MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100709_013PAK5_PAK7.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100709_013PAK5_PAK7.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	228-UNIMOD:510	0.09	44.0	7	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	204-UNIMOD:510,222-UNIMOD:510,213-UNIMOD:35,121-UNIMOD:510,126-UNIMOD:21,131-UNIMOD:510	0.14	38.0	5	2	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	38.0	null	431-UNIMOD:510	0.04	38.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	203-UNIMOD:510,221-UNIMOD:510,93-UNIMOD:510,94-UNIMOD:35,103-UNIMOD:510	0.07	37.0	2	2	2
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	463-UNIMOD:510,473-UNIMOD:21,482-UNIMOD:510	0.01	36.0	1	1	1
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	75-UNIMOD:510,84-UNIMOD:35	0.13	36.0	2	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	142-UNIMOD:510,176-UNIMOD:510,411-UNIMOD:510,458-UNIMOD:510,460-UNIMOD:21,467-UNIMOD:510	0.08	36.0	3	3	3
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	105-UNIMOD:510,106-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	721-UNIMOD:510,726-UNIMOD:4,727-UNIMOD:21,726-UNIMOD:510	0.02	36.0	3	2	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	223-UNIMOD:510,28-UNIMOD:510,28-UNIMOD:21	0.16	35.0	3	2	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	581-UNIMOD:510,591-UNIMOD:4,593-UNIMOD:21,594-UNIMOD:510,728-UNIMOD:510,728-UNIMOD:4,732-UNIMOD:21	0.03	35.0	2	2	2
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,331-UNIMOD:510,336-UNIMOD:21,339-UNIMOD:4,342-UNIMOD:510,332-UNIMOD:510	0.08	35.0	3	3	3
PRT	sp|Q969S3|ZN622_HUMAN	Zinc finger protein 622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	36-UNIMOD:510,38-UNIMOD:21,39-UNIMOD:35	0.03	35.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	239-UNIMOD:510,360-UNIMOD:510	0.08	34.0	3	2	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	264-UNIMOD:510,271-UNIMOD:21,282-UNIMOD:510,288-UNIMOD:21	0.07	34.0	3	2	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	180-UNIMOD:510,186-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	446-UNIMOD:510,446-UNIMOD:4,447-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9UI15|TAGL3_HUMAN	Transgelin-3 OS=Homo sapiens OX=9606 GN=TAGLN3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	183-UNIMOD:510,185-UNIMOD:21,189-UNIMOD:35,194-UNIMOD:35	0.08	32.0	3	1	0
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,466-UNIMOD:35,446-UNIMOD:510	0.03	32.0	2	2	2
PRT	sp|P29692-4|EF1D_HUMAN	Isoform 4 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	125-UNIMOD:510,143-UNIMOD:21,150-UNIMOD:510	0.10	32.0	1	1	1
PRT	sp|O00562-2|PITM1_HUMAN	Isoform 2 of Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	662-UNIMOD:510,664-UNIMOD:21,668-UNIMOD:4	0.02	32.0	1	1	0
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	32.0	2	1	0
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	323-UNIMOD:510	0.06	32.0	1	1	1
PRT	sp|O00562|PITM1_HUMAN	Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNM1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	null	662-UNIMOD:510,665-UNIMOD:21,668-UNIMOD:4	0.02	32.0	1	1	0
PRT	sp|P27448-8|MARK3_HUMAN	Isoform 7 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	39-UNIMOD:510,39-UNIMOD:4,42-UNIMOD:21,46-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q9H1E3-2|NUCKS_HUMAN	Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	89-UNIMOD:510,98-UNIMOD:35,110-UNIMOD:510	0.11	31.0	1	1	1
PRT	sp|Q5T1M5-2|FKB15_HUMAN	Isoform 2 of FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	1151-UNIMOD:510,1152-UNIMOD:21,1163-UNIMOD:510	0.01	31.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	null	39-UNIMOD:510,41-UNIMOD:21	0.06	31.0	1	1	0
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	39-UNIMOD:510,43-UNIMOD:21	0.09	30.0	1	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	253-UNIMOD:510,265-UNIMOD:510	0.02	30.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	478-UNIMOD:510,482-UNIMOD:21,494-UNIMOD:4,484-UNIMOD:21,480-UNIMOD:21	0.01	30.0	3	1	0
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	322-UNIMOD:510,325-UNIMOD:21,328-UNIMOD:4,334-UNIMOD:510	0.03	30.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	57-UNIMOD:510,73-UNIMOD:510	0.10	30.0	1	1	1
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	288-UNIMOD:510,290-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	325-UNIMOD:510,336-UNIMOD:510,330-UNIMOD:35	0.03	29.0	2	1	0
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	58-UNIMOD:510,65-UNIMOD:21	0.09	29.0	1	1	1
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	269-UNIMOD:510,295-UNIMOD:21,298-UNIMOD:510	0.06	29.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	292-UNIMOD:510,306-UNIMOD:510,379-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,492-UNIMOD:510,613-UNIMOD:510,623-UNIMOD:510,457-UNIMOD:510,459-UNIMOD:21,466-UNIMOD:35,54-UNIMOD:510,58-UNIMOD:21,64-UNIMOD:510,457-UNIMOD:21	0.15	29.0	9	8	7
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	207-UNIMOD:510	0.14	29.0	1	1	1
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	60-UNIMOD:510	0.27	29.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	223-UNIMOD:510	0.09	28.0	2	1	0
PRT	sp|P13645|K1C10_HUMAN	Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	null	37-UNIMOD:510,40-UNIMOD:21	0.02	28.0	1	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	27.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	7-UNIMOD:510,8-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	891-UNIMOD:510,893-UNIMOD:21,911-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|P13807-2|GYS1_HUMAN	Isoform 2 of Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	644-UNIMOD:510,646-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	221-UNIMOD:510,37-UNIMOD:510,160-UNIMOD:510,163-UNIMOD:21	0.09	27.0	4	3	1
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	762-UNIMOD:510,768-UNIMOD:21,762-UNIMOD:21,767-UNIMOD:21	0.03	27.0	3	1	0
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	193-UNIMOD:510	0.12	26.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,547-UNIMOD:510,558-UNIMOD:510,192-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510	0.08	26.0	4	4	4
PRT	sp|Q8NBJ7-2|SUMF2_HUMAN	Isoform 2 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	166-UNIMOD:510,168-UNIMOD:21	0.08	26.0	2	1	0
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	145-UNIMOD:510,147-UNIMOD:21,151-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	26.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	268-UNIMOD:510,270-UNIMOD:21,193-UNIMOD:510,199-UNIMOD:21,205-UNIMOD:4	0.10	26.0	2	2	2
PRT	sp|O43865-2|SAHH2_HUMAN	Isoform 2 of S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	15-UNIMOD:510,17-UNIMOD:21,19-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	null	9-UNIMOD:510,21-UNIMOD:510	0.13	26.0	1	1	1
