MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100511_022PKCg_PRKCG.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100511_022PKCg_PRKCG.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	47.0	null	228-UNIMOD:510	0.09	47.0	4	1	0
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	null	119-UNIMOD:510,136-UNIMOD:21,137-UNIMOD:510	0.06	45.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	44.0	null	223-UNIMOD:510	0.10	44.0	2	1	0
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	396-UNIMOD:510,397-UNIMOD:21	0.05	43.0	2	1	0
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	333-UNIMOD:510,353-UNIMOD:21	0.06	43.0	1	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	180-UNIMOD:510,196-UNIMOD:21	0.02	41.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	40.0	null	355-UNIMOD:510,370-UNIMOD:21	0.06	40.0	1	1	0
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	38.0	null	593-UNIMOD:510,597-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	151-UNIMOD:510,168-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	207-UNIMOD:510	0.14	37.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	354-UNIMOD:510,365-UNIMOD:21,353-UNIMOD:510	0.02	36.0	3	2	1
PRT	sp|Q15185-4|TEBP_HUMAN	Isoform 4 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	108-UNIMOD:510	0.12	35.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	189-UNIMOD:510,202-UNIMOD:21,205-UNIMOD:21,206-UNIMOD:510	0.04	35.0	2	1	0
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	221-UNIMOD:510,329-UNIMOD:510,340-UNIMOD:21	0.06	35.0	2	2	2
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,36-UNIMOD:21	0.04	34.0	2	1	0
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	60-UNIMOD:510	0.27	34.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	39-UNIMOD:510,40-UNIMOD:21	0.09	33.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	33.0	1	1	1
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	50-UNIMOD:510,56-UNIMOD:21	0.09	33.0	1	1	1
PRT	sp|P05129|KPCG_HUMAN	Protein kinase C gamma type OS=Homo sapiens OX=9606 GN=PRKCG PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	385-UNIMOD:510,395-UNIMOD:4,396-UNIMOD:21,400-UNIMOD:510,277-UNIMOD:510,296-UNIMOD:4,297-UNIMOD:21,301-UNIMOD:510,142-UNIMOD:510,142-UNIMOD:4,145-UNIMOD:21,148-UNIMOD:21,150-UNIMOD:4,317-UNIMOD:510,330-UNIMOD:21,335-UNIMOD:510,597-UNIMOD:510,600-UNIMOD:21,607-UNIMOD:21	0.13	33.0	5	5	5
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	165-UNIMOD:510,176-UNIMOD:21,178-UNIMOD:510,177-UNIMOD:21	0.05	32.0	2	1	0
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	1153-UNIMOD:510	0.02	32.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	239-UNIMOD:510	0.05	32.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	204-UNIMOD:510,213-UNIMOD:35,222-UNIMOD:510	0.09	31.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510	0.03	31.0	2	1	0
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	196-UNIMOD:510,202-UNIMOD:21,211-UNIMOD:510	0.04	31.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	223-UNIMOD:510	0.09	30.0	1	1	0
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	30.0	1	1	0
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	30.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	193-UNIMOD:510,199-UNIMOD:21,205-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	null	225-UNIMOD:510	0.09	30.0	1	1	0
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	null	228-UNIMOD:510	0.08	30.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	81-UNIMOD:510,83-UNIMOD:21,86-UNIMOD:21,93-UNIMOD:510,91-UNIMOD:35	0.09	30.0	2	1	0
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	null	98-UNIMOD:510,108-UNIMOD:35	0.16	30.0	1	1	0
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	193-UNIMOD:510	0.12	29.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	223-UNIMOD:510,237-UNIMOD:4	0.10	29.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	547-UNIMOD:510,558-UNIMOD:510,59-UNIMOD:510,63-UNIMOD:21,69-UNIMOD:510	0.03	29.0	2	2	2
