSTVFYPSDGVATEK	50	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,5-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4252	42.691	2	2032.0078	2032.0078	R	A	439	457
PSM	TLVSTVGSMVFNEGEAQR	51	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=5279	50.546	2	2037.9655	2037.9655	K	L	219	237
PSM	TMSEVGGSVEDLIAK	52	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=5483	52.212	2	1762.8138	1762.8138	R	G	35	50
PSM	YASICQQNGIVPIVEPEILPDGDHDLK	53	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,27-UNIMOD:510	ms_run[2]:scan=5790	55.072	3	3167.5887	3167.5887	R	R	228	255
PSM	INPDGSQSVVEVPYAR	54	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=3732	38.839665000000004	2	1843.8871	1843.8924	R	S	58	74
PSM	SQSTTFNPDDMSEPEFK	55	sp|Q86W92|LIPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,1-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=4419	43.93007	2	2106.906987	2106.912953	R	R	599	616
PSM	AITGASLADIMAK	56	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5656	53.732	2	1488.7337	1488.7337	R	R	81	94
PSM	APSVATVGSICDLNLK	57	sp|O75369-5|FLNB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=4627	45.528	2	1791.9478	1791.9478	R	I	2105	2121
PSM	DDVAQTDLLQIDPNFGSK	58	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,17-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=5992	57.182	2	2123.046	2123.0460	K	E	169	187
PSM	EALLSSAVDHGSDEVK	59	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3182	34.778	2	1803.8928	1803.8928	R	F	92	108
PSM	ELSSCANVLELTR	60	sp|Q8WWH5|TRUB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=4760	46.521	2	1604.7693	1604.7693	K	T	265	278
PSM	ENSETVVTGSLDDLVK	61	sp|Q9GZS3|WDR61_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4720	46.219	2	1852.9343	1852.9343	K	V	30	46
PSM	ETVSEESNVLCLSK	62	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3780	39.192	2	1741.8482	1741.8482	R	S	581	595
PSM	NGSEADIDEGLYSR	63	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3060	33.888	2	1638.6987	1638.6987	K	Q	4	18
PSM	NWYSDADMPASAR	64	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=2994	33.415	2	1612.6441	1612.6441	R	Q	186	199
PSM	NWYSDADMPASAR	65	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3827	39.543	2	1596.6492	1596.6492	R	Q	186	199
PSM	SNSGLGGEVSGVMSK	66	sp|Q9UGP4|LIMD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3610	37.939	2	1555.759	1555.7590	R	P	314	329
PSM	SQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPR	67	sp|Q92538-3|GBF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=5344	51.104	4	4238.7547	4238.7547	K	G	345	382
PSM	THSTSSSLGSGESPFSR	68	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2182	27.5	2	1836.8104	1836.8104	R	S	240	257
PSM	VPTANVSVVDLTCR	69	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3951	40.461	2	1643.8166	1643.8166	R	L	193	207
PSM	YASICQQNGIVPIVEPEILPDGDHDLK	70	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:4,27-UNIMOD:510	ms_run[1]:scan=5790	55.07219333333334	3	3167.5826	3167.5881	R	R	174	201
PSM	SYSSPDITQAIQEEEK	71	sp|P40818|UBP8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:510,1-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=4537	44.817148333333336	2	1971.931201	1971.935068	R	R	716	732
PSM	ELAPYDENWFYTR	72	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=5634	53.521	2	1816.7922	1816.7922	K	A	44	57
PSM	ERWEQGQADYMGADSFDNIK	73	sp|P46976-2|GLYG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,15-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4080	41.413	3	2507.1101	2507.1101	K	R	306	326
PSM	GQSEDPGSLLSLFR	74	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=6453	61.946	2	1618.7816	1618.7816	K	R	410	424
PSM	KEESEESDDDMGFGLFD	75	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4518	44.672	2	2032.8732	2032.8732	K	-	73	90
PSM	KEESEESDDDMGFGLFD	76	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=5214	50.05	2	2112.8395	2112.8395	K	-	73	90
PSM	TRVTDSSVSVQLRE	77	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=2939	33.014	2	1769.8174	1769.8174	R	-	262	276
PSM	VDSTTCLFPVEEK	78	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=4416	43.908	2	1671.8103	1671.8103	R	A	241	254
PSM	SNSEASVDSASMEDFWR	79	sp|Q9P2N2|RHG28_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=5425	51.743045	2	2030.8121	2030.8136	R	E	67	84
PSM	FSSQSNVYGLAGGAGGR	80	sp|Q9Y664|KPTN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3331	35.88125333333333	2	1741.8052	1740.8042	R	G	22	39
PSM	ANSTEYGLASGVFTR	81	sp|Q3SY69|AL1L2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=4614	45.43261833333334	2	1687.7922	1685.7872	R	D	848	863
PSM	AELFTQSCADLDK	82	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=3815	39.454	2	1644.7743	1644.7743	K	W	1369	1382
PSM	AGLNCSTENMPIK	83	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:4,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2726	31.455	2	1581.7568	1581.7569	R	I	214	227
PSM	ASSLGEIDESSELR	84	sp|Q16513-5|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3368	36.154	2	1605.7347	1605.7347	R	V	255	269
PSM	EVSFQSTGESEWK	85	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3720	38.75	2	1660.7658	1660.7658	R	D	208	221
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	86	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,20-UNIMOD:21,32-UNIMOD:4,33-UNIMOD:510	ms_run[2]:scan=4041	41.119	3	3881.5895	3881.5895	R	G	16	49
PSM	LPSGSGAASPTGSAVDIR	87	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2568	30.303	2	1755.8617	1755.8617	R	A	208	226
PSM	LYGSGDQEAWQK	88	sp|P28838-2|AMPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2744	31.587	2	1528.7236	1528.7236	K	G	146	158
PSM	RHASSSDDFSDFSDDSDFSPSEK	89	sp|Q9UPT8|ZC3H4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=3489	37.044	3	2712.1137	2712.1137	K	G	128	151
PSM	SAWLSGYENPVVSR	90	sp|P13674|P4HA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4598	45.313	2	1677.7976	1677.7976	K	I	383	397
PSM	SPSGSAFGSQENLR	91	sp|Q96N67-4|DOCK7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2212	27.719	2	1549.6986	1549.6986	R	W	1390	1404
PSM	SQAPGQPGASQWGSR	92	sp|Q96EP5-2|DAZP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=1689	23.884	2	1626.7364	1626.7364	K	V	195	210
PSM	SVGDGETVEFDVVEGEK	93	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4692	46.014	2	1942.9085	1942.9085	R	G	102	119