PRT	sp|Q9HCN4|GPN1_HUMAN	GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	298-UNIMOD:510,301-UNIMOD:21,310-UNIMOD:510	0.04	26.0	1	1	1
PRT	sp|P05787-2|K2C8_HUMAN	Isoform 2 of Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	357-UNIMOD:510,358-UNIMOD:21,314-UNIMOD:510,319-UNIMOD:21,323-UNIMOD:510	0.05	25.0	2	2	2
PRT	sp|P61158|ARP3_HUMAN	Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	229-UNIMOD:510,232-UNIMOD:21,235-UNIMOD:4,240-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|P61081|UBC12_HUMAN	NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	170-UNIMOD:510,175-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	376-UNIMOD:510,378-UNIMOD:21,387-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|Q12805-5|FBLN3_HUMAN	Isoform 5 of EGF-containing fibulin-like extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=EFEMP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	137-UNIMOD:510,138-UNIMOD:21,141-UNIMOD:4,143-UNIMOD:4,149-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	25.0	1	1	1
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	276-UNIMOD:510,286-UNIMOD:21,288-UNIMOD:4,290-UNIMOD:510	0.02	25.0	1	1	0
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	25.0	2	1	0
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	756-UNIMOD:510,760-UNIMOD:21,770-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|O15013-7|ARHGA_HUMAN	Isoform 3 of Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	1166-UNIMOD:510,1169-UNIMOD:21,1182-UNIMOD:510,1166-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	1369-UNIMOD:510,1375-UNIMOD:21,1376-UNIMOD:4,1381-UNIMOD:510	0.01	24.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	225-UNIMOD:510,229-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	542-UNIMOD:510,544-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q6IBS0|TWF2_HUMAN	Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	137-UNIMOD:510,139-UNIMOD:21,141-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	244-UNIMOD:510,249-UNIMOD:21,255-UNIMOD:4,256-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	8-UNIMOD:510,23-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	394-UNIMOD:510,396-UNIMOD:21,404-UNIMOD:510	0.01	24.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	448-UNIMOD:510,452-UNIMOD:21,464-UNIMOD:510,61-UNIMOD:510,64-UNIMOD:21,563-UNIMOD:510,573-UNIMOD:510,102-UNIMOD:510,113-UNIMOD:510	0.09	24.0	4	4	4
PRT	sp|Q15052-2|ARHG6_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	495-UNIMOD:510,495-UNIMOD:21,507-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	439-UNIMOD:510,443-UNIMOD:21,456-UNIMOD:510,442-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|Q9BTC0-1|DIDO1_HUMAN	Isoform 1 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	1024-UNIMOD:510,1026-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	332-UNIMOD:510,341-UNIMOD:21,344-UNIMOD:4,346-UNIMOD:510	0.02	24.0	1	1	0
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	223-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	107-UNIMOD:510,110-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	10-UNIMOD:510,12-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|O15357-2|SHIP2_HUMAN	Isoform 2 of Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	931-UNIMOD:510,934-UNIMOD:21,945-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P49419-4|AL7A1_HUMAN	Isoform 4 of Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	82-UNIMOD:510,84-UNIMOD:21,93-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|Q14671-4|PUM1_HUMAN	Isoform 4 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	648-UNIMOD:510,650-UNIMOD:21,659-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	65-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510	0.09	23.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	286-UNIMOD:510,288-UNIMOD:21,299-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	652-UNIMOD:510,652-UNIMOD:21	0.02	23.0	1	1	0
PRT	sp|Q9P286|PAK5_HUMAN	Serine/threonine-protein kinase PAK 5 OS=Homo sapiens OX=9606 GN=PAK5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	602-UNIMOD:510,602-UNIMOD:21,571-UNIMOD:510,568-UNIMOD:510,570-UNIMOD:510,573-UNIMOD:21	0.04	23.0	3	3	3
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	22-UNIMOD:510,26-UNIMOD:4,27-UNIMOD:4,28-UNIMOD:21,44-UNIMOD:4,24-UNIMOD:21	0.06	23.0	2	1	0
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q8NBS9-2|TXND5_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	315-UNIMOD:510,318-UNIMOD:21,321-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	11-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|Q9Y6E0-2|STK24_HUMAN	Isoform A of Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	418-UNIMOD:510,422-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	70-UNIMOD:510,78-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	80-UNIMOD:510,82-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	92-UNIMOD:510,94-UNIMOD:21,105-UNIMOD:510,81-UNIMOD:510	0.02	22.0	2	2	2
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	40-UNIMOD:510,50-UNIMOD:510,52-UNIMOD:21,61-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|P23142|FBLN1_HUMAN	Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	242-UNIMOD:510,242-UNIMOD:4,248-UNIMOD:4,250-UNIMOD:21,260-UNIMOD:4,261-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q9HA77|SYCM_HUMAN	Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=CARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	542-UNIMOD:510,548-UNIMOD:21,545-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	74-UNIMOD:510	0.11	21.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	123-UNIMOD:510,126-UNIMOD:21,130-UNIMOD:35,22-UNIMOD:510,24-UNIMOD:21,35-UNIMOD:510	0.06	21.0	3	2	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	295-UNIMOD:510,305-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|Q7Z7N9|T179B_HUMAN	Transmembrane protein 179B OS=Homo sapiens OX=9606 GN=TMEM179B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	200-UNIMOD:510,217-UNIMOD:21	0.10	21.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510,82-UNIMOD:510,92-UNIMOD:510	0.15	21.0	2	2	2
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q13625-2|ASPP2_HUMAN	Isoform 2 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	612-UNIMOD:510,614-UNIMOD:21,628-UNIMOD:510	0.02	21.0	1	1	0
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	240-UNIMOD:510,242-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	930-UNIMOD:510,930-UNIMOD:21,941-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	131-UNIMOD:510,131-UNIMOD:21,135-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	232-UNIMOD:510,233-UNIMOD:21,245-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	86-UNIMOD:510,89-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	815-UNIMOD:510,817-UNIMOD:21,819-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q13625|ASPP2_HUMAN	Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	735-UNIMOD:510,736-UNIMOD:21,751-UNIMOD:510	0.02	21.0	1	1	0
