MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100720_031DYRK4.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100720_031DYRK4.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	46.0	null	355-UNIMOD:510,358-UNIMOD:21	0.06	46.0	1	1	0
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	44.0	null	42-UNIMOD:510,42-UNIMOD:4,43-UNIMOD:21,67-UNIMOD:510	0.05	44.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	333-UNIMOD:510,334-UNIMOD:21	0.06	43.0	1	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	203-UNIMOD:510,221-UNIMOD:510,270-UNIMOD:510,272-UNIMOD:21,281-UNIMOD:510	0.08	40.0	2	2	2
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	269-UNIMOD:510,295-UNIMOD:21,298-UNIMOD:510	0.06	40.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	40.0	null	230-UNIMOD:510,231-UNIMOD:21,232-UNIMOD:21,230-UNIMOD:21	0.04	40.0	4	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	228-UNIMOD:510	0.09	38.0	4	1	0
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	43-UNIMOD:510,57-UNIMOD:510,175-UNIMOD:510,185-UNIMOD:510,248-UNIMOD:510,100-UNIMOD:510,105-UNIMOD:4	0.19	37.0	4	4	4
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	75-UNIMOD:510,84-UNIMOD:35	0.13	37.0	2	1	0
PRT	sp|P31749-2|AKT1_HUMAN	Isoform 2 of RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	60-UNIMOD:510,62-UNIMOD:21,78-UNIMOD:510	0.05	36.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q96S44|PRPK_HUMAN	EKC/KEOPS complex subunit TP53RK OS=Homo sapiens OX=9606 GN=TP53RK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	6-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:21	0.09	35.0	2	1	0
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	158-UNIMOD:510,160-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	239-UNIMOD:510,197-UNIMOD:510,316-UNIMOD:510,323-UNIMOD:21,325-UNIMOD:35,326-UNIMOD:510	0.11	35.0	3	3	2
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	null	571-UNIMOD:510,576-UNIMOD:4,584-UNIMOD:21,592-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	204-UNIMOD:510,213-UNIMOD:35,222-UNIMOD:510,121-UNIMOD:510,131-UNIMOD:510,223-UNIMOD:510	0.18	34.0	3	3	2
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	411-UNIMOD:510,415-UNIMOD:4,417-UNIMOD:4,423-UNIMOD:21,431-UNIMOD:510,1390-UNIMOD:510,1394-UNIMOD:21	0.02	33.0	2	2	2
PRT	sp|Q9NR20-5|DYRK4_HUMAN	Isoform 5 of Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Homo sapiens OX=9606 GN=DYRK4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	486-UNIMOD:510,496-UNIMOD:35,498-UNIMOD:21,503-UNIMOD:510,495-UNIMOD:21,497-UNIMOD:21,485-UNIMOD:510	0.04	33.0	3	2	0
PRT	sp|P10696|PPBN_HUMAN	Alkaline phosphatase, germ cell type OS=Homo sapiens OX=9606 GN=ALPG PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510	0.03	32.0	1	1	1
PRT	sp|Q5VSL9-3|STRP1_HUMAN	Isoform 3 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	69-UNIMOD:510,71-UNIMOD:21,85-UNIMOD:510	0.04	31.0	1	1	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	204-UNIMOD:510,206-UNIMOD:21,210-UNIMOD:35,215-UNIMOD:35,182-UNIMOD:510,192-UNIMOD:510	0.12	31.0	2	2	2
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	292-UNIMOD:510,306-UNIMOD:510,187-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,492-UNIMOD:510,379-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,613-UNIMOD:510,617-UNIMOD:35,620-UNIMOD:35,621-UNIMOD:35,623-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510	0.14	31.0	8	8	8
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	323-UNIMOD:510	0.06	31.0	1	1	1
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	87-UNIMOD:510,89-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q12792-4|TWF1_HUMAN	Isoform 4 of Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	39-UNIMOD:510,45-UNIMOD:21	0.08	31.0	1	1	1
PRT	sp|P34932-2|HSP74_HUMAN	Isoform 2 of Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	20-UNIMOD:510	0.10	30.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510	0.02	30.0	1	1	1
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	656-UNIMOD:510,658-UNIMOD:21,669-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	14-UNIMOD:510,15-UNIMOD:21,17-UNIMOD:21	0.14	30.0	2	1	0
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	257-UNIMOD:510,267-UNIMOD:21,280-UNIMOD:510	0.06	30.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	28-UNIMOD:510	0.06	30.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	30.0	1	1	1
PRT	sp|O15160-2|RPAC1_HUMAN	Isoform 2 of DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	256-UNIMOD:510,256-UNIMOD:4,258-UNIMOD:21,270-UNIMOD:510	0.05	29.0	1	1	1
PRT	sp|Q9BTY7|HGH1_HUMAN	Protein HGH1 homolog OS=Homo sapiens OX=9606 GN=HGH1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	377-UNIMOD:510,388-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510	0.03	29.0	2	1	0
PRT	sp|Q8WWM7-7|ATX2L_HUMAN	Isoform 7 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	107-UNIMOD:510,111-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	144-UNIMOD:510,147-UNIMOD:21,169-UNIMOD:510	0.10	29.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	8-UNIMOD:510,23-UNIMOD:510	0.05	29.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	305-UNIMOD:510,307-UNIMOD:21,318-UNIMOD:510	0.05	29.0	2	1	0