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	107-UNIMOD:510,116-UNIMOD:21,120-UNIMOD:21,121-UNIMOD:510	0.02	29.0	1	1	1
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	144-UNIMOD:510,147-UNIMOD:21,169-UNIMOD:510	0.10	29.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	95-UNIMOD:510,97-UNIMOD:4,104-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	126-UNIMOD:510,139-UNIMOD:21,129-UNIMOD:510	0.11	28.0	2	2	2
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	200-UNIMOD:510,213-UNIMOD:21	0.07	28.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	42-UNIMOD:510,53-UNIMOD:510	0.02	27.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	27.0	1	1	1
PRT	sp|P30622-2|CLIP1_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	191-UNIMOD:510,204-UNIMOD:21,206-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	40-UNIMOD:510,41-UNIMOD:21,44-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	66-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510	0.09	26.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	57-UNIMOD:510,66-UNIMOD:21,71-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	70-UNIMOD:510,78-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	100-UNIMOD:510,103-UNIMOD:21,105-UNIMOD:4,109-UNIMOD:21	0.05	26.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:510	ms_run[1]:scan=3711	48.22224333333333	2	2226.9338	2226.9356	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:510	ms_run[1]:scan=3630	47.19645333333333	2	2226.9331	2226.9356	R	-	228	248
PSM	GAEAANVTGPGGVPVQGSK	3	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510,18-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=1557	27.049	2	1842.9513	1842.9513	K	Y	119	138
PSM	DNLTLWTSDTQGDEAEAGEGGEN	4	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	44.0	1-UNIMOD:510	ms_run[1]:scan=3751	48.68396833333333	2	2442.049714	2442.051903	R	-	223	246
PSM	DYEEVGVDSVEGEGEEEGEEY	5	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=3538	46.099	2	2381.9607	2381.9607	K	-	396	417
PSM	SSGSPYGGGYGSGGGSGGYGSR	6	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=1446	26.079	2	2023.8121	2023.8121	R	R	333	355
PSM	INSSGESGDESDEFLQSR	7	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=2320	33.367	2	2069.8639	2069.8639	R	K	180	198
PSM	TPEELDDSDFETEDFDVR	8	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3797	49.25	2	2271.9157	2271.9157	R	S	264	282
PSM	SSGSPYGGGYGSGGGSGGYGSR	9	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=1446	26.078961666666668	2	2023.812363	2023.812145	R	R	355	377
PSM	DNLTLWTSDTQGDEAEAGEGGEN	10	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=3748	48.659	3	2442.0519	2442.0519	R	-	223	246
PSM	YAALSVDGEDENEGEDYAE	11	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3245	42.559648333333335	2	2188.840992	2188.842167	K	-	593	612
PSM	GAEAANVTGPDGVPVEGSR	12	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=1891	29.869	2	1895.8839	1895.8839	K	Y	151	170
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	13	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=3650	47.421	3	3490.5054	3490.5054	R	-	207	238
PSM	SDIDEIVLVGGSTR	14	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3559	46.398	2	1573.7813	1573.7813	K	I	354	368
PSM	DWEDDSDEDMSNFDR	15	sp|Q15185-4|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=3206	42.081	2	1908.7168	1908.7168	K	F	108	123
PSM	GADFLVTEVENGGSLGSK	16	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,14-UNIMOD:21,17-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4129	54.428	2	2006.9276	2006.9276	K	K	189	207
PSM	STAGDTHLGGEDFDNR	17	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=1282	24.772	2	1724.7814	1724.7814	K	M	221	237
PSM	GILAADESTGSIAK	18	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2140	31.814	2	1479.7858	1479.7858	K	R	29	43