PRT	sp|Q9NR19|ACSA_HUMAN	Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens OX=9606 GN=ACSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	26-UNIMOD:510,28-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q16513-5|PKN2_HUMAN	Isoform 5 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	25-UNIMOD:510,27-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	104-UNIMOD:510,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:510	0.12	20.0	1	1	1
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	196-UNIMOD:510,197-UNIMOD:21,211-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	480-UNIMOD:510,483-UNIMOD:21,491-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	853-UNIMOD:510,855-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q5TAX3|TUT4_HUMAN	Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	1380-UNIMOD:510,1383-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	186-UNIMOD:510,188-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	700-UNIMOD:510,704-UNIMOD:21	0.02	20.0	1	1	0
PRT	sp|P63146|UBE2B_HUMAN	Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	140-UNIMOD:510,142-UNIMOD:21	0.09	20.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	340-UNIMOD:510,342-UNIMOD:21,353-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|Q9UQ35-2|SRRM2_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	846-UNIMOD:510,846-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	97-UNIMOD:510,100-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|Q07866-8|KLC1_HUMAN	Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	521-UNIMOD:510,524-UNIMOD:21,531-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	100-UNIMOD:510,105-UNIMOD:4	0.05	20.0	1	1	1
PRT	sp|P25789|PSA4_HUMAN	Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	5-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q8TEW0|PARD3_HUMAN	Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	713-UNIMOD:510,715-UNIMOD:21	0.01	20.0	1	1	0
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	273-UNIMOD:510,279-UNIMOD:21,281-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q5VSL9-3|STRP1_HUMAN	Isoform 3 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	69-UNIMOD:510,71-UNIMOD:21,85-UNIMOD:510	0.04	19.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	264-UNIMOD:510,271-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9UHP3|UBP25_HUMAN	Ubiquitin carboxyl-terminal hydrolase 25 OS=Homo sapiens OX=9606 GN=USP25 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	105-UNIMOD:510,109-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	128-UNIMOD:510,128-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	85-UNIMOD:510,91-UNIMOD:4,97-UNIMOD:510	0.06	19.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	28-UNIMOD:510,35-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|Q9H3Q1-2|BORG4_HUMAN	Isoform 2 of Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	236-UNIMOD:510,239-UNIMOD:21,243-UNIMOD:4	0.06	19.0	1	1	0
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	44-UNIMOD:510	0.12	19.0	1	1	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	110-UNIMOD:510,113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4,128-UNIMOD:510	0.07	19.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	119-UNIMOD:510,125-UNIMOD:21,128-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	14-UNIMOD:510	0.06	19.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	143-UNIMOD:510,152-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	52-UNIMOD:21,62-UNIMOD:510,48-UNIMOD:510	0.09	19.0	2	2	2
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	378-UNIMOD:510,379-UNIMOD:35,380-UNIMOD:21,390-UNIMOD:510	0.04	19.0	1	1	1
PRT	sp|Q86WR7-2|PRSR2_HUMAN	Isoform 2 of Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	41-UNIMOD:510,43-UNIMOD:21,52-UNIMOD:510	0.04	19.0	1	1	1
PRT	sp|Q9UBP0|SPAST_HUMAN	Spastin OS=Homo sapiens OX=9606 GN=SPAST PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	91-UNIMOD:510,92-UNIMOD:21	0.04	19.0	1	1	0
PRT	sp|O60293|ZC3H1_HUMAN	Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	38-UNIMOD:510,38-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	114-UNIMOD:510	0.13	19.0	1	1	1
PRT	sp|O14829|PPE1_HUMAN	Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens OX=9606 GN=PPEF1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	305-UNIMOD:35,307-UNIMOD:21,315-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9UIQ6|LCAP_HUMAN	Leucyl-cystinyl aminopeptidase OS=Homo sapiens OX=9606 GN=LNPEP PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	668-UNIMOD:510,670-UNIMOD:21,676-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	129-UNIMOD:510,130-UNIMOD:21,144-UNIMOD:510	0.07	18.0	1	1	1
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	519-UNIMOD:510,521-UNIMOD:21,532-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	81-UNIMOD:510,89-UNIMOD:21	0.14	18.0	1	1	1
PRT	sp|P51570|GALK1_HUMAN	Galactokinase OS=Homo sapiens OX=9606 GN=GALK1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	229-UNIMOD:510,230-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	380-UNIMOD:510,385-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	38-UNIMOD:510,41-UNIMOD:21,178-UNIMOD:510,181-UNIMOD:21,187-UNIMOD:21,198-UNIMOD:510	0.06	18.0	2	2	2
PRT	sp|P30044-4|PRDX5_HUMAN	Isoform 4 of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	91-UNIMOD:510,93-UNIMOD:21,94-UNIMOD:35,102-UNIMOD:510	0.10	18.0	1	1	1
PRT	sp|P11274-2|BCR_HUMAN	Isoform 2 of Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1218-UNIMOD:510,1220-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1862-UNIMOD:510,1865-UNIMOD:21,1884-UNIMOD:510	0.01	18.0	1	1	1
PRT	sp|Q9UBP0-4|SPAST_HUMAN	Isoform 4 of Spastin OS=Homo sapiens OX=9606 GN=SPAST	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	5-UNIMOD:510,7-UNIMOD:21	0.05	18.0	1	1	0
PRT	sp|Q5VZK9-2|CARL1_HUMAN	Isoform 2 of F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	966-UNIMOD:510,968-UNIMOD:21,980-UNIMOD:510	0.01	18.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	55-UNIMOD:510,63-UNIMOD:510	0.08	18.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	264-UNIMOD:510,267-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q92614-5|MY18A_HUMAN	Isoform 5 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1562-UNIMOD:510,1563-UNIMOD:21,1575-UNIMOD:510	0.01	18.0	1	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	900-UNIMOD:510,900-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9H3Q1|BORG4_HUMAN	Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	306-UNIMOD:510,308-UNIMOD:21,313-UNIMOD:4	0.05	18.0	1	1	0