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	608-UNIMOD:510,621-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	143-UNIMOD:510,146-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q8IWW6-3|RHG12_HUMAN	Isoform 3 of Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	229-UNIMOD:510,231-UNIMOD:21,240-UNIMOD:21,250-UNIMOD:510	0.03	28.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	1099-UNIMOD:510,1103-UNIMOD:21,976-UNIMOD:510,983-UNIMOD:21,1000-UNIMOD:510,492-UNIMOD:510,494-UNIMOD:21,504-UNIMOD:21	0.04	28.0	3	3	3
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	29-UNIMOD:510,36-UNIMOD:21,42-UNIMOD:510,39-UNIMOD:21	0.04	28.0	3	1	0
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	268-UNIMOD:510,193-UNIMOD:510,199-UNIMOD:21,205-UNIMOD:4	0.10	28.0	2	2	2
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510	0.03	28.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	221-UNIMOD:510,26-UNIMOD:510,37-UNIMOD:510	0.07	28.0	4	3	2
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	670-UNIMOD:510,670-UNIMOD:4,677-UNIMOD:21,686-UNIMOD:4,664-UNIMOD:510	0.04	27.0	2	2	2
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	85-UNIMOD:510,91-UNIMOD:4,97-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	76-UNIMOD:21,79-UNIMOD:21,83-UNIMOD:35,73-UNIMOD:510	0.20	27.0	4	1	0
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	468-UNIMOD:510,470-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	340-UNIMOD:510,344-UNIMOD:21,353-UNIMOD:510	0.04	27.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	1072-UNIMOD:510,1084-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	26.0	1	1	1
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	298-UNIMOD:510,303-UNIMOD:21,313-UNIMOD:35,317-UNIMOD:510	0.04	26.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	108-UNIMOD:510,125-UNIMOD:21,132-UNIMOD:510,121-UNIMOD:21	0.07	26.0	2	1	0
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	100-UNIMOD:510,102-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	207-UNIMOD:510	0.14	26.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	2192-UNIMOD:510,2195-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9NR20|DYRK4_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Homo sapiens OX=9606 GN=DYRK4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	488-UNIMOD:510,499-UNIMOD:35,500-UNIMOD:21,501-UNIMOD:21,506-UNIMOD:510,489-UNIMOD:510,498-UNIMOD:21	0.04	26.0	4	2	0
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	40-UNIMOD:510,41-UNIMOD:21,44-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	39-UNIMOD:510,40-UNIMOD:21	0.09	25.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510,82-UNIMOD:510,92-UNIMOD:510	0.15	25.0	2	2	2
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	373-UNIMOD:510,376-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q86TB9-2|PATL1_HUMAN	Isoform 2 of Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	34-UNIMOD:510,36-UNIMOD:21,33-UNIMOD:510	0.02	25.0	2	2	2
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	74-UNIMOD:510,76-UNIMOD:21,80-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	362-UNIMOD:510,368-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	22-UNIMOD:510,37-UNIMOD:21	0.09	25.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	175-UNIMOD:510,177-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	223-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	24.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	472-UNIMOD:510,493-UNIMOD:510	0.04	24.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	53-UNIMOD:510	0.11	23.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	250-UNIMOD:510,251-UNIMOD:510,252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4,281-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	90-UNIMOD:510,91-UNIMOD:21,96-UNIMOD:21	0.04	23.0	3	1	0
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	152-UNIMOD:510,152-UNIMOD:4,162-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	383-UNIMOD:510,389-UNIMOD:21,385-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	61-UNIMOD:510,69-UNIMOD:21,524-UNIMOD:510,534-UNIMOD:21,102-UNIMOD:510,113-UNIMOD:510,563-UNIMOD:510,573-UNIMOD:510,50-UNIMOD:510,62-UNIMOD:21	0.11	23.0	5	5	5
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	45-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	31-UNIMOD:510,33-UNIMOD:21,37-UNIMOD:21	0.15	23.0	1	1	1
PRT	sp|Q6PCE3|PGM2L_HUMAN	Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	166-UNIMOD:510,175-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	184-UNIMOD:510,194-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P06753-3|TPM3_HUMAN	Isoform 3 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	80-UNIMOD:510,82-UNIMOD:21,92-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	576-UNIMOD:510,578-UNIMOD:21,580-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	86-UNIMOD:510,89-UNIMOD:21,87-UNIMOD:21,77-UNIMOD:510	0.04	22.0	4	2	1