PSM	TAMSTPHVAEPAENEQDEQDENGAEASADLR	94	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3114	34.284	3	3425.4415	3425.4415	K	A	465	496
PSM	TDYNASVSVPDSSGPER	95	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2612	30.625	2	1893.8206	1893.8206	R	I	70	87
PSM	TGTLQPWNSDSTLNSR	96	sp|Q9H0H5|RGAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3641	38.17	2	1889.8733	1889.8733	K	Q	249	265
PSM	TMSEVGGSVEDLIAK	97	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=5337	51.05	2	1682.8474	1682.8474	R	G	35	50
PSM	VAAETQSPSLFGSTK	98	sp|Q9UKX7-2|NUP50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3310	35.727	2	1669.8601	1669.8601	K	L	187	202
PSM	YLRSVGDGETVEFDVVEGEK	99	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4415	43.901	3	2375.157	2375.1570	K	G	99	119
PSM	YLRSVGDGETVEFDVVEGEK	100	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4431	44.02	2	2375.157	2375.1570	K	G	99	119
PSM	ELISNSSDALDK	101	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2643	30.851353333333332	2	1438.7193	1438.7224	R	I	47	59
PSM	RHASSSDDFSDFSDDSDFSPSEK	102	sp|Q9UPT8|ZC3H4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,23-UNIMOD:510	ms_run[1]:scan=3489	37.043668333333336	3	2712.1058	2712.1132	K	G	128	151
PSM	SNSELEDEILCLEK	103	sp|Q8IX94|CTGE4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:4,14-UNIMOD:510	ms_run[1]:scan=5972	57.02800166666666	2	1825.867796	1825.869297	R	D	138	152
PSM	ATAGDTHLGGEDFDNR	104	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=1715	24.075	3	1708.7865	1708.7865	K	L	166	182
PSM	DDVAQTDLLQIDPNFGSKEDFDSLLQSAK	105	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,17-UNIMOD:21,18-UNIMOD:510,29-UNIMOD:510	ms_run[2]:scan=6767	65.985	3	3390.6969	3390.6969	K	K	169	198
PSM	ELISNSSDALDK	106	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2643	30.851	2	1438.7229	1438.7229	R	I	169	181
PSM	GADFLVTEVENGGSLGSK	107	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,17-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=5385	51.426	2	1926.9612	1926.9612	K	K	174	192
PSM	INPDGSQSVVEVPYAR	108	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3868	39.848	2	1843.893	1843.8930	R	S	58	74
PSM	NAGVEGSLIVEK	109	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2893	32.677	2	1362.7432	1362.7432	K	I	482	494
PSM	SDSYVELSQYR	110	sp|P52298-3|NCBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3467	36.887	2	1459.6445	1459.6445	R	D	11	22
PSM	SQIFSTASDNQPTVTIK	111	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3849	39.705	2	1984.0191	1984.0191	K	V	448	465
PSM	SSSPVQVEEEPVR	112	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1983	26.045	2	1555.7343	1555.7343	R	L	100	113
PSM	TIGGGDDSFNTFFSETGAGK	113	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,8-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5636	53.537	2	2154.9783	2154.9783	K	H	6	26
PSM	TSSFTEQLDEGTPNR	114	sp|Q13439-3|GOGA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3045	33.782	2	1794.7886	1794.7886	R	E	39	54
PSM	SQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPR	115	sp|Q92538|GBF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,1-UNIMOD:21,8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=5344	51.10396	4	4238.7412	4238.7542	K	G	345	382
PSM	ENSETVVTGSLDDLVK	116	sp|Q9GZS3|WDR61_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,8-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=4720	46.218896666666666	2	1852.929965	1852.934340	K	V	30	46
PSM	AGSISTLDSLDFAR	117	sp|Q9P260|RELCH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5249	50.318	2	1565.7551	1565.7551	R	Y	178	192
PSM	AQYYLPDGSTIEIGPSR	118	sp|P61163|ACTZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=5599	53.212	2	1979.9454	1979.9454	K	F	239	256
PSM	CTSVSSLDSFESR	119	sp|P25054-2|APC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=3625	38.051	2	1587.67	1587.6700	R	S	1286	1299
PSM	EEILENWNMFVGSQATNYGEDLTK	120	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,13-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=6718	65.322	3	2935.3623	2935.3623	K	N	303	327
PSM	FQSSHHPTDITSLDQYVER	121	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3788	39.252	3	2373.0851	2373.0851	R	M	512	531
PSM	GNPTVEVDLFTSK	122	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4704	46.099	2	1553.8015	1553.8015	R	G	16	29
PSM	GPLQSVQVFGR	123	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4056	41.232	2	1300.6753	1300.6753	K	K	5	16
PSM	GSTDNLMDDIER	124	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4328	43.256	2	1478.6173	1478.6173	R	A	306	318
PSM	GVSLTNHHFYDESK	125	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2429	29.291	2	1780.8458	1780.8458	R	P	22	36
PSM	KAEAGAGSATEFQFR	126	sp|P46783|RS10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2562	30.259	2	1716.8509	1716.8509	K	G	139	154
PSM	LNEGVVEFASYGDLK	127	sp|Q13243-3|SRSF5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=5095	49.111	2	1787.9019	1787.9019	K	N	141	156
PSM	QWYESHYALPLGR	128	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4488	44.448	2	1732.8187	1732.8187	R	K	111	124
PSM	RYDGSQQALDLK	129	sp|Q9UBU9-2|NXF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2076	26.729	2	1540.7923	1540.7923	K	G	219	231
PSM	SPSPEPIYNSEGK	130	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1980	26.024	2	1551.7494	1551.7494	R	R	80	93
PSM	TDASSASSFLDSDELER	131	sp|Q14498-3|RBM39_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4741	46.379	2	1942.8257	1942.8257	R	T	308	325
PSM	TLSFGSDLNYATR	132	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4803	46.845	2	1557.7289	1557.7289	R	E	456	469
PSM	VPTANVSVVDLTCR	133	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4090	41.488	2	1643.8166	1643.8166	R	L	193	207
PSM	WTSQDSLLGMEFSGR	134	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5792	55.088	2	1826.8123	1826.8123	K	D	1592	1607
PSM	GSTDNLMDDIER	135	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4328	43.25604	2	1478.6151	1478.6167	R	A	379	391
PSM	TMSEVGGSVEDLIAK	136	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,1-UNIMOD:21,8-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=5483	52.21171	2	1762.8112	1762.8132	R	G	35	50