PRT	sp|Q92614|MY18A_HUMAN	Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	2035-UNIMOD:510,2035-UNIMOD:21,2048-UNIMOD:510	0.01	18.0	1	1	0
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	225-UNIMOD:510,227-UNIMOD:21,242-UNIMOD:510	0.05	18.0	1	1	1
PRT	sp|Q86X27|RGPS2_HUMAN	Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Homo sapiens OX=9606 GN=RALGPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	315-UNIMOD:510,315-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q7Z7L1|SLN11_HUMAN	Schlafen family member 11 OS=Homo sapiens OX=9606 GN=SLFN11 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	49-UNIMOD:510,51-UNIMOD:4,56-UNIMOD:21,63-UNIMOD:35	0.02	18.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	44.0	1-UNIMOD:510	ms_run[1]:scan=4515	50.87003833333333	2	2226.932706	2226.936145	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510	ms_run[2]:scan=4605	51.915	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	3	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4386	49.427	2	2248.059	2248.0590	R	E	204	223
PSM	DYEEVGADSADGEDEGEEY	4	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:510	ms_run[1]:scan=3483	40.109655	2	2111.7979	2111.8022	K	-	431	450
PSM	DATNVGDEGGFAPNILENK	5	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4262	47.984	2	2028.0436	2028.0436	K	E	203	222
PSM	DNLTLWTSDQQDDDGGEGNN	6	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=4687	52.944	2	2226.9361	2226.9361	R	-	228	248
PSM	AGEEDEGEEDSDSDYEISAK	7	sp|A2RRP1-2|NBAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2341	30.554	2	2321.9221	2321.9221	R	A	463	483
PSM	DWEDDSDEDMSNFDR	8	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=3886	44.175	2	1908.7168	1908.7168	K	F	75	90
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	9	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,35-UNIMOD:510	ms_run[2]:scan=3002	36.068	3	4220.6251	4220.6251	K	A	142	177
PSM	NSYVAGQYDDAASYQR	10	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2764	33.989	2	1920.8104	1920.8104	R	L	105	121
PSM	QNPSRCSVSLSNVEAR	11	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,6-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=2000	27.845	2	1916.8988	1916.8988	R	R	721	737
PSM	DNLTLWTSDTQGDEAEAGEGGEN	12	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=4650	52.479	3	2442.0519	2442.0519	R	-	223	246
PSM	ETVSEESNVLCLSK	13	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,11-UNIMOD:4,13-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3506	40.307	2	1741.8482	1741.8482	R	S	581	595
PSM	GILAADESTGSIAK	14	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2701	33.485	2	1479.7858	1479.7858	K	R	29	43
PSM	VASMAPVTAEGFQER	15	sp|Q969S3|ZN622_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=2638	32.958	2	1721.7908	1721.7908	K	V	36	51
PSM	SYELPDGQVITIGNER	16	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4521	50.919	2	1823.9478	1823.9478	K	F	239	255
PSM	TPEELDDSDFETEDFDVR	17	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4641	52.404	2	2271.9157	2271.9157	R	S	264	282
PSM	INSSGESGDESDEFLQSR	18	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3137	37.156	2	2069.8639	2069.8639	R	K	180	198
PSM	CSVLAAANPVYGR	19	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21	ms_run[2]:scan=3433	39.64	2	1490.7165	1490.7165	R	Y	446	459
PSM	DWEDDSDEDMSNFDR	20	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2969	35.8	2	1924.7117	1924.7117	K	F	75	90
PSM	GASQAGMTGYGMPR	21	sp|Q9UI15|TAGL3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=1942	27.399	2	1512.6315	1512.6315	K	Q	183	197
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	22	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=1755	25.971	3	2863.2161	2863.2161	K	M	445	470
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	23	sp|P29692-4|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,19-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3884	44.16	3	3090.3451	3090.3451	K	E	125	151
PSM	RASTAFCPPAASSEAPDGPSSTAR	24	sp|O00562-2|PITM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2190	29.316	3	2504.1215	2504.1215	R	L	662	686
PSM	RVSVCAETYNPDEEEEDTDPR	25	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2571	32.381	2	2624.0798	2624.0798	R	V	97	118
PSM	SVTEQGAELSNEER	26	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1840	26.623	2	1661.7358	1661.7358	K	N	28	42
PSM	TAENATSGETLEENEAGD	27	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=1778	26.148	2	1870.8128	1870.8128	K	-	323	341
PSM	RASTAFCPPAASSEAPDGPSSTAR	28	sp|O00562|PITM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=2190	29.316115000000003	3	2504.117304	2504.121535	R	L	662	686
PSM	CRNSIASCADEQPHIGNYR	29	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,1-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=1958	27.52	3	2361.0204	2361.0204	R	L	39	58
PSM	DNLTLWTSDMQGDGEEQNK	30	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3755	42.946	2	2264.0539	2264.0539	R	E	204	223
PSM	DSGSDEDFLMEDDDDSDYGSSK	31	sp|Q9H1E3-2|NUCKS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:35,22-UNIMOD:510	ms_run[2]:scan=3611	41.309	2	2511.9868	2511.9868	K	K	89	111
PSM	SSLSGDEEDELFK	32	sp|Q5T1M5-2|FKB15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,2-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3954	44.816	2	1602.7338	1602.7338	R	G	1151	1164
PSM	VASMAPVTAEGFQER	33	sp|Q969S3|ZN622_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3415	39.502	2	1705.7959	1705.7959	K	V	36	51
PSM	DSSTSPGDYVLSVSENSR	34	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=4357	49.05249	2	2012.875936	2012.878828	R	V	39	57
PSM	DSSTSPGDYVLSVSENSR	35	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4357	49.052	2	2012.8788	2012.8788	R	V	39	57
PSM	EEASDYLELDTIK	36	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4102	46.198	2	1592.8458	1592.8458	K	N	253	266
PSM	QLSSSVTGLTNIEEENCQR	37	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=3839	43.672	2	2278.0361	2278.0361	K	Y	478	497
PSM	QVQSLTCEVDALK	38	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=4150	46.713	2	1637.8372	1637.8372	R	G	322	335
PSM	RVSVCAETYNPDEEEEDTDPR	39	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2550	32.22	3	2624.0798	2624.0798	R	V	97	118
PSM	SLDSDESEDEEDDYQQK	40	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,17-UNIMOD:510	ms_run[2]:scan=1670	25.288	2	2098.8975	2098.8975	K	R	57	74
PSM	ELSLAGNELGDEGAR	41	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3689	42.235	2	1643.7616	1643.7616	K	L	288	303
PSM	EVDEQMLNVQNK	42	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2593	32.549	2	1513.8083	1513.8083	K	N	325	337
PSM	GASQAGMTGYGMPR	43	sp|Q9UI15|TAGL3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2745	33.843	2	1496.6366	1496.6366	K	Q	183	197
PSM	INPDGSQSVVEVPYAR	44	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3583	41.05	2	1843.893	1843.8930	R	S	58	74