PRT	sp|O43598|DNPH1_HUMAN	2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	157-UNIMOD:510,169-UNIMOD:21,174-UNIMOD:21	0.11	22.0	2	1	0
PRT	sp|Q8IYD8|FANCM_HUMAN	Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	1339-UNIMOD:21,1342-UNIMOD:21,1346-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O00115-2|DNS2A_HUMAN	Isoform 2 of Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	66-UNIMOD:510,70-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P25325-2|THTM_HUMAN	Isoform 2 of 3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	13-UNIMOD:510,15-UNIMOD:21,17-UNIMOD:21,21-UNIMOD:35,27-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	81-UNIMOD:510,81-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	490-UNIMOD:510,499-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	129-UNIMOD:510,133-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	186-UNIMOD:510,193-UNIMOD:21,204-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	142-UNIMOD:510,149-UNIMOD:21,154-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q9NW81-5|DMAC2_HUMAN	Isoform 5 of Distal membrane-arm assembly complex protein 2 OS=Homo sapiens OX=9606 GN=DMAC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	215-UNIMOD:510,226-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|Q96EN8|MOCOS_HUMAN	Molybdenum cofactor sulfurase OS=Homo sapiens OX=9606 GN=MOCOS PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	528-UNIMOD:510,530-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	1101-UNIMOD:510,1103-UNIMOD:21,2130-UNIMOD:510,2130-UNIMOD:4,2132-UNIMOD:21,846-UNIMOD:510,854-UNIMOD:21,846-UNIMOD:21	0.02	21.0	4	3	2
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	225-UNIMOD:510,226-UNIMOD:21,242-UNIMOD:510,227-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	85-UNIMOD:510,88-UNIMOD:21,102-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	228-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	74-UNIMOD:510,76-UNIMOD:35	0.11	20.0	2	1	0
PRT	sp|P61916-2|NPC2_HUMAN	Isoform 2 of NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	36-UNIMOD:510,40-UNIMOD:21,42-UNIMOD:4,47-UNIMOD:4,51-UNIMOD:510	0.14	20.0	1	1	1
PRT	sp|O15460-2|P4HA2_HUMAN	Isoform IIa of Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens OX=9606 GN=P4HA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	520-UNIMOD:510,527-UNIMOD:4,529-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	11-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	244-UNIMOD:510,249-UNIMOD:21,255-UNIMOD:4,256-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q8NBJ7-2|SUMF2_HUMAN	Isoform 2 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	187-UNIMOD:510,187-UNIMOD:35,190-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|Q08AD1-2|CAMP2_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	1284-UNIMOD:510,1294-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	97-UNIMOD:510,100-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	228-UNIMOD:510,234-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.18	20.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	232-UNIMOD:510,233-UNIMOD:21,245-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P37275-3|ZEB1_HUMAN	Isoform 3 of Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	633-UNIMOD:510,634-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	40-UNIMOD:510,50-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	55-UNIMOD:510,63-UNIMOD:510,57-UNIMOD:21	0.08	20.0	2	1	0
PRT	sp|Q12765-3|SCRN1_HUMAN	Isoform 3 of Secernin-1 OS=Homo sapiens OX=9606 GN=SCRN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	252-UNIMOD:510,254-UNIMOD:21,256-UNIMOD:4,264-UNIMOD:510,265-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q9HCN4-3|GPN1_HUMAN	Isoform 3 of GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	203-UNIMOD:510,206-UNIMOD:21,215-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	91-UNIMOD:510,94-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.03	19.0	2	1	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:510,9-UNIMOD:21	0.13	19.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	58-UNIMOD:510,65-UNIMOD:21	0.09	19.0	1	1	1
PRT	sp|Q86VH5-2|LRRT3_HUMAN	Isoform 2 of Leucine-rich repeat transmembrane neuronal protein 3 OS=Homo sapiens OX=9606 GN=LRRTM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	247-UNIMOD:21,251-UNIMOD:21,254-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q9C0F1|CEP44_HUMAN	Centrosomal protein of 44 kDa OS=Homo sapiens OX=9606 GN=CEP44 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	324-UNIMOD:510,331-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	6-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:35,12-UNIMOD:21,6-UNIMOD:21	0.04	19.0	2	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	372-UNIMOD:510,380-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q5JSH3-2|WDR44_HUMAN	Isoform 2 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	554-UNIMOD:510,561-UNIMOD:21,573-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	85-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|Q9GZZ9|UBA5_HUMAN	Ubiquitin-like modifier-activating enzyme 5 OS=Homo sapiens OX=9606 GN=UBA5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	null	45-UNIMOD:21,50-UNIMOD:21,53-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	69-UNIMOD:510,73-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4	0.20	18.