PSM	ALDVSASDDEIAR	137	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3012	33.546	2	1474.6765	1474.6765	K	L	181	194
PSM	GGSVLVTCSTSCDQPK	138	sp|P05362|ICAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2184	27.515	2	1842.8529	1842.8529	R	L	41	57
PSM	IFSGSSHQDLSQK	139	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1419	21.882	2	1580.7872	1580.7872	K	I	6	19
PSM	IQESYGDVYGICTK	140	sp|P20020-5|AT2B1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3890	40.011	2	1779.8427	1779.8427	K	L	49	63
PSM	RALIESYQNLTR	141	sp|Q8IZP0-11|ABI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3167	34.669	2	1576.8187	1576.8187	K	V	17	29
PSM	RVSHQGYSTEAEFEEPR	142	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1897	25.414	3	2134.9533	2134.9533	R	V	240	257
PSM	SGSSSPDSEITELK	143	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2975	33.277	2	1583.7604	1583.7604	R	F	340	354
PSM	SLSMVDLQDAR	144	sp|Q5VWQ8-3|DAB2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4221	42.462	2	1347.6318	1347.6318	K	T	552	563
PSM	SRSFTLDDESLK	145	sp|Q86WR7-2|PRSR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2990	33.386	2	1544.776	1544.7760	R	Y	41	53
PSM	TDSDSDLQLYK	146	sp|Q01433-3|AMPD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3011	33.539	2	1431.6807	1431.6807	K	E	69	80
PSM	TDTESELDLISR	147	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4110	41.636	2	1491.6918	1491.6918	K	L	761	773
PSM	TNSMQQLEQWIK	148	sp|Q9HAU0-3|PKHA5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5565	52.954	2	1652.827	1652.8270	R	I	408	420
PSM	TQSSASLAASYAAQQHPQAAASYR	149	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2880	32.579	3	2578.2026	2578.2026	R	G	518	542
PSM	VPTANVSVVDLTCR	150	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4450	44.164	2	1723.783	1723.7830	R	L	193	207
PSM	YDSRTTIFSPEGR	151	sp|P25789|PSA4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3023	33.623	2	1641.7612	1641.7612	R	L	5	18
PSM	GVVDSEDLPLNISR	152	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=4548	44.89958	2	1626.8050	1626.8073	R	E	379	393
PSM	SGTPPRQGSITSPQANEQSVTPQR	153	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=1801	24.705788333333334	3	2638.2762	2636.2762	K	R	846	870
PSM	YASICQQNGIVPIVEPEILPDGDHDLK	154	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:4,27-UNIMOD:510	ms_run[1]:scan=5895	56.24795666666667	3	3168.5672	3167.5882	R	R	174	201
PSM	SRSESDLSQPESDEEGYALSGR	155	sp|Q15751|HERC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=2797	31.973858333333332	3	2512.0750	2512.0810	K	R	1510	1532
PSM	TSSFTEQLDEGTPNR	156	sp|Q13439|GOGA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=3045	33.78230166666667	2	1794.7810	1794.7880	R	E	39	54
PSM	SQSMDIDGVSCEK	157	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:35,11-UNIMOD:4,13-UNIMOD:510	ms_run[1]:scan=1654	23.62319	2	1619.6892	1618.6882	R	S	103	116
PSM	IFSGSSHQDLSQK	158	sp|P60891|PRPS1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=1419	21.882081666666664	2	1580.7841	1580.7867	K	I	6	19
PSM	EVSFQSTGESEWK	159	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=3720	38.74957166666667	2	1660.763335	1660.765818	R	D	208	221
PSM	THSTSSSLGSGESPFSR	160	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=2182	27.500009999999996	2	1836.805015	1836.810354	R	S	329	346
PSM	AFSGYLGTDQSK	161	sp|P10768|ESTD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3605	37.901	2	1420.6912	1420.6912	K	W	187	199
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	162	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4,32-UNIMOD:510	ms_run[2]:scan=5127	49.352	4	4015.8382	4015.8382	R	I	250	282
PSM	ALRSDSYVELSQYR	163	sp|P52298-3|NCBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3271	35.438	2	1799.8667	1799.8667	K	D	8	22
PSM	ALSRQEMQEVQSSR	164	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1764	24.431	2	1761.8293	1761.8293	K	S	175	189
PSM	DMGSVALDAGTAK	165	sp|Q9HCN4-3|GPN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3478	36.965	2	1382.6789	1382.6789	K	D	203	216
PSM	EAAFSPGQQDWSR	166	sp|Q9C0C2-2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3395	36.352	2	1591.6881	1591.6881	R	D	550	563
PSM	EGLELPEDEEEK	167	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2847	32.339	2	1483.7566	1483.7566	K	K	539	551
PSM	EYIPGQPPLSQSSDSSPTR	168	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3342	35.962	2	2158.9996	2158.9996	K	N	871	890
PSM	GSFSEQGINEFLR	169	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=5442	51.872	2	1596.7398	1596.7398	K	E	371	384
PSM	HGESAWNLENR	170	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2271	28.143	2	1425.6251	1425.6251	R	F	11	22
PSM	IIYGGSVTGATCK	171	sp|P60174-4|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2463	29.536	2	1473.7575	1473.7575	R	E	125	138
PSM	LFDSTTLEHQK	172	sp|Q13347|EIF3I_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2409	29.147	2	1465.749	1465.7490	K	T	214	225
PSM	NPSTVEAFDLAQSNSEHSR	173	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3399	36.383	3	2201.9803	2201.9803	R	H	213	232
PSM	QNSAYNMHSILSNTSAE	174	sp|Q15172-2|2A5A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4130	41.783	2	1979.8508	1979.8508	K	-	413	430
PSM	QREESETRSESSDFEVVPK	175	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2157	27.319	3	2386.1326	2386.1326	R	R	995	1014
PSM	RNQSFCPTVNLDK	176	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2610	30.611	2	1725.8546	1725.8546	K	L	65	78
PSM	RSAAEMYGSSFDLDYDFQR	177	sp|P07910-4|HNRPC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=5084	49.026	2	2371.004	2371.0040	K	D	99	118
PSM	SEESVSRLPEEIR	178	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2987	33.363	2	1643.798	1643.7980	R	R	359	372
PSM	SLGSVQLINDR	179	sp|Q96FC9-4|DDX11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3769	39.112	2	1314.6757	1314.6757	K	C	274	285
PSM	SRSAMDSPVPASMFAPEPSSPGAAR	180	sp|O00178|GTPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4420	43.938	3	2696.1589	2696.1589	R	A	6	31
PSM	SRSESDLSQPESDEEGYALSGR	181	sp|Q15751|HERC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2797	31.974	3	2512.0815	2512.0815	K	R	1510	1532
PSM	SRSQSRSNSPLPVPPSK	182	sp|Q13247-3|SRSF6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1784	24.581	3	2130.9902	2130.9902	R	A	295	312