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	45	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	ms_run[2]:scan=1402	23.189	3	3241.4532	3241.4532	K	E	269	299
PSM	NPDDITQEEYGEFYK	46	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3745	42.851	2	1914.916	1914.9160	R	S	292	307
PSM	SVTEQGAELSNEER	47	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=1409	23.247	2	1581.7695	1581.7695	K	N	28	42
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	48	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=4494	50.682	3	3490.5054	3490.5054	R	-	207	238
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	49	sp|Q9BXV9|GON7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=2721	33.657	3	2865.1757	2865.1757	R	T	60	86
PSM	DNLTLWTSENQGDEGDAGEGEN	50	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=4493	50.675	3	2384.01	2384.0100	R	-	223	245
PSM	EVDEQMLNVQNK	51	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1587	24.653	2	1529.8032	1529.8032	K	N	325	337
PSM	GSLGGGFSSGGFSGGSFSR	52	sp|P13645|K1C10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3533	40.621	2	1706.7649	1706.7649	K	G	41	60
PSM	TDYNASVSVPDSSGPER	53	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2572	32.389	2	1893.8206	1893.8206	R	I	70	87
PSM	TTPSYVAFTDTER	54	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=3490	40.179111666666664	2	1600.7219	1600.7229	R	L	37	50
PSM	AFLAELEQNSPK	55	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3915	44.432	2	1493.7803	1493.7803	K	I	2424	2436
PSM	GTVTDFPGFDER	56	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4104	46.215	2	1453.6339	1453.6339	R	A	7	19
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	57	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2756	33.927	3	2685.0632	2685.0632	K	M	446	470
PSM	RDSLGAYASQDANEQGQDLGK	58	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=2543	32.167	3	2370.1125	2370.1125	K	R	891	912
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	59	sp|P13807-2|GYS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3354	39.003	3	3219.4993	3219.4993	K	-	644	674
PSM	STAGDTHLGGEDFDNR	60	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=1554	24.401	2	1724.7814	1724.7814	K	M	221	237
PSM	TLNDRSSIVMGEPISQSSSNSQ	61	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3328	38.802	2	2450.1209	2450.1209	R	-	762	784
PSM	DNLTLWTADNAGEEGGEAPQEPQS	62	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4666	52.671	3	2562.157	2562.1570	R	-	193	217
PSM	DNLTLWTSDQQDDDGGEGNN	63	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4602	51.876	3	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	64	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4695	53.023	3	2226.9361	2226.9361	R	-	228	248
PSM	ESEDKPEIEDVGSDEEEEK	65	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=1913	27.184	3	2294.1022	2294.1022	K	K	251	270
PSM	GASWIDTADGSANHR	66	sp|Q8NBJ7-2|SUMF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2731	33.735	2	1670.7262	1670.7262	R	A	166	181
PSM	HSSLAGCQIINYR	67	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2687	33.374	2	1631.7703	1631.7703	R	T	145	158
PSM	KEESEESDDDMGFGLFD	68	sp|P05386-2|RLA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4179	47.009	2	2032.8732	2032.8732	K	-	73	90
PSM	LISWYDNEFGYSNR	69	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4967	56.894	2	1876.8245	1876.8245	K	V	268	282
PSM	QLSSSVTGLTNIEEENCQR	70	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=3835	43.639	3	2278.0361	2278.0361	K	Y	478	497
PSM	SLSRSISQSSTDSYSSAASYTDSSDDEVSPR	71	sp|O43865-2|SAHH2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=3595	41.142	3	3465.4194	3465.4194	R	E	15	46
PSM	TAFQEALDAAGDK	72	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[1]:scan=3124	37.05956833333334	2	1403.756625	1403.756894	K	L	9	22
PSM	DMGSVALDAGTAK	73	sp|Q9HCN4|GPN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=3414	39.495575	2	1382.6778	1382.6784	K	D	298	311
PSM	ASLEAAIADAEQR	74	sp|P05787-2|K2C8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4178	47.002	2	1457.6976	1457.6976	R	G	357	370
PSM	ERYSYVCPDLVK	75	sp|P61158|ARP3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=3071	36.665	2	1675.8317	1675.8317	K	E	229	241
PSM	GGYIGSTYFER	76	sp|P61081|UBC12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3819	43.482	2	1362.6069	1362.6069	R	C	170	181
PSM	GRSFAGNLNTYK	77	sp|Q01813-2|PFKAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2083	28.479	2	1474.7606	1474.7606	R	R	376	388
PSM	GSFACQCPPGYQK	78	sp|Q12805-5|FBLN3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2037	28.124	2	1646.7259	1646.7259	R	R	137	150
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	79	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4703	53.143	3	2995.386	2995.3860	R	G	2913	2938
PSM	NLFEDQNTLTSICEK	80	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:510	ms_run[2]:scan=4361	49.084	2	1958.9333	1958.9333	K	V	276	291
PSM	RLSQSDEDVIR	81	sp|Q9H7D7-3|WDR26_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1613	24.852	2	1430.6979	1430.6979	K	L	119	130
PSM	SAADSISESVPVGPK	82	sp|P45974-2|UBP5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2880	34.961	2	1590.8179	1590.8179	R	V	756	771
PSM	SRDSLAPGPEPQDEDQK	83	sp|O15013-7|ARHGA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1267	22.05	2	2015.9474	2015.9474	K	D	1166	1183
PSM	VPTANVSVVDLTCR	84	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3741	42.821	2	1643.8166	1643.8166	R	L	193	207
PSM	GVVDSEDLPLNISR	85	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510	ms_run[1]:scan=3887	44.18286833333333	2	1546.8392	1546.8410	R	E	379	393
PSM	QLSSSVTGLTNIEEENCQR	86	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=3835	43.639428333333335	3	2278.0332	2278.0355	K	Y	478	497
PSM	AELFTQSCADLDK	87	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=3649	41.747	2	1644.7743	1644.7743	K	W	1369	1382
PSM	CLYASVLTAQPR	88	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=3975	45.016	2	1491.7369	1491.7369	R	L	728	740
PSM	DNLTLWTSDQQDDDGGEGNN	89	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=6258	81.863	2	2226.9361	2226.9361	R	-	228	248
PSM	EGLELPEDEEEK	90	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2733	33.749	2	1483.7566	1483.7566	K	K	547	559
PSM	ENRESLVVNYEDLAAR	91	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3806	43.384	2	1990.9574	1990.9574	K	E	225	241
PSM	HGSYEDAVHSGALND	92	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1860	26.779	2	1684.6943	1684.6943	K	-	542	557
PSM	HLSSCAAPAPLTSAER	93	sp|Q6IBS0|TWF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=1945	27.419	2	1780.8392	1780.8392	K	E	137	153
PSM	IIYGGSVTGATCK	94	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2381	30.874	2	1473.7575	1473.7575	R	E	244	257