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	19	sp|Q9BXV9|GON7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=2158	31.948	3	2865.1757	2865.1757	R	T	60	86
PSM	DNLTLWTSDQQDDDGGEGNN	20	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=3637	47.253	3	2226.9361	2226.9361	R	-	228	248
PSM	DSSTSPGDYVLSVSENSR	21	sp|P46108-2|CRK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3491	45.55	2	2012.8788	2012.8788	R	V	39	57
PSM	DYEEVGVDSVEGEGEEEGEEY	22	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3639	47.267	2	2461.927	2461.9270	K	-	396	417
PSM	GADFLVTEVENGGSLGSK	23	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,17-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3917	50.947	2	1926.9612	1926.9612	K	K	189	207
PSM	TAFQEALDAAGDK	24	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2574	35.601	2	1403.7569	1403.7569	K	L	9	22
PSM	TAVVVGTITDDVR	25	sp|Q07020-2|RL18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2866	38.363	2	1458.7543	1458.7543	K	V	50	63
PSM	DVIVQDDDVDCTLVEK	26	sp|P05129|KPCG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,11-UNIMOD:4,12-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=3215	42.169914999999996	2	2009.9528	2009.9536	K	R	385	401
PSM	GAVDGGLSIPHSTK	27	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1758	28.618	2	1485.7865	1485.7865	K	R	165	179
PSM	IAQLEEELEEEQGNTELINDR	28	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=3615	47.06	3	2505.2295	2505.2295	R	L	1153	1174
PSM	SQIHDIVLVGGSTR	29	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2429	34.338	2	1594.8292	1594.8292	K	I	329	343
PSM	SYELPDGQVITIGNER	30	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=3700	48.103	2	1823.9478	1823.9478	K	F	239	255
PSM	DNLTLWTSDMQGDGEEQNK	31	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3060	40.409	2	2264.0539	2264.0539	R	E	204	223
PSM	EVDEQMLNVQNK	32	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1255	24.486	2	1529.8032	1529.8032	K	N	325	337
PSM	GILAADESTGSIAK	33	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2697	36.766	2	1559.7522	1559.7522	K	R	29	43
PSM	HSGSDRSSFSHYSGLK	34	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,7-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1132	23.374	2	1898.8949	1898.8949	R	H	196	212
PSM	DNLTLWTSENQGDEGDAGEGEN	35	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=3724	48.343	2	2384.01	2384.0100	R	-	223	245
PSM	KEESEESDDDMGFGLFD	36	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=3438	44.883	2	2032.8732	2032.8732	K	-	73	90
PSM	LLNQEEGEYYNVPVADADNCSLLQK	37	sp|P05129|KPCG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,20-UNIMOD:4,21-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3770	48.856	3	3029.4366	3029.4366	K	F	277	302
PSM	QENCGAQQVPAGPGTSTPPSSPVR	38	sp|Q96G46-2|DUS3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=1775	28.763	3	2535.1637	2535.1637	R	T	257	281
PSM	RVSVCAETYNPDEEEEDTDPR	39	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2040	31.012	3	2624.0798	2624.0798	R	V	97	118
PSM	VPTANVSVVDLTCR	40	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3018	39.984	2	1643.8166	1643.8166	R	L	193	207
PSM	DNLTLWTSENQGDEGDAGEGEN	41	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510	ms_run[1]:scan=3604	46.968525	2	2384.0067	2384.0095	R	-	225	247
PSM	DNLTLWTSDQQDEEAGEGN	42	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510	ms_run[1]:scan=3676	47.741009999999996	2	2154.9388	2154.9396	R	-	228	247
PSM	AITGASLADIMAK	43	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4024	52.58277	2	1488.7336	1488.7331	R	R	81	94
PSM	KEESEESDDDMGFGLFD	44	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[1]:scan=3438	44.88292666666667	2	2032.8717	2032.8727	K	-	98	115
PSM	CVRSVPSLCGVDHTER	45	sp|P05129|KPCG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:4,4-UNIMOD:21,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=1968	30.452	2	2064.8736	2064.8736	R	R	142	158