PSM	SVGDGETVEFDVVEGEK	183	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4741	46.379	2	1942.9085	1942.9085	R	G	102	119
PSM	TAFQEALDAAGDK	184	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3284	35.536	2	1403.7569	1403.7569	K	L	9	22
PSM	TLSSSAQEDIIR	185	sp|Q9H788-2|SH24A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2826	32.188	2	1432.7023	1432.7023	R	W	268	280
PSM	TMSEVGGSVEDLIAK	186	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4679	45.915	2	1682.8474	1682.8474	R	G	35	50
PSM	TNSMQQLEQWIK	187	sp|Q9HAU0-3|PKHA5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=4517	44.665	2	1668.8219	1668.8219	R	I	408	420
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	188	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,32-UNIMOD:510	ms_run[2]:scan=1883	25.312	3	2580.1514	2580.1514	R	A	19	51
PSM	VMSDFAINQEQK	189	sp|Q96EY7-2|PTCD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3320	35.8	2	1556.7582	1556.7582	R	E	240	252
PSM	VTSFRDLIHDQDEDEEEEEGQR	190	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3826	39.535	3	2789.1878	2789.1878	R	F	72	94
PSM	YLRSVGDGETVEFDVVEGEK	191	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4594	45.283	3	2375.157	2375.1570	K	G	99	119
PSM	YSSDYFQAPSDYR	192	sp|Q08380|LG3BP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3802	39.356	2	1711.6979	1711.6979	K	Y	442	455
PSM	EYIPGQPPLSQSSDSSPTR	193	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=3342	35.961643333333335	2	2158.9937	2158.9991	K	N	871	890
PSM	GPPSSSDSEPEAELER	194	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=2391	29.016876666666665	2	1799.7612	1799.7670	R	E	392	408
PSM	SGSSSPDSEITELK	195	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2975	33.276878333333336	2	1583.756739	1583.760398	R	F	571	585
PSM	AASIENVLQDSSPEHCGR	196	sp|O60291-4|MGRN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=3446	36.731	3	2082.9254	2082.9254	R	G	491	509
PSM	AHSSMVGVNLPQK	197	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:510	ms_run[2]:scan=1710	24.038	2	1530.7902	1530.7902	R	A	144	157
PSM	AIQLSMQGSSR	198	sp|P54252-5|ATX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=1597	23.204	2	1306.6165	1306.6165	R	N	73	84
PSM	DNSNIILLGDSQGDLR	199	sp|Q9H0P0-3|5NT3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=5157	49.593	2	1842.8937	1842.8937	K	M	217	233
PSM	ETVSEESNVLCLSK	200	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:4,13-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3637	38.14	2	1741.8482	1741.8482	R	S	581	595
PSM	EVDEQMLNVQNK	201	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2694	31.218	2	1513.8083	1513.8083	K	N	325	337
PSM	GLSQSALPYR	202	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3218	35.043	2	1204.6066	1204.6066	K	R	10	20
PSM	GPPSSSDSEPEAELER	203	sp|Q7Z4V5-2|HDGR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2391	29.017	2	1799.7675	1799.7675	R	E	392	408
PSM	GTSGSLADVFANTR	204	sp|Q9P265|DIP2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4267	42.803	2	1508.7085	1508.7085	K	I	199	213
PSM	ISHTDSSSDLSDCPSEPLSDEQR	205	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=2368	28.847	3	2675.1118	2675.1118	R	L	203	226
PSM	ITPSYVAFTPEGER	206	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4219	42.448	2	1679.802	1679.8020	R	L	61	75
PSM	KLQEESDLELAK	207	sp|O75822-2|EIF3J_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2574	30.347	2	1583.8908	1583.8908	K	E	122	134
PSM	LARVDSEGDFSENDDAAGDFR	208	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3418	36.524	3	2399.0127	2399.0127	K	S	318	339
PSM	NEINGNWISASSINEAR	209	sp|Q53EL6-2|PDCD4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=4438	44.074	2	2067.8876	2067.8876	K	I	27	44
PSM	QQEGESRLNLVQR	210	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2124	27.081	2	1669.8361	1669.8361	R	N	100	113
PSM	QQSVESLAEEVK	211	sp|Q8WXH0|SYNE2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3522	37.284	2	1493.7651	1493.7651	R	D	2779	2791
PSM	RMTGSEFDFEEMK	212	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4111	41.643	2	1753.7729	1753.7729	K	R	378	391
PSM	SSSTSDILEPFTVER	213	sp|Q6GYQ0-3|RGPA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5356	51.195	2	1780.8344	1780.8344	R	A	842	857
PSM	TEAQDLCRASPEPPGPESSSR	214	sp|Q9C0C2-2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=1853	25.088	3	2384.0528	2384.0528	R	W	114	135
PSM	TTPSVVAFTADGER	215	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3724	38.78	2	1563.7394	1563.7394	R	L	86	100
PSM	VIGSGCNLDSAR	216	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1408	21.805	2	1281.656	1281.6560	R	F	158	170
PSM	VMSQEIQEQLHK	217	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2778	31.836	2	1616.827	1616.8270	K	Q	3255	3267
PSM	VTDSSVSVQLRE	218	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=3315	35.764	2	1512.6686	1512.6686	R	-	264	276
PSM	WTSQDSLLGMEFSGR	219	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5157	49.593	2	1842.8072	1842.8072	K	D	1592	1607
PSM	TVSSSSLPSLEEYEPR	220	sp|P42694|HELZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=4847	47.18736833333333	2	1893.8779	1893.8816	R	G	1736	1752
PSM	QLLTLSSELSQAR	221	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=4956	48.034416666666665	2	1558.8157	1558.8175	R	D	530	543
PSM	SRSQSRSNSPLPVPPSK	222	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,1-UNIMOD:21,3-UNIMOD:21,9-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=1784	24.580513333333332	3	2130.9867	2130.9897	R	A	295	312
PSM	AHSSMVGVNLPQK	223	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:510	ms_run[1]:scan=1710	24.037944999999997	2	1530.787321	1530.790199	R	A	172	185
PSM	SFTSSSPSSPSRAKGGDDSK	224	sp|O94875|SRBS2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=4864	47.316143333333336	2	2226.818278	2223.812370	K	I	294	314
PSM	AALEALGSCLNNK	225	sp|P34897-3|GLYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=3825	39.528	2	1507.7742	1507.7742	R	Y	62	75
PSM	ALSRQEMQEVQSSR	226	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=1085	19.386	3	1777.8242	1777.8242	K	S	175	189
PSM	APSDSSLGTPSDGRPELR	227	sp|Q15642-5|CIP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2164	27.37	2	1954.921	1954.9210	R	G	294	312
PSM	ASSLEDLVLK	228	sp|Q15477|SKIV2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4797	46.8	2	1221.6894	1221.6894	R	E	254	264