PSM	LIAPVAEEEATVPNNK	95	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2824	34.47	2	1762.0149	1762.0149	K	I	8	24
PSM	RMSLIEEEGSK	96	sp|P06737-2|PYGL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2104	28.633	2	1425.7211	1425.7211	R	R	394	405
PSM	SIYYITGESK	97	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2590	32.525	2	1227.7023	1227.7023	K	E	482	492
PSM	SQIFSTASDNQPTVTIK	98	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3891	44.228	2	1984.0191	1984.0191	K	V	448	465
PSM	STAALEEDAQILK	99	sp|Q15052-2|ARHG6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4033	45.522	2	1535.812	1535.8120	K	V	495	508
PSM	SVPTSTVFYPSDGVATEK	100	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4004	45.261	2	2032.0078	2032.0078	R	A	439	457
PSM	TTPSYVAFTDTER	101	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=3099	36.875	2	1520.7571	1520.7571	R	L	37	50
PSM	YLSVPPSPNISTSESR	102	sp|Q9BTC0-1|DIDO1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3368	39.13	2	1846.8926	1846.8926	R	S	1024	1040
PSM	NLFEDQNTLTSICEK	103	sp|P55060|XPO2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:510	ms_run[1]:scan=4361	49.083675	2	1958.930759	1958.933295	K	V	332	347
PSM	ATAGDTHLGGEDFDNR	104	sp|P48741|HSP77_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1592	24.693	3	1708.7865	1708.7865	K	L	223	239
PSM	DAGTIAGLNVLR	105	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4712	53.269	2	1312.6964	1312.6964	K	I	160	172
PSM	DVLSVAFSSDNR	106	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4803	54.516	2	1422.6604	1422.6604	K	Q	107	119
PSM	EVFEDAAEIR	107	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2739	33.797	2	1211.6246	1211.6246	K	L	411	421
PSM	GLSQSALPYR	108	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3088	36.79	2	1204.6066	1204.6066	K	R	10	20
PSM	IRESIQEDLAEEAPCLQGGR	109	sp|O15357-2|SHIP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=3991	45.156	3	2384.1256	2384.1256	R	A	931	951
PSM	ITPSYVAFTPEGER	110	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3942	44.678	2	1679.802	1679.8020	R	L	61	75
PSM	QASVADYEETVK	111	sp|P49419-4|AL7A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2440	31.375	2	1486.7229	1486.7229	R	K	82	94
PSM	RDSLTGSSDLYK	112	sp|Q14671-4|PUM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1843	26.645	2	1488.7498	1488.7498	R	R	648	660
PSM	RNQSFCPTVNLDK	113	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2468	31.592	2	1725.8546	1725.8546	K	L	65	78
PSM	RRSGASEANLIVAK	114	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1184	21.342	3	1618.9192	1618.9192	K	S	286	300
PSM	DNLTLWTSDQQDDDGGEGNN	115	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510	ms_run[1]:scan=4514	50.862453333333335	3	2226.9347	2226.9356	R	-	228	248
PSM	SRTSVQTEDDQLIAGQSAR	116	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=2054	28.256808333333332	3	2175.0349	2175.0376	R	A	652	671
PSM	SLVGTPYWMAPEVISR	117	sp|Q9P286|PAK5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=5284	62.573508333333336	2	1918.9430	1918.9471	K	L	602	618
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	118	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,5-UNIMOD:4,6-UNIMOD:4,7-UNIMOD:21,23-UNIMOD:4	ms_run[1]:scan=3735	42.771029999999996	3	2895.1802	2895.1871	R	L	22	47
PSM	DNLTLWTSDMQGDGEEQNK	119	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3733	42.753	3	2264.0539	2264.0539	R	E	204	223
PSM	DNLTLWTSENQGDEGDAGEGEN	120	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4485	50.613	2	2384.01	2384.0100	R	-	223	245
PSM	DVIELTDDSFDK	121	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=4297	48.398	2	1463.7668	1463.7668	K	N	158	170
PSM	FVLSQAKDEL	122	sp|Q8NBS9-2|TXND5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:510	ms_run[2]:scan=4454	50.214	2	1296.7003	1296.7003	R	-	315	325
PSM	GASQAGMTGYGMPR	123	sp|Q9UI15|TAGL3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=1065	20.389	2	1528.6264	1528.6264	K	Q	183	197
PSM	HGESAWNLENR	124	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1487	23.851	2	1345.6587	1345.6587	R	F	11	22
PSM	LQRYSLSGGGTSSH	125	sp|Q9Y6E0-2|STK24_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1444	23.512	2	1562.7303	1562.7303	R	-	418	432
PSM	NVDGVNYASITR	126	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2974	35.841	2	1421.6764	1421.6764	R	N	70	82
PSM	QLSSGVSEIR	127	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2110	28.678	2	1188.5964	1188.5964	R	H	80	90
PSM	RGSLSNAGDPEIVK	128	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1626	24.946	2	1589.8451	1589.8451	R	S	92	106
PSM	HQGVMVGMGQKDSYVGDEAQSK	129	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,11-UNIMOD:510,13-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=2114	28.70938333333333	3	2532.2177	2532.2233	R	R	40	62
PSM	NELESYAYSLK	130	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[1]:scan=3581	41.032865	2	1384.7572	1383.7552	R	N	563	574
PSM	CQRDSSCGTGYELTEDNSCK	131	sp|P23142|FBLN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:4,9-UNIMOD:21,19-UNIMOD:4,20-UNIMOD:510	ms_run[1]:scan=1666	25.259471666666666	3	2515.0102	2514.0132	R	D	242	262
PSM	DRSSTTSTWELLDQR	132	sp|Q9HA77|SYCM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4120	46.398	2	1907.8839	1907.8839	K	T	542	557
PSM	EAAENSLVAYK	133	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2233	29.709	2	1341.6854	1341.6854	K	A	121	132
PSM	EGMNIVEAMER	134	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3783	43.186	2	1311.6375	1311.6375	K	F	74	85
PSM	ELISNASDALDK	135	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2642	32.99	2	1342.7616	1342.7616	R	I	42	54
PSM	EQVANSAFVER	136	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1603	24.776	2	1282.673	1282.6730	K	V	492	503
PSM	ERESLQQMAEVTR	137	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2303	30.262	3	1689.797	1689.7970	K	E	123	136
PSM	GDLGIEIPAEK	138	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3411	39.473	2	1208.7289	1208.7289	R	V	295	306
PSM	GDPEWSSETDALVGSRLSHS	139	sp|Q7Z7N9|T179B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=4143	46.627	3	2242.9956	2242.9956	R	-	200	220
PSM	HELQANCYEEVK	140	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1237	21.795	2	1586.8035	1586.8035	K	D	133	145
PSM	NNSGEEFDCAFR	141	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2626	32.863	2	1478.6309	1478.6309	R	L	355	367
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	142	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,6-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=3735	42.771	3	2895.1876	2895.1876	R	L	22	47
PSM	RSSITEPEGPNGPNIQK	143	sp|Q13625-2|ASPP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1699	25.509	3	1971.0099	1971.0099	K	L	612	629
PSM	RVSHQGYSTEAEFEEPR	144	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1732	25.769	3	2134.9533	2134.9533	R	V	240	257