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	25-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|Q5T0N5-3|FBP1L_HUMAN	Isoform 3 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	429-UNIMOD:510,443-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|O75792|RNH2A_HUMAN	Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 GN=RNASEH2A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	16-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	11-UNIMOD:510,11-UNIMOD:35,13-UNIMOD:21,19-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	229-UNIMOD:510,232-UNIMOD:21,241-UNIMOD:510	0.05	18.0	1	1	1
PRT	sp|Q53EL6-2|PDCD4_HUMAN	Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	76-UNIMOD:510,82-UNIMOD:21,85-UNIMOD:510	0.02	18.0	1	1	0
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	616-UNIMOD:510,618-UNIMOD:21,621-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|Q9BTA9-5|WAC_HUMAN	Isoform 4 of WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	420-UNIMOD:510,422-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q07960|RHG01_HUMAN	Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	49-UNIMOD:510,51-UNIMOD:21,59-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	257-UNIMOD:510,270-UNIMOD:4,272-UNIMOD:21	0.08	18.0	1	1	1
PRT	sp|Q9BYW2-3|SETD2_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1216-UNIMOD:510,1228-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	95-UNIMOD:510	0.08	18.0	1	1	1
PRT	sp|P53814-5|SMTN_HUMAN	Isoform B2 of Smoothelin OS=Homo sapiens OX=9606 GN=SMTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	243-UNIMOD:510,244-UNIMOD:21,264-UNIMOD:510	0.03	18.0	1	1	0
PRT	sp|O43488|ARK72_HUMAN	Aflatoxin B1 aldehyde reductase member 2 OS=Homo sapiens OX=9606 GN=AKR7A2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	38-UNIMOD:510,40-UNIMOD:21,47-UNIMOD:35	0.04	18.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	143-UNIMOD:510,153-UNIMOD:510	0.05	18.0	1	1	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q7Z7L1|SLN11_HUMAN	Schlafen family member 11 OS=Homo sapiens OX=9606 GN=SLFN11 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	49-UNIMOD:510,51-UNIMOD:4,56-UNIMOD:21,63-UNIMOD:35	0.02	18.0	1	1	1
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	87-UNIMOD:510,94-UNIMOD:21,96-UNIMOD:510	0.02	18.0	1	1	0
PRT	sp|P53814|SMTN_HUMAN	Smoothelin OS=Homo sapiens OX=9606 GN=SMTN PE=1 SV=7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	243-UNIMOD:510,245-UNIMOD:21,264-UNIMOD:510	0.03	18.0	1	1	0
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	null	318-UNIMOD:510,326-UNIMOD:21,327-UNIMOD:35,328-UNIMOD:510	0.03	18.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	SSGSPYGGGYGSGGGSGGYGSR	1	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=1753	24.230138333333333	2	2023.8105	2023.8116	R	R	355	377
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	2	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=2898	32.69128166666667	2	2488.0272	2487.0372	R	R	42	68
PSM	SSGSPYGGGYGSGGGSGGYGSR	3	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=1753	24.23	2	2023.8121	2023.8121	R	R	333	355
PSM	DATNVGDEGGFAPNILENK	4	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4475	45.517	2	2028.0436	2028.0436	K	E	203	222
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	5	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	ms_run[2]:scan=1443	21.935	3	3241.4532	3241.4532	K	E	269	299
PSM	SSSPAPADIAQTVQEDLR	6	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=5173	52.414	2	1997.9519	1997.9519	K	T	230	248
PSM	SSSPAPADIAQTVQEDLR	7	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=5173	52.413646666666665	2	1997.9506	1997.9514	K	T	230	248
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	8	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=3220	35.116	3	3112.2782	3112.2782	K	L	595	622
PSM	DNLTLWTSDQQDDDGGEGNN	9	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=4768	48.273	2	2226.9361	2226.9361	R	-	228	248
PSM	DLADELALVDVIEDK	10	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6277	68.474	2	1724.972	1724.9720	K	L	43	58
PSM	DWEDDSDEDMSNFDR	11	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2967	33.207	2	1924.7117	1924.7117	K	F	75	90
PSM	DWEDDSDEDMSNFDR	12	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=3971	41.139	2	1908.7168	1908.7168	K	F	75	90
PSM	SSSPAPADIAQTVQEDLR	13	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=5173	52.413646666666665	2	1997.951107	1997.951933	K	T	230	248
PSM	SGSPSDNSGAEEMEVSLAK	14	sp|P31749-2|AKT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,3-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3567	37.746	2	2041.9188	2041.9188	R	P	60	79