PSM	DNLTLWTSDQQDEEAGEGN	229	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=4953	48.012	2	2154.9402	2154.9402	R	-	228	247
PSM	EQVANSAFVER	230	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1747	24.311	2	1282.673	1282.6730	K	V	492	503
PSM	EVANSTANLVK	231	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1855	25.103	2	1292.7014	1292.7014	K	T	1531	1542
PSM	EVDYSDSLTEK	232	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2348	28.7	2	1432.6647	1432.6647	K	Q	1343	1354
PSM	FARSLQSVAEER	233	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2364	28.819	2	1505.7452	1505.7452	K	A	94	106
PSM	LADFGFGNFYKSGEPLSTWCGSPPYAAPEVFEGK	234	sp|P57059|SIK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510,12-UNIMOD:21,17-UNIMOD:21,20-UNIMOD:4,34-UNIMOD:510	ms_run[2]:scan=6976	68.599	4	3986.8404	3986.8404	K	E	165	199
PSM	LYGPSSVSFADDFVR	235	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=5643	53.592	2	1772.8235	1772.8235	R	S	134	149
PSM	MSASDPNSSIFLTDTAK	236	sp|P23381-2|SYWC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4192	42.247	2	1931.9224	1931.9224	K	Q	309	326
PSM	NFSDNQLQEGK	237	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2232	27.86	2	1426.6766	1426.6766	R	N	182	193
PSM	QLLTLSSELSQAR	238	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4944	47.945	2	1558.818	1558.8180	R	D	530	543
PSM	SGYSEVNLSK	239	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2461	29.522	2	1230.617	1230.6170	R	L	1444	1454
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	240	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,14-UNIMOD:21,16-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4076	41.382	3	2993.3733	2993.3733	R	R	67	93
PSM	TPSSDVLVFDYTK	241	sp|Q09028-4|RBBP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4963	48.087	2	1618.8168	1618.8168	K	H	109	122
PSM	YADLTEDQLPSCESLK	242	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=4107	41.611	2	2015.9435	2015.9435	R	D	142	158
PSM	YRGMGSLDAMDK	243	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2682	31.131	2	1490.6935	1490.6935	K	H	411	423
PSM	TASGSSVTSLDGTR	244	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1843	25.013505	2	1451.6696	1451.6712	R	S	328	342
PSM	DRSSPPPGYIPDELHQVAR	245	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=3499	37.116725	3	2247.0863	2247.0892	R	N	161	180
PSM	VDSTTCLFPVEEK	246	sp|Q06210|GFPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[1]:scan=4416	43.90832833333333	2	1671.806758	1671.810326	R	A	259	272
PSM	AGDGDGWVSLAELR	247	sp|Q96D15|RCN3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=5658	53.747	2	1558.7241	1558.7241	R	A	90	104
PSM	AILVDLEPGTMDSVR	248	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=5321	50.917	2	1728.8582	1728.8582	R	S	63	78
PSM	AQELGHSQSALASAQR	249	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1380	21.596	3	1766.8525	1766.8525	K	E	1175	1191
PSM	ASPEPQRENASPAPGTTAEEAMSR	250	sp|P46379-5|BAG6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2048	26.525	3	2597.1641	2597.1641	R	G	957	981
PSM	CDFTQMSQYFK	251	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=5560	52.888	2	1601.6932	1601.6932	K	A	300	311
PSM	DATNVGDEGGFAPNILENK	252	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4636	45.596	2	2028.0436	2028.0436	K	E	203	222
PSM	DISSSLNSLADSNAR	253	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3859	39.779	2	1662.7674	1662.7674	R	E	50	65
PSM	DLADELALVDVIEDK	254	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6919	67.894	2	1724.972	1724.9720	K	L	43	58
PSM	ERLESLNIQR	255	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2740	31.559	2	1370.7131	1370.7131	K	E	546	556
PSM	EYQNEEDSLGGSRVVVCDINK	256	sp|Q5HYK3|COQ5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:21,17-UNIMOD:4,21-UNIMOD:510	ms_run[2]:scan=3411	36.471	3	2558.1996	2558.1996	K	E	154	175
PSM	FARLSEHATAPTR	257	sp|P33316-2|DUT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1381	21.603	3	1569.7877	1569.7877	R	G	28	41
PSM	FWEVISDEHGIDPTGTYHGDSDLQLDR	258	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=5173	49.714	4	3215.4297	3215.4297	K	I	20	47
PSM	GMGSLDAMDK	259	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:35,4-UNIMOD:21,8-UNIMOD:35,10-UNIMOD:510	ms_run[2]:scan=902	17.97	2	1203.5189	1203.5189	R	H	413	423
PSM	GMGSLDAMDK	260	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:35,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1701	23.973	2	1187.524	1187.5240	R	H	413	423
PSM	LGGSAVISLEGK	261	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4139	41.852	2	1277.7269	1277.7269	K	P	153	165
PSM	LYGPSSVSFADDFVR	262	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=6496	62.537	2	1852.7898	1852.7898	R	S	134	149
PSM	NLEAVETLGSTSTICSDK	263	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:4,18-UNIMOD:510	ms_run[2]:scan=4218	42.44	2	2072.0021	2072.0021	K	T	360	378
PSM	NRPTSISWDGLDSGK	264	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3699	38.595	2	1779.8829	1779.8829	K	L	48	63
PSM	NSDSIVSLPQSDR	265	sp|Q7Z460-2|CLAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2950	33.094	2	1530.7139	1530.7139	K	S	542	555
PSM	QEYDESGPSIVHR	266	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1574	23.036	3	1549.7585	1549.7585	K	K	360	373
PSM	QRSPSPAPAPAPAAAAGPPTR	267	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=1627	23.425	3	2161.0295	2161.0295	R	K	496	517
PSM	QYSLQNWEAR	268	sp|P48637-2|GSHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3803	39.363	2	1407.6396	1407.6396	R	L	163	173
PSM	RAPSVANVGSHCDLSLK	269	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:21,12-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=2739	31.553	3	2037.9745	2037.9745	R	I	2141	2158
PSM	RGESLDNLDSPR	270	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1740	24.259	2	1471.6881	1471.6881	R	S	1173	1185
PSM	RTMSEVGGSVEDLIAK	271	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4861	47.293	2	1918.9149	1918.9149	R	G	34	50
PSM	SDLSSSSGSLSLSHGSSSLEHR	272	sp|O15013-7|ARHGA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2419	29.217	3	2330.06	2330.0600	K	S	1216	1238
PSM	SGEPLSTWCGSPPYAAPEVFEGK	273	sp|P57059|SIK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4,23-UNIMOD:510	ms_run[2]:scan=5691	54.063	2	2613.2135	2613.2135	K	E	176	199