PSM	DNLTLWTADNAGEEGGEAPQEPQS	46	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=3752	48.692	3	2562.157	2562.1570	R	-	193	217
PSM	DNLTLWTSDSAGEECDAAEGAEN	47	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=3815	49.501	2	2488.0396	2488.0396	R	-	223	246
PSM	EGLELPEDEEEK	48	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2225	32.539	2	1483.7566	1483.7566	K	K	547	559
PSM	KSDIDEIVLVGGSTR	49	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2989	39.653	2	1735.9394	1735.9394	K	I	353	368
PSM	MGPSSSPIPSPSPSPTDPK	50	sp|P05129|KPCG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,14-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2324	33.397	2	2012.9802	2012.9802	R	R	317	336
PSM	RQAVTNPNNTFYATK	51	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1364	25.412	2	1951.9231	1951.9231	K	R	107	122
PSM	KSDIDEIVLVGGSTR	52	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=2989	39.653105	2	1735.9390	1735.9388	K	I	353	368
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	53	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=3218	42.194811666666666	3	3090.3442	3090.3446	K	E	144	170
PSM	GAVDGGLSIPHSTK	54	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,13-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=1758	28.617553333333333	2	1485.787044	1485.786494	K	R	165	179
PSM	AITGASLADIMAK	55	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,11-UNIMOD:35,13-UNIMOD:510	ms_run[2]:scan=3135	41.326	2	1504.7286	1504.7286	R	R	81	94
PSM	DNLTLWTSDSAGEECDAAEGAEN	56	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=3818	49.526	3	2488.0396	2488.0396	R	-	223	246
PSM	GLCAIAQAESLR	57	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=2757	37.333	2	1401.69	1401.6900	R	Y	95	107
PSM	IGRIEDVTPIPSDSTR	58	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2565	35.532	2	1868.9457	1868.9457	K	R	126	142
PSM	TLSNAEDYLDDEDSD	59	sp|Q92882|OSTF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=3379	44.114	2	1814.6831	1814.6831	R	-	200	215
PSM	DNLTLWTSDQQDDDGGEGNN	60	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=3729	48.401	3	2226.9361	2226.9361	R	-	228	248
PSM	ELISNASDALDK	61	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2139	31.807	2	1342.7616	1342.7616	R	I	42	54
PSM	EVDEQMLNVQNK	62	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2082	31.34	2	1513.8083	1513.8083	K	N	325	337
PSM	GPLQSVQVFGR	63	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3094	40.856	2	1300.6753	1300.6753	K	K	5	16
PSM	IEDVTPIPSDSTR	64	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2208	32.389	2	1542.7391	1542.7391	R	R	129	142
PSM	TASESISNLSEAGSIK	65	sp|P30622-2|CLIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,14-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2418	34.251	2	1740.8819	1740.8819	K	K	191	207
PSM	RLGSGPDGEPTIR	66	sp|P05129|KPCG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1638	27.67349	2	1547.6951	1547.6953	K	A	597	610
PSM	DSSTCPGDYVLSVSENSR	67	sp|P46109|CRKL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=3420	44.676	2	2085.8774	2085.8774	R	V	40	58
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	68	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3824	49.577	3	2995.386	2995.3860	R	G	2913	2938
PSM	IRYESLTDPSK	69	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2159	31.956	2	1455.7647	1455.7647	K	L	59	70
PSM	NQSFCPTVNLDK	70	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=2644	36.273	2	1569.7535	1569.7535	R	L	66	78
PSM	NQVALNPQNTVFDAK	71	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2692	36.729	2	1805.9349	1805.9349	K	R	57	72
PSM	NVDGVNYASITR	72	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2403	34.12	2	1421.6764	1421.6764	R	N	70	82
PSM	TDYNASVSVPDSSGPER	73	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2009	30.774	2	1893.8206	1893.8206	R	I	70	87
PSM	VIGSGCNLDSARFR	74	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=2466	34.634	2	1744.7581	1744.7581	R	Y	100	114