PSM	TPEELDDSDFETEDFDVR	15	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4866	49.148	2	2271.9157	2271.9157	R	S	264	282
PSM	ATTPADGEEPAPEAEALAAAR	16	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3792	39.631	2	2150.9945	2150.9945	R	E	6	27
PSM	SSTPLPTISSSAENTR	17	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2575	30.302	2	1760.8406	1760.8406	R	Q	158	174
PSM	SYELPDGQVITIGNER	18	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=4744	48.079	2	1823.9478	1823.9478	K	F	239	255
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	19	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[1]:scan=1791	24.510126666666665	3	2865.209447	2863.216148	K	M	571	596
PSM	ATTPADGEEPAPEAEALAAAR	20	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3792	39.63086166666666	2	2150.989733	2150.994526	R	E	6	27
PSM	DNLTLWTSDMQGDGEEQNK	21	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3894	40.484	2	2264.0539	2264.0539	R	E	204	223
PSM	RSEACPCQPDSGSPLPAEEEK	22	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=1629	23.312	3	2491.1033	2491.1033	R	R	411	432
PSM	SEAAVGAEVSMTSPGQSK	23	sp|Q9NR20-5|DYRK4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,11-UNIMOD:35,13-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=1635	23.358	2	1898.8969	1898.8969	K	N	486	504
PSM	HVPDSGATATAYLCGVK	24	sp|P10696|PPBN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=3394	36.429	2	1893.9332	1893.9332	K	G	107	124
PSM	AASPPASASDLIEQQQK	25	sp|Q5VSL9-3|STRP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3270	35.489	2	1887.9616	1887.9616	R	R	69	86
PSM	DNLTLWTSDQQDDDGGEGNN	26	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=4664	47.272	2	2226.9361	2226.9361	R	-	228	248
PSM	GASQAGMTGYGMPR	27	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=1183	20.004	2	1528.6264	1528.6264	R	Q	204	218
PSM	NPDDITQEEYGEFYK	28	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3891	40.46	2	1914.916	1914.9160	R	S	292	307
PSM	TAENATSGETLEENEAGD	29	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=1812	24.663	2	1870.8128	1870.8128	K	-	323	341
PSM	TLSPTPSAEGYQDVR	30	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2685	31.117	2	1733.8086	1733.8086	R	D	87	102
PSM	YLLSQSSPAPLTAAEEELR	31	sp|Q12792-4|TWF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=5311	54.125	2	2188.0877	2188.0877	K	Q	39	58
PSM	AGGIETIANEYSDR	32	sp|P34932-2|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=3272	35.504	2	1528.7582	1528.7582	R	C	20	34
PSM	ETVSEESNVLCLSK	33	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3275	35.527	2	1661.8818	1661.8818	R	S	581	595
PSM	NDSPTQIPVSSDVCR	34	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=2739	31.517	2	1787.7973	1787.7973	R	L	656	671
PSM	RSASPDDDLGSSNWEAADLGNEER	35	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3753	39.249	3	2704.1462	2704.1462	K	K	14	38
PSM	RSLAALDALNTDDENDEEEYEAWK	36	sp|P55081|MFAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=4848	48.984	3	2944.3288	2944.3288	K	V	257	281
PSM	SVTEQGAELSNEER	37	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=1505	22.39	2	1581.7695	1581.7695	K	N	28	42
PSM	TAFQEALDAAGDK	38	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3238	35.252	2	1403.7569	1403.7569	K	L	9	22
PSM	RSASPDDDLGSSNWEAADLGNEER	39	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=3753	39.249068333333334	3	2704.1432	2704.1457	K	K	14	38
PSM	CFSPGVIEVQEVQGK	40	sp|O15160-2|RPAC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4418	45.005	2	1823.9165	1823.9165	R	K	256	271
PSM	ELAPEPWVERATPT	41	sp|Q9BTY7|HGH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4118	42.364	2	1708.8286	1708.8286	R	-	377	391
PSM	EVDEQMLNVQNK	42	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1681	23.695	2	1529.8032	1529.8032	K	N	325	337
PSM	GPPQSPVFEGVYNNSR	43	sp|Q8WWM7-7|ATX2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3610	38.126	2	1860.862	1860.8620	K	M	107	123
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	44	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4103	42.224	3	3090.3451	3090.3451	K	E	144	170
PSM	LIAPVAEEEATVPNNK	45	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2942	33.017	2	1762.0149	1762.0149	K	I	8	24
PSM	SRSPESQVIGENTK	46	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1332	21.114	2	1678.8564	1678.8564	R	Q	305	319
PSM	TQPDGTSVPGEPASPISQR	47	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2503	29.765	2	2036.9628	2036.9628	R	L	608	627
PSM	ASPSPQPSSQPLQIHR	48	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1920	25.458	3	1842.9202	1842.9202	R	Q	143	159
PSM	ATTPPNQGRPDSPVYANLQELK	49	sp|Q8IWW6-3|RHG12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4129	42.489	3	2623.2721	2623.2721	R	I	229	251
PSM	DNLTLWTSDQQDDDGGEGNN	50	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=4882	49.28	2	2226.9361	2226.9361	R	-	228	248
PSM	EAAFSPGQQDWSR	51	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3348	36.076	2	1591.6881	1591.6881	R	D	1099	1112
PSM	EVDEQMLNVQNK	52	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2655	30.895	2	1513.8083	1513.8083	K	N	325	337