PSM	SGSWAAIYQDIR	274	sp|P18031|PTN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=5325	50.96	2	1479.6972	1479.6972	K	H	13	25
PSM	SSGSPYGGGYGSGGGSGGYGSRRF	275	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=2449	29.437	3	2326.9817	2326.9817	R	-	333	357
PSM	SSQSSSQQFSGIGR	276	sp|Q92841-1|DDX17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1998	26.156	2	1568.7044	1568.7044	R	S	592	606
PSM	SSSPVTELASR	277	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2237	27.897	2	1246.6019	1246.6019	R	S	1101	1112
PSM	TESVPSDINNPVDR	278	sp|Q8IVT5-4|KSR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2675	31.08	2	1655.7616	1655.7616	R	A	267	281
PSM	TTPSVVAFTADGER	279	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3943	40.401	2	1563.7394	1563.7394	R	L	86	100
PSM	YVGVSSDSVGGFR	280	sp|Q14677|EPN4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3250	35.282	2	1442.6655	1442.6655	K	Y	159	172
PSM	AILVDLEPGTMDSVR	281	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=5321	50.9166	2	1728.8557	1728.8576	R	S	63	78
PSM	TLSNAEDYLDDEDSD	282	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=4718	46.20258833333333	2	1814.6791	1814.6826	R	-	200	215
PSM	DSSTSPGDYVLSVSENSR	283	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4682	45.937733333333334	2	2012.8705	2012.8783	R	V	39	57
PSM	NRPTSISWDGLDSGK	284	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3699	38.594568333333335	2	1779.8778	1779.8824	K	L	48	63
PSM	SGSGTMNLGGSLTR	285	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=2718	31.397395	2	1450.6690	1450.6694	K	Q	182	196
PSM	YSSDYFQAPSDYR	286	sp|Q08380|LG3BP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3802	39.35603166666667	2	1711.696486	1711.697950	K	Y	442	455
PSM	TLSNAEDYLDDEDSD	287	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=4718	46.20258833333333	2	1814.679630	1814.683148	R	-	200	215
PSM	AASPPASASDLIEQQQK	288	sp|Q5VSL9-3|STRP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3293	35.602	3	1887.9616	1887.9616	R	R	69	86
PSM	AFGESSTESDEEEEEGCGHTHCVR	289	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=1526	22.684	4	2852.0751	2852.0751	R	G	69	93
PSM	AFSDPFVEAEK	290	sp|P34932-2|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4622	45.491	2	1386.6745	1386.6745	R	S	74	85
PSM	AQSYPDNHQEFSDYDNPIFEK	291	sp|Q9Y2U5|M3K2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=4487	44.441	3	2691.1803	2691.1803	R	F	237	258
PSM	CTLSDDCIPLTWR	292	sp|Q9NPF0-2|CD320_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:4,4-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=5470	52.1	2	1749.768	1749.7680	R	C	97	110
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	293	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=3277	35.482	3	3112.2782	3112.2782	K	L	595	622
PSM	DMGSCEIYPQTIQHNPNGR	294	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:35,4-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2561	30.251	3	2345.9982	2345.9982	K	F	318	337
PSM	DRSSPPPGYIPDELHQVAR	295	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3499	37.117	3	2247.0898	2247.0898	R	N	161	180
PSM	GGYIGSTYFER	296	sp|P61081|UBC12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4040	41.112	2	1362.6069	1362.6069	R	C	170	181
PSM	GLPWSCSADEVQR	297	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=4070	41.336	2	1617.7071	1617.7071	R	F	17	30
PSM	GMGSLDAMDK	298	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2958	33.154	2	1171.5291	1171.5291	R	H	413	423
PSM	GSQFGQSCCLR	299	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=2007	26.221	2	1412.579	1412.5790	K	A	329	340
PSM	HVGSNLCLDSR	300	sp|Q10471|GALT2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=1861	25.148	2	1370.6226	1370.6226	R	T	533	544
PSM	IGSTIFGER	301	sp|O94903|PLPHP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3647	38.214	2	1092.5429	1092.5429	R	D	242	251
PSM	IHRASDPGLPAEEPK	302	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1329	21.219	3	1763.9244	1763.9244	R	E	1855	1870
PSM	MNVSPDVNYEELAR	303	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4411	43.87	2	1749.7857	1749.7857	K	C	373	387
PSM	NPDDITNEEYGEFYK	304	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3767	39.096	2	1980.8667	1980.8667	R	S	422	437
PSM	NQVAMNPTNTVFDAK	305	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3322	35.814	2	1796.8805	1796.8805	K	R	57	72
PSM	QLSSSSSYSGDISR	306	sp|P33527-8|MRP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2042	26.479	2	1586.7038	1586.7038	R	H	798	812
PSM	QSSSSDTDLSLTPK	307	sp|Q86YS7|C2CD5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2531	30.029	2	1612.7869	1612.7869	R	T	303	317
PSM	RAESMLQQADK	308	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=798	16.962	2	1439.7116	1439.7116	K	L	291	302
PSM	SASFNTDPYVR	309	sp|Q9UKV8-2|AGO2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2925	32.912	2	1369.6128	1369.6128	R	E	385	396
PSM	SDIDEIVLVGGSTR	310	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4815	46.936	2	1573.7813	1573.7813	K	I	354	368
PSM	SGSGTMNLGGSLTR	311	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2718	31.397	2	1450.67	1450.6700	K	Q	182	196
PSM	SIYEGDESFRELSPVSFQYR	312	sp|Q6NW29|RWDD4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=5104	49.179	3	2522.1579	2522.1579	R	I	16	36
PSM	SRTLTAVHDAILEDLVFPSEIVGK	313	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,3-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=7138	71.029	3	2837.4654	2837.4654	R	R	119	143
PSM	TGSYGALAEITASK	314	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4383	43.663	2	1515.7858	1515.7858	K	E	356	370
PSM	TVSSSSLPSLEEYEPR	315	sp|P42694|HELZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4847	47.187	2	1893.8821	1893.8821	R	G	1736	1752
PSM	VEMYSGSDDDDDFNK	316	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3119	34.321	2	1883.7445	1883.7445	K	L	131	146
PSM	VLGTSVESIMATEDR	317	sp|P31327-2|CPSM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4727	46.274	2	1720.8167	1720.8167	K	Q	82	97
PSM	AHSSMVGVNLPQK	318	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=2871	32.51233333333333	2	1594.7578	1594.7611	R	A	172	185