PSM	SIAEEQYSDLEK	145	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2999	36.045	2	1558.744	1558.7440	R	E	930	942
PSM	SLYESFVSSSDR	146	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=4276	48.125	2	1569.6214	1569.6214	K	L	131	143
PSM	SSGPYGGGGQYFAK	147	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2774	34.065	2	1522.713	1522.7130	R	P	232	246
PSM	TTPSVVAFTADGER	148	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3552	40.784	2	1563.7394	1563.7394	R	L	86	100
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	149	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2632	32.91016333333333	3	2448.1819	2448.1853	R	L	815	839
PSM	RSSITEPEGPNGPNIQK	150	sp|Q13625|ASPP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=1699	25.509245	3	1971.0076	1971.0094	K	L	735	752
PSM	TLNDRSSIVMGEPISQSSSNSQ	151	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=3319	38.73242833333333	3	2450.1168	2450.1203	R	-	762	784
PSM	SVPTSTVFYPSDGVATEK	152	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=4004	45.261293333333334	2	2032.0035	2032.0073	R	A	439	457
PSM	CSVSLSNVEAR	153	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=2688	33.38098333333333	2	1334.6098	1334.6109	R	R	726	737
PSM	DRSSTTSTWELLDQR	154	sp|Q9HA77|SYCM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=4120	46.398439999999994	2	1907.8804	1907.8833	K	T	542	557
PSM	ARSWSPPPEVSR	155	sp|Q9NR19|ACSA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1921	27.242	2	1481.724	1481.7240	R	S	26	38
PSM	ATSVALPGWSPSETR	156	sp|Q16513-5|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4051	45.717	2	1671.8082	1671.8082	K	S	25	40
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	157	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=3333	38.842	4	3527.556	3527.5560	K	L	104	135
PSM	CSVSLSNVEAR	158	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21	ms_run[2]:scan=2692	33.412	2	1334.6114	1334.6114	R	R	726	737
PSM	DNLTLWTSDMQGDGEEQNK	159	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4381	49.369	3	2248.059	2248.0590	R	E	204	223
PSM	DNSTMGYMMAK	160	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2864	34.816	2	1315.6247	1315.6247	R	K	613	624
PSM	EDQTEYLEER	161	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1809	26.382	2	1344.6258	1344.6258	K	R	192	202
PSM	HSGSDRSSFSHYSGLK	162	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1164	21.181	2	1898.8949	1898.8949	R	H	196	212
PSM	HTLSYVDVGTGK	163	sp|P31040-3|SDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2167	29.124	2	1423.7385	1423.7385	K	V	480	492
PSM	LGSLVENNER	164	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2141	28.926	2	1243.6022	1243.6022	K	V	853	863
PSM	QEYDESGPSIVHR	165	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1461	23.646	2	1549.7585	1549.7585	K	K	360	373
PSM	QRNSSVAAAQLVR	166	sp|Q5TAX3|TUT4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1451	23.565	3	1512.7986	1512.7986	R	N	1380	1393
PSM	RDSFDDRGPSLNPVLDYDHGSR	167	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3326	38.787	4	2631.1927	2631.1927	R	S	186	208
PSM	RISHSLYSGIEGLDESPSR	168	sp|Q8TEW0-9|PARD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3362	39.065	3	2216.0687	2216.0687	R	N	700	719
PSM	RVSAIVEQSWNDS	169	sp|P63146|UBE2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3697	42.343	2	1603.7456	1603.7456	K	-	140	153
PSM	SGSSSPDSEITELK	170	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2956	35.686	2	1583.7604	1583.7604	R	F	340	354
PSM	SGTPPRQGSITSPQANEQSVTPQR	171	sp|Q9UQ35-2|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1706	25.567	3	2636.2768	2636.2768	K	R	846	870
PSM	SLQSVAEER	172	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2237	29.742	2	1131.5385	1131.5385	R	A	97	106
PSM	SLYESFVSSSDR	173	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3742	42.828	2	1489.655	1489.6550	K	L	131	143
PSM	SRESLNVDVVK	174	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2101	28.612	2	1392.765	1392.7650	R	Y	521	532
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	175	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2632	32.91	3	2448.1858	2448.1858	R	L	815	839
PSM	SRTSVQTEDDQLIAGQSAR	176	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2054	28.257	3	2175.0381	2175.0381	R	A	282	301
PSM	STAGDTHLGGEDFDNR	177	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1541	24.302	3	1724.7814	1724.7814	K	M	221	237
PSM	TLNDRSSIVMGEPISQSSSNSQ	178	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3319	38.732	3	2450.1209	2450.1209	R	-	762	784
PSM	VIGSGCNLDSAR	179	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1261	22	2	1281.656	1281.6560	R	F	100	112
PSM	YDSRTTIFSPEGR	180	sp|P25789|PSA4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=3185	37.602	2	1721.7275	1721.7275	R	L	5	18
PSM	YHTSQSGDEMTSLSEYVSR	181	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=2950	35.597	3	2305.9622	2305.9622	R	M	457	476
PSM	RISHSLYSGIEGLDESPSR	182	sp|Q8TEW0|PARD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3362	39.06548333333333	3	2216.0659	2216.0682	R	N	713	732
PSM	GEPNVSYICSR	183	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=2265	29.95703333333333	2	1394.6097	1394.6109	R	Y	273	284
PSM	AASPPASASDLIEQQQK	184	sp|Q5VSL9-3|STRP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3193	37.679	3	1887.9616	1887.9616	R	R	69	86
PSM	AETNSRVSGVDGYETEGIR	185	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2346	30.59	3	2152.985	2152.9850	R	G	264	283
PSM	AIALSLAESNR	186	sp|Q9UHP3|UBP25_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3417	39.517	2	1257.6542	1257.6542	R	A	105	116
PSM	CYEMASHLR	187	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=1341	22.706	3	1199.564	1199.5640	K	R	128	137
PSM	DINAYNCEEPTEK	188	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2013	27.942	2	1649.7879	1649.7879	K	L	85	98
PSM	DISLSDYK	189	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:510	ms_run[2]:scan=2888	35.038	2	1007.5812	1007.5812	K	G	28	36
PSM	DSSSLSSCTSGILEER	190	sp|Q9H3Q1-2|BORG4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=3881	44.137	2	1840.7974	1840.7974	R	S	236	252
PSM	ELISNSSDALDK	191	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2092	28.546	2	1358.7566	1358.7566	R	I	47	59
PSM	ENRESLVVNYEDLAAR	192	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3789	43.25	3	1990.9574	1990.9574	K	E	225	241
PSM	ERESLQQMAEVTR	193	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=1148	21.059	2	1705.7919	1705.7919	K	E	123	136
PSM	HGYIGEFEIIDDHR	194	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=3343	38.918	3	1733.8586	1733.8586	K	A	44	58
PSM	HTGCCGDNDPIDVCEIGSK	195	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4,19-UNIMOD:510	ms_run[2]:scan=2479	31.676	3	2200.9824	2200.9824	K	V	110	129
PSM	IEAFRASLSK	196	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2302	30.255	2	1268.7166	1268.7166	K	L	119	129