PSM	GILAADESTGSIAK	53	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2975	33.266	2	1479.7858	1479.7858	K	R	29	43
PSM	LISWYDNEFGYSNR	54	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=4734	48.003	2	1796.8582	1796.8582	K	V	268	282
PSM	QVPDSAATATAYLCGVK	55	sp|P09923|PPBI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=4354	44.495	2	1898.9485	1898.9486	R	A	107	124
PSM	STAGDTHLGGEDFDNR	56	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=1649	23.46	2	1724.7814	1724.7814	K	M	221	237
PSM	CTLPEHESPSQDISDACEAESTER	57	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,1-UNIMOD:4,8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=2994	33.406	3	2861.1581	2861.1581	R	C	670	694
PSM	DINAYNCEEPTEK	58	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2061	26.492	2	1649.7879	1649.7879	K	L	85	98
PSM	DNLTLWTSDQQDDDGGEGNN	59	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=5110	51.706	2	2226.9361	2226.9361	R	-	228	248
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	60	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4977	50.204	3	2995.386	2995.3860	R	G	2913	2938
PSM	KEESEESDDDMGFGLFD	61	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=5602	58.19	2	2124.6796	2124.6796	K	-	73	90
PSM	SFGTRPLSSGFSPEEAQQQDEEFEK	62	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4130	42.497	3	2977.3655	2977.3655	R	K	976	1001
PSM	SGSPAPETTNESVPFAQHSSLDSR	63	sp|O15047|SET1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3000	33.451	3	2614.1761	2614.1761	R	I	468	492
PSM	SGSSSPDSEITELK	64	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2946	33.048	2	1583.7604	1583.7604	R	F	340	354
PSM	AFGPGLQGGSAGSPAR	65	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=2443	29.325898333333335	2	1542.7371	1542.7399	K	F	1072	1088
PSM	AFLAELEQNSPK	66	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4100	42.202	2	1493.7803	1493.7803	K	I	2424	2436
PSM	DGGRSSPGGQDEGGFMAQGK	67	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:35,20-UNIMOD:510	ms_run[2]:scan=1273	20.676	3	2100.9208	2100.9208	R	T	298	318
PSM	EFITGDVEPTDAESEWHSENEEEEK	68	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,18-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4056	41.839	3	3083.3081	3083.3081	R	L	108	133
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	69	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2106	26.82	3	2826.1852	2826.1852	R	E	418	442
PSM	SSSPVQVEEEPVR	70	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1997	26.028	2	1555.7343	1555.7343	R	L	100	113
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	71	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4706	47.656	3	3490.5054	3490.5054	R	-	207	238
PSM	TQETPSAQMEGFLNR	72	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4452	45.324	2	1821.8181	1821.8181	R	K	2192	2207
PSM	KSEAAVGAEVSMTSPGQSK	73	sp|Q9NR20|DYRK4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,12-UNIMOD:35,13-UNIMOD:21,14-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=1285	20.765765	2	2141.0124	2141.0208	K	N	488	507
PSM	DSSTCPGDYVLSVSENSR	74	sp|P46109|CRKL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=4435	45.15	2	2085.8774	2085.8774	R	V	40	58
PSM	DSSTSPGDYVLSVSENSR	75	sp|P46108-2|CRK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4519	45.904	2	2012.8788	2012.8788	R	V	39	57
PSM	EDQTEYLEER	76	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1874	25.12	2	1344.6258	1344.6258	K	R	187	197
PSM	EGLELPEDEEEK	77	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2815	32.076	2	1483.7566	1483.7566	K	K	539	551
PSM	HELQANCYEEVK	78	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1384	21.503	2	1586.8035	1586.8035	K	D	133	145
PSM	MNVSPDVNYEELAR	79	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4274	43.731	2	1749.7857	1749.7857	K	C	373	387
PSM	SEAAVGAEVSMTSPGQSK	80	sp|Q9NR20-5|DYRK4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:35,12-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=1743	24.154	2	1978.8632	1978.8632	K	N	486	504
PSM	STSPIIGSPPVR	81	sp|Q86TB9-2|PATL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2692	31.17	2	1323.7012	1323.7012	R	A	34	46
PSM	TQSPGGCSAEAVLAR	82	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2559	30.181	2	1616.7442	1616.7442	R	K	74	89
PSM	TQTPPVSPAPQPTEER	83	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1656	23.513	2	1847.8879	1847.8879	K	L	362	378
PSM	VWLDPNETNEIANANSR	84	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=4212	43.183	2	2055.9475	2055.9475	K	Q	22	39
PSM	ALSRQEMQEVQSSR	85	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1744	24.162	2	1761.8293	1761.8293	K	S	175	189
PSM	ATAGDTHLGGEDFDNR	86	sp|P48741|HSP77_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1689	23.755	3	1708.7865	1708.7865	K	L	223	239
PSM	ESLKEEDESDDDNM	87	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=964	18.31	2	1738.7364	1738.7364	K	-	235	249
PSM	QVVESAYEVIK	88	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2974	33.259	2	1331.7973	1331.7973	K	L	175	186