PSM	LGRCESQSTLDPGAGEAR	319	sp|Q15818|NPTX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,4-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1650	23.594148333333333	3	2016.9134	2016.9143	K	A	86	104
PSM	LYGPSSVSFADDFVR	320	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=5643	53.592315	2	1772.822740	1772.823485	R	S	134	149
PSM	SRSFTLDDESLK	321	sp|Q86WR7|PRSR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2990	33.38627666666667	2	1544.7732	1544.7755	R	Y	41	53
PSM	TLYKKSSSEGIEDETGPPFHLK	322	sp|Q969M2|CXA10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:21,7-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=2015	26.279311666666665	2	2658.2352	2656.2282	R	K	241	263
PSM	GQSEDPGSLLSLFR	323	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=6453	61.945903333333334	2	1618.780721	1618.781620	K	R	511	525
PSM	SSSTSDILEPFTVER	324	sp|Q6GYQ0|RGPA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=5356	51.19548666666667	2	1780.832525	1780.834444	R	A	795	810
PSM	VEMYSGSDDDDDFNK	325	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3119	34.321486666666665	2	1883.741986	1883.744490	K	L	131	146
PSM	AHSIQIMK	326	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35,8-UNIMOD:510	ms_run[2]:scan=1059	19.185	2	1090.5883	1090.5883	R	V	121	129
PSM	AHSIQIMK	327	sp|Q02543|RL18A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=1581	23.089	2	1074.5933	1074.5933	R	V	121	129
PSM	ALSRQEMQEVQSSR	328	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=1088	19.407	2	1777.8242	1777.8242	K	S	175	189
PSM	ALSSDSILSPAPDAR	329	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3774	39.148	2	1612.7922	1612.7922	R	A	392	407
PSM	ASGNYATVISHNPETK	330	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2272	28.148	3	1835.9091	1835.9091	R	K	129	145
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	331	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2737	31.538	4	2483.1113	2483.1113	R	A	90	114
PSM	ATSEVPGSQASPNPVPGDGLHR	332	sp|Q96GM8-2|TOE1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2439	29.363	3	2286.0854	2286.0854	R	A	338	360
PSM	DISQDSLQDIK	333	sp|Q9Y4X5|ARI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3186	34.808	2	1408.7123	1408.7123	R	Q	512	523
PSM	DTNGSQFFITTVK	334	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4931	47.848	2	1604.8124	1604.8124	K	T	146	159
PSM	EDQTEYLEER	335	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1908	25.498	2	1344.6258	1344.6258	K	R	187	197
PSM	EQFLDGDGWTSR	336	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3807	39.395	2	1443.6843	1443.6843	K	W	25	37
PSM	FASENDLPEWK	337	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4460	44.24	2	1482.7068	1482.7068	R	E	58	69
PSM	FGSGMNMGR	338	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=1518	22.624	2	1085.4248	1085.4248	R	I	324	333
PSM	GILAADESTGSIAK	339	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3455	36.799	2	1559.7522	1559.7522	K	R	83	97
PSM	IEDVTPIPSDSTR	340	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2440	29.371	2	1542.7391	1542.7391	R	R	129	142
PSM	KEESEESDDDMGFGLFD	341	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=5985	57.127	2	2096.8446	2096.8446	K	-	73	90
PSM	KESYSIYVYK	342	sp|Q8N257|H2B3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2969	33.235	2	1460.8053	1460.8053	R	V	35	45
PSM	LCYVALDFEQEMATAASSSSLEK	343	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:4,17-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=6445	61.851	3	2697.2591	2697.2591	K	S	216	239
PSM	LLDFGSLSNLQVTQPTVGMNFK	344	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=6667	64.69	3	2556.3335	2556.3335	K	T	108	130
PSM	NSNLVGAAHEELQQSR	345	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=2529	30.015	3	1865.8845	1865.8845	R	I	182	198
PSM	QAPELSLSSQDLEVGGNQGH	346	sp|O00273-2|DFFA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4448	44.149	2	2179.0007	2179.0007	K	-	249	269
PSM	RSTQGVTLTDLQEAEK	347	sp|O14974-5|MYPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3070	33.962	3	1922.9987	1922.9987	R	T	607	623
PSM	SFGSTCQLSEK	348	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=2246	27.963	2	1390.6476	1390.6476	K	F	387	398
PSM	SFSSPENFQR	349	sp|Q9Y580|RBM7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2852	32.373	2	1311.5709	1311.5709	R	Q	134	144
PSM	SGSYSYLEER	350	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2670	31.045	2	1303.5546	1303.5546	R	K	821	831
PSM	SISNEGLTLNNSHVSK	351	sp|Q08AD1-2|CAMP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2570	30.318	3	1846.9462	1846.9462	R	H	435	451
PSM	SPSPPPSPPPLPSPPSLPSPAAPEAPELPEPAQPSEAHAR	352	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=5559	52.881	3	4173.9914	4173.9914	R	Q	31	71
PSM	SRTHSTSSSLGSGESPFSR	353	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2138	27.182	3	2159.9098	2159.9098	R	S	238	257
PSM	STAGDTHLGGEDFDNR	354	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1669	23.737	3	1724.7814	1724.7814	K	M	221	237
PSM	STLTDSLVCK	355	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4,10-UNIMOD:510	ms_run[2]:scan=2816	32.114	2	1270.6516	1270.6516	K	A	33	43
PSM	TASFSESRADEVAPAK	356	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1901	25.444	2	1812.8931	1812.8931	R	K	192	208
PSM	TASGSSVTSLDGTR	357	sp|Q92597-3|NDRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1843	25.014	2	1451.6717	1451.6717	R	S	247	261
PSM	TCSNVNWAR	358	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=1835	24.954	2	1220.5222	1220.5222	K	R	73	82
PSM	TTPSYVAFTDTER	359	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3253	35.304	2	1520.7571	1520.7571	R	L	37	50
PSM	TVSSSSLPSLEEYEPR	360	sp|P42694|HELZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=5318	50.893	2	1973.8485	1973.8485	R	G	1736	1752
PSM	GILAADESTGSIAK	361	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=3455	36.79898833333333	2	1559.7497	1559.7516	K	R	29	43
PSM	MSASDPNSSIFLTDTAK	362	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=4192	42.247065	2	1931.9162	1931.9219	K	Q	350	367
PSM	KEESEESDDDMGFGLFD	363	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=5985	57.12705333333333	2	2096.8400	2096.8441	K	-	98	115
PSM	ATSEVPGSQASPNPVPGDGLHR	364	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=2439	29.363456666666664	3	2286.0831	2286.0849	R	A	418	440