PSM	IQALQQQADEAEDR	197	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1803	26.335	2	1647.8276	1647.8276	K	A	14	28
PSM	LGADESEEEGRRGSLSNAGDPEIVK	198	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,14-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=2324	30.426	3	2762.3396	2762.3396	R	S	81	106
PSM	LMIEMDGTENK	199	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2504	31.868	2	1363.7	1363.7000	K	S	93	104
PSM	NLQYYDISAK	200	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2877	34.937	2	1281.7241	1281.7241	K	S	143	153
PSM	PTSISWDGLDSGK	201	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4052	45.724	2	1475.6758	1475.6758	R	L	50	63
PSM	RALANSLACQGK	202	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1043	20.181	2	1435.7643	1435.7643	K	Y	331	343
PSM	RLSQSDEDVIR	203	sp|Q9H7D7-3|WDR26_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1616	24.873	3	1430.6979	1430.6979	K	L	119	130
PSM	RMTGSEFDFEEMK	204	sp|P50395-2|GDIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:35,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3397	39.352	3	1769.7678	1769.7678	K	R	378	391
PSM	SDSILLTSDGR	205	sp|Q9P286|PAK5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2367	30.764	2	1196.6461	1196.6461	K	I	571	582
PSM	SISLYYTGEK	206	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3558	40.843	2	1307.6687	1307.6687	R	G	458	468
PSM	SRSFTLDDESLK	207	sp|Q86WR7-2|PRSR2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2859	34.775	2	1544.776	1544.7760	R	Y	41	53
PSM	RSSGAAPAPASASAPAPVPGGEAER	208	sp|Q9UBP0|SPAST_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=1607	24.8052	3	2374.1431	2374.1485	K	V	91	116
PSM	SRSSSSSSGGGLLPYPR	209	sp|O60293|ZC3H1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=2552	32.23492	3	1807.8659	1807.8673	R	R	38	55
PSM	YFQINQDEEEEEDED	210	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510	ms_run[1]:scan=3157	37.35771166666667	2	1964.7831	1964.7854	R	-	114	129
PSM	NKMKSVLIPPTETNR	211	sp|O14829|PPE1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	3-UNIMOD:35,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=3746	42.85910833333333	2	1902.8492	1902.8672	R	D	303	318
PSM	YQSVSLLDK	212	sp|Q9UIQ6|LCAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[1]:scan=2971	35.817240000000005	2	1199.6464	1199.6470	K	K	668	677
PSM	ALANSLACQGK	213	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=1563	24.473	2	1279.6632	1279.6632	R	Y	332	343
PSM	ASGNYATVISHNPETK	214	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2164	29.1	3	1835.9091	1835.9091	R	K	129	145
PSM	DIKSDSILLTSDGR	215	sp|Q9P286|PAK5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3427	39.594	2	1666.8815	1666.8815	R	I	568	582
PSM	DVTPPPETEVVLIK	216	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4522	50.926	2	1683.9372	1683.9372	K	N	519	533
PSM	GASWIDTADGSANHR	217	sp|Q8NBJ7-2|SUMF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2726	33.697	3	1670.7262	1670.7262	R	A	166	181
PSM	GDNITLLQSVSN	218	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4417	49.755	2	1373.6652	1373.6652	K	-	81	93
PSM	GVSLTNHHFYDESK	219	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2278	30.057	2	1780.8458	1780.8458	R	P	22	36
PSM	HSLASSEYPVR	220	sp|P51570|GALK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=1349	22.77	2	1358.6444	1358.6444	R	R	229	240
PSM	LYRPGSVAYVSR	221	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2180	29.223	2	1480.7652	1480.7652	K	S	380	392
PSM	QEYDESGPSIVHR	222	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=1450	23.558	3	1549.7585	1549.7585	K	K	360	373
PSM	QWQSLIEESAR	223	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4418	49.762	2	1459.6921	1459.6921	R	R	38	49
PSM	RFSMVVQDGIVK	224	sp|P30044-4|PRDX5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=2828	34.502	2	1541.8313	1541.8313	K	A	91	103
PSM	RPLSGPDVGTPQPAGLASGAK	225	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=2942	35.534	3	2203.1076	2203.1076	K	L	178	199
PSM	RQSILFSTEV	226	sp|P11274-2|BCR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3939	44.655	2	1292.659	1292.6590	K	-	1218	1228
PSM	RRASWASENGETDAEGTQMTPAK	227	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=1608	24.813	3	2640.2276	2640.2276	K	R	1862	1885
PSM	RSSGAAPAPASASAPAPVPGGEAER	228	sp|Q9UBP0-4|SPAST_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1607	24.805	3	2374.1491	2374.1491	K	V	5	30
PSM	RSSGFISELPSEEGK	229	sp|Q5VZK9-2|CARL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3170	37.471	2	1769.8873	1769.8873	K	K	966	981
PSM	SRDSLAPGPEPQDEDQK	230	sp|O15013-7|ARHGA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1257	21.968	3	2015.9474	2015.9474	K	D	1166	1183
PSM	TLSDYNIQK	231	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=1811	26.396	2	1148.6714	1148.6714	R	E	55	64
PSM	TPEELDDSDFETEDFDVR	232	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4647	52.454	3	2271.9157	2271.9157	R	S	264	282
PSM	TWNDPSVQQDIK	233	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2553	32.242	2	1497.81	1497.8100	R	F	102	114
PSM	VTDSSVSVQLRE	234	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2885	35	2	1432.7023	1432.7023	R	-	264	276
PSM	YALYDATYETK	235	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2900	35.133	2	1404.7449	1404.7449	R	E	82	93
PSM	YEELQSLAGK	236	sp|P05787-2|K2C8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2949	35.59	2	1284.6639	1284.6639	K	H	314	324
PSM	YSHSYLSDSDTEAK	237	sp|Q92614-5|MY18A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1646	25.099	3	1749.7771	1749.7771	R	L	1562	1576
PSM	IRYESLTDPSK	238	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2689	33.38806666666667	2	1455.7627	1455.7642	K	L	54	65
PSM	YHTSQSGDEMTSLSEYVSR	239	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=2950	35.59688	3	2305.9588	2305.9617	R	M	457	476
PSM	NRPTSISWDGLDSGK	240	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3503	40.284443333333336	3	1779.8815	1779.8824	K	L	48	63
PSM	SFSTALYGESDL	241	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=5183	60.63043666666667	2	1402.6100	1402.6112	K	-	900	912
PSM	DSSSLSSCTSGILEER	242	sp|Q9H3Q1|BORG4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=3881	44.13660333333333	2	1840.7920	1840.7969	R	S	306	322
PSM	YSHSYLSDSDTEAK	243	sp|Q92614|MY18A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=1646	25.099106666666664	3	1749.7747	1749.7766	R	L	2035	2049
PSM	STTPPPAEPVSLPQEPPKPR	244	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2802	34.297958333333334	3	2272.2105	2272.2136	K	V	225	245
PSM	SVAAEGALLPQTPPSPR	245	sp|Q86X27|RGPS2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=3702	42.383939999999996	2	1803.9316	1803.9339	K	N	315	332
PSM	AACALLNSGGGVIRMAK	246	sp|Q7Z7L1|SLN11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:4,8-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=4512	50.845751666666665	2	1817.9143	1817.9100	R	K	49	66