PSM	SSSPAPADIAQTVQEDLR	89	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=5171	52.398	2	1963.8888	1963.8888	K	T	230	248
PSM	TSRPENAIIYNNNEDFQVGQAK	90	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,22-UNIMOD:510	ms_run[2]:scan=3044	33.779	3	2575.3303	2575.3303	R	V	472	494
PSM	GILAADESTGSIAK	91	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2975	33.26630166666666	2	1479.784631	1479.785825	K	R	29	43
PSM	AGNLGGGVVTIER	92	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2516	29.862	2	1275.7359	1275.7359	K	S	53	66
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	93	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4,32-UNIMOD:510	ms_run[2]:scan=4865	49.14	4	4015.8382	4015.8382	R	I	250	282
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	94	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2679	31.071	4	2483.1113	2483.1113	R	A	90	114
PSM	CDENILWLDYK	95	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=4933	49.776	2	1535.7966	1535.7967	K	N	152	163
PSM	GNSRPGTPSAEGGSTSSTLR	96	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1052	18.997	3	2031.9435	2031.9435	R	A	383	403
PSM	ITPSYVAFTPEGER	97	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3865	40.264	2	1679.802	1679.8020	R	L	61	75
PSM	KEESEESDDDMGFGLFD	98	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4348	44.45	2	2032.8732	2032.8732	K	-	73	90
PSM	LTRDETNYGIPQR	99	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1747	24.186	3	1595.848	1595.8480	K	A	45	58
PSM	SPSPPPSPPPLPSPPSLPSPAAPEAPELPEPAQPSEAHAR	100	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=5293	53.936	3	4173.9914	4173.9914	R	Q	31	71
PSM	VEIIANDQGNR	101	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510	ms_run[1]:scan=1570	22.863258333333334	2	1261.6817	1261.6834	K	T	26	37
PSM	GNSRPGTPSAEGGSTSSTLR	102	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1052	18.997441666666667	3	2031.940692	2031.943494	R	A	383	403
PSM	AVAGVMITASHNR	103	sp|Q6PCE3|PGM2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1909	25.378	3	1439.7169	1439.7169	K	K	166	179
PSM	DSSDSADGRATPSENLVPSSAR	104	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2333	28.484	3	2332.0392	2332.0392	R	V	184	206
PSM	EQVANSAFVER	105	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1737	24.111	2	1282.673	1282.6730	K	V	492	503
PSM	IQVLQQQADDAEER	106	sp|P06753-3|TPM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1889	25.232	2	1641.7958	1641.7958	K	A	14	28
PSM	ITITNDQNRLTPEEIER	107	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3286	35.612	2	2155.0734	2155.0734	K	M	524	541
PSM	SPSPEPIYNSEGK	108	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1957	25.729	2	1551.7494	1551.7494	R	R	80	93
PSM	STAGDTHLGGEDFDNR	109	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1643	23.415	3	1724.7814	1724.7814	K	M	221	237
PSM	TRSPSPDDILER	110	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2916	32.825	2	1578.6904	1578.6904	R	V	576	588
PSM	TTPSVVAFTADGER	111	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3677	38.653	2	1563.7394	1563.7394	R	L	86	100
PSM	TWNDPSVQQDIK	112	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2647	30.836	2	1497.81	1497.8100	R	F	102	114
PSM	VTLTSEEEAR	113	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1413	21.716	2	1167.6195	1167.6195	K	L	248	258
PSM	YALYDATYETK	114	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3006	33.496	2	1404.7449	1404.7449	R	E	82	93
PSM	YFEADPPGQVAASPDPTT	115	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3660	38.523	2	1975.8665	1975.8665	R	-	157	175
PSM	GVVDSEDLPLNISR	116	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510	ms_run[1]:scan=4091	42.1336	2	1546.8408	1546.8410	R	E	379	393
PSM	SEAAVGAEVSMTSPGQSK	117	sp|Q9NR20|DYRK4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:35,13-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=1743	24.154415	2	1978.8581	1978.8627	K	N	489	507
PSM	VMSTPLSKSNTLNSFSK	118	sp|Q8IYD8|FANCM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=4434	45.142446666666665	2	2079.8449	2079.8385	K	I	1336	1353
PSM	ALINSPEGAVGR	119	sp|O00115-2|DNS2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2670	31.006	2	1296.6651	1296.6651	R	S	66	78
PSM	ARSPSVAAMASPQLCR	120	sp|P25325-2|THTM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21,9-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=1963	25.776	3	1910.8357	1910.8357	R	A	13	29
PSM	CAGNEDIITLR	121	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=2863	32.435	2	1294.6764	1294.6764	K	A	81	92
PSM	GILAADESTGSIAK	122	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=2391	28.946	2	1399.8195	1399.8195	K	R	29	43
PSM	GYSFTTTAER	123	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1929	25.525	2	1165.5828	1165.5828	R	E	197	207
PSM	HIYYITGETK	124	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=1863	25.038	2	1291.7449	1291.7449	K	D	490	500
PSM	IEDVTPIPSDSTR	125	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2443	29.326	2	1542.7391	1542.7391	R	R	129	142
PSM	KEESEESDDDMGFGLFD	126	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=5086	51.425	2	2016.8783	2016.8783	K	-	73	90
PSM	MLAESDESGDEESVSQTDKTELQNTLR	127	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3763	39.34	3	3159.4439	3159.4439	K	T	186	213
PSM	NNAYLAQSPQLYK	128	sp|P14868-2|SYDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3244	35.296	2	1656.8549	1656.8549	K	Q	142	155
PSM	RLSQSDEDVIR	129	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1733	24.08	2	1430.6979	1430.6979	K	L	119	130
PSM	SGPEEQPRDTASPVPA	130	sp|Q9NW81-5|DMAC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=1477	22.186	2	1750.7987	1750.7987	K	-	215	231
PSM	SLSPQEDALTGSR	131	sp|Q96EN8|MOCOS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2740	31.524	2	1473.6925	1473.6925	R	V	528	541
PSM	SSSPVTELASR	132	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2232	27.74	2	1246.6019	1246.6019	R	S	1101	1112
PSM	STTPPPAEPVSLPQEPPKPR	133	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2908	32.765	3	2272.2141	2272.2141	K	V	225	245
PSM	VPTANVSVVDLTCR	134	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3932	40.773	2	1643.8166	1643.8166	R	L	193	207
PSM	CRSPGMLEPLGSSR	135	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=2579	30.330323333333332	2	1660.7682	1659.7682	R	T	2130	2144
PSM	STTPPPAEPVSLPQEPPKPR	136	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2908	32.76527333333333	3	2272.2113	2272.2136	K	V	225	245
PSM	AGGSPAPGPETPAISPSK	137	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2167	27.265	2	1767.9081	1767.9081	K	R	85	103
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	138	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2701	31.235	3	2483.1113	2483.1113	R	A	90	114
PSM	DNLTLWTSDQQDEEAGEGN	139	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4730	47.973	2	2154.9402	2154.9402	R	-	228	247
PSM	EAAENSLVAYK	140	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2046	26.384	2	1261.7191	1261.7191	K	A	121	132
PSM	EGMNIVEAMER	141	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:35	ms_run[2]:scan=2879	32.553	2	1327.6324	1327.6324	K	F	74	85
PSM	EGMNIVEAMER	142	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3977	41.185	2	1311.6375	1311.6375	K	F	74	85
PSM	ELISNASDALDK	143	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2724	31.406	2	1342.7616	1342.7616	R	I	42	54
PSM	EVNVSPCPTQPCQLSK	144	sp|P61916-2|NPC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2596	30.456	2	1990.953	1990.9530	K	G	36	52
PSM	GQEFLRPCGSTEVD	145	sp|O15460-2|P4HA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=3139	34.518	2	1707.7388	1707.7388	R	-	520	534
PSM	HGESAWNLENR	146	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1670	23.615	2	1345.6587	1345.6587	R	F	11	22
PSM	IIYGGSVTGATCK	147	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2466	29.496	2	1473.7575	1473.7575	R	E	244	257
PSM	KEESEESDDDMGFGLFD	148	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=5542	57.318	2	2096.8446	2096.8446	K	-	73	90
PSM	MGNTPDSASDNLGFR	149	sp|Q8NBJ7-2|SUMF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=2817	32.09	2	1710.7133	1710.7133	R	C	187	202
PSM	SEDADRCTLPEHESPSQDISDACEAESTER	150	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:4,14-UNIMOD:21,23-UNIMOD:4	ms_run[2]:scan=2902	32.721	4	3534.4248	3534.4248	K	C	664	694
PSM	SESVEGFLSPSR	151	sp|Q08AD1-2|CAMP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3890	40.453	2	1407.6495	1407.6495	R	C	1284	1296
PSM	SLQSVAEER	152	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2336	28.505	2	1131.5385	1131.5385	R	A	97	106
PSM	SQWESPSPTPSYR	153	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2584	30.367	2	1634.719	1634.7190	R	D	228	241
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	154	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3002	33.466	3	3223.2305	3223.2305	K	-	122	148
PSM	SSGPYGGGGQYFAK	155	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2853	32.359	2	1522.713	1522.7130	R	P	232	246
PSM	SSTPSPSPLNLSSSR	156	sp|P37275-3|ZEB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2947	33.055	2	1629.7823	1629.7823	R	N	633	648
PSM	TLEEDEEELFK	157	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3736	39.108	2	1448.7559	1448.7559	K	M	40	51
PSM	TLSDYNIQK	158	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=1940	25.604	2	1148.6714	1148.6714	R	E	55	64
PSM	TLSDYNIQK	159	sp|P62987|RL40_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2538	30.025	2	1228.6377	1228.6377	R	E	55	64
PSM	TQSPCFGDDDPAKKEPR	160	sp|Q12765-3|SCRN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,13-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=1461	22.069	3	2129.0349	2129.0349	K	F	252	269
PSM	TRSPSPDDILER	161	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2552	30.13	2	1498.7241	1498.7241	R	V	576	588
PSM	TTPSYVAFTDTER	162	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3213	35.063	2	1520.7571	1520.7571	R	L	37	50
PSM	YISPDQLADLYK	163	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5063	51.143	2	1572.8113	1572.8113	R	S	270	282
PSM	KSEAAVGAEVSMTSPGQSK	164	sp|Q9NR20|DYRK4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:