PSM	ELALPGELTQSR	365	sp|O75436|VP26A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=4377	43.617745	2	1426.7262	1426.7276	K	S	94	106
PSM	AGLNCSTENMPIK	366	sp|P05198|IF2A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,5-UNIMOD:4,6-UNIMOD:21,10-UNIMOD:35,13-UNIMOD:510	ms_run[1]:scan=1731	24.19249	2	1597.7496	1597.7512	R	I	214	227
PSM	STTPPPAEPVSLPQEPPKPR	367	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2895	32.69177	3	2272.2092	2272.2136	K	V	225	245
PSM	RMTGSEFDFEEMK	368	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,2-UNIMOD:35,5-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=3560	37.56734333333333	2	1769.763689	1769.767809	K	R	423	436
PSM	RSTQGVTLTDLQEAEK	369	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=3070	33.962475	3	1922.995876	1922.998672	R	T	694	710
PSM	ISHTDSSSDLSDCPSEPLSDEQR	370	sp|Q9Y4B5|MTCL1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=2368	28.847423333333335	3	2675.103711	2675.111818	R	L	203	226
PSM	AILVDLEPGTMDSVR	371	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=4774	46.628	2	1744.8531	1744.8531	R	S	63	78
PSM	AITGASLADIMAK	372	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:35,13-UNIMOD:510	ms_run[2]:scan=3772	39.134	2	1424.7623	1424.7623	R	R	81	94
PSM	DKDDDGGEDDDANCNLICGDEYGPETRLSMSQLNEK	373	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4,31-UNIMOD:21,36-UNIMOD:510	ms_run[2]:scan=4773	46.621	4	4256.8194	4256.8194	K	E	595	631
PSM	EMSGSTSELLIK	374	sp|Q9NS91|RAD18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3836	39.61	2	1441.7412	1441.7412	R	E	140	152
PSM	EPCLHPLEPDEVEYEPRGSR	375	sp|Q9UIQ6-3|LCAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:4,19-UNIMOD:21	ms_run[2]:scan=3263	35.377	3	2522.1361	2522.1361	K	L	14	34
PSM	GEPNVSYICSR	376	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2344	28.672	2	1394.6114	1394.6114	R	Y	273	284
PSM	HKSIEEIVR	377	sp|P39748-2|FEN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1307	21.053	2	1257.7119	1257.7119	K	R	189	198
PSM	HTLSYVDVGTGK	378	sp|P31040-3|SDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2292	28.293	2	1423.7385	1423.7385	K	V	480	492
PSM	IGSLIDVNQSK	379	sp|P61326-2|MGN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3196	34.883	2	1320.7327	1320.7327	K	D	67	78
PSM	INPDGSQSVVEVPYARSEAHLTELLEEICDR	380	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,17-UNIMOD:21,29-UNIMOD:4	ms_run[2]:scan=6295	60.268	4	3639.734	3639.7340	R	M	58	89
PSM	LTNSMMMHGR	381	sp|P46782|RS5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1818	24.831	3	1290.5497	1290.5497	R	N	72	82
PSM	NGRVEIIANDQGNR	382	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1253	20.652	3	1588.8494	1588.8494	K	I	47	61
PSM	NQSFCPTVNLDK	383	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=3404	36.419	2	1569.7535	1569.7535	R	L	66	78
PSM	NWYSDADVPASAR	384	sp|P10696|PPBN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3672	38.396	2	1564.6772	1564.6772	R	Q	186	199
PSM	RAESMLQQADK	385	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1537	22.765	2	1423.7167	1423.7167	K	L	291	302
PSM	RMTGSEFDFEEMK	386	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:35,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3560	37.567	2	1769.7678	1769.7678	K	R	378	391
PSM	RRESLSYIPK	387	sp|A1L390-2|PKHG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1596	23.197	3	1395.7912	1395.7912	R	G	271	281
PSM	RTESVPSDINNPVDR	388	sp|Q8IVT5-4|KSR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2049	26.532	3	1811.8627	1811.8627	R	A	266	281
PSM	SDSSQPMLLR	389	sp|P11532-9|DMD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=2238	27.904	2	1262.579	1262.5790	R	V	443	453
PSM	SESVEGFLSPSR	390	sp|Q08AD1-2|CAMP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4117	41.687	2	1407.6495	1407.6495	R	C	1284	1296
PSM	SGSMDPSGAHPSVR	391	sp|Q07666-3|KHDR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1139	19.794	3	1497.6496	1497.6496	R	Q	18	32
PSM	SGTSEFLNK	392	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2103	26.928	2	1129.5693	1129.5693	K	M	169	178
PSM	SMSTEGLMK	393	sp|O75390|CISY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:35,9-UNIMOD:510	ms_run[2]:scan=1582	23.096	2	1146.5338	1146.5338	K	F	451	460
PSM	SRSSDIVSSVR	394	sp|Q14C86-3|GAPD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1541	22.792	2	1305.6502	1305.6502	R	R	900	911
PSM	SRSSSPVTELASR	395	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2166	27.386	2	1569.7013	1569.7013	R	S	1099	1112
PSM	TISNPEVVMK	396	sp|P55196-2|AFAD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2782	31.866	2	1264.6775	1264.6775	R	R	213	223
PSM	TSTTGSILNLNLDR	397	sp|Q9ULU4-4|PKCB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4747	46.424	2	1617.8187	1617.8187	K	S	133	147
PSM	VIGSGCNLDSAR	398	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=1939	25.727	2	1361.6223	1361.6223	R	F	158	170
PSM	VTDSSVSVQLRE	399	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2968	33.228	2	1432.7023	1432.7023	R	-	264	276
PSM	YLRSVGDGETVEFDVVEGEK	400	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4763	46.544	3	2375.157	2375.1570	K	G	99	119
PSM	YVGESEANIRK	401	sp|P46459-2|NSF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1362	21.464	2	1412.7337	1412.7337	K	L	200	211
PSM	VEIIANDQGNR	402	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510	ms_run[1]:scan=1559	22.923426666666668	2	1261.6823	1261.6834	R	I	50	61
PSM	VEIIANDQGNRTTPSYVAFTDTER	403	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=4253	42.69924666666667	3	2810.325605	2810.333636	K	L	26	50
PSM	DKDDDGGEDDDANCNLICGDEYGPETRLSMSQLNEK	404	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4,29-UNIMOD:21,36-UNIMOD:510	ms_run[1]:scan=4773	46.620581666666666	4	4256.8052	4256.8192	K	E	595	631
PSM	VTDSSVSVQLRE	405	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=3315	35.764298333333336	2	1512.6660	1512.6681	R	-	264	276
PSM	TSTTGSILNLNLDR	406	sp|Q9ULU4|PKCB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=4747	46.42426666666667	2	1617.8153	1617.8182	K	S	509	523
PSM	PGTCPGGTFTPSMKSTK	407	sp|Q13275|SEM3F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	4-UNIMOD:4,10-UNIMOD:21,13-UNIMOD:35,14-UNIMOD:510,15-UNIMOD:21,16-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=4589	45.24548	2	2078.8432	2076.8372	R	D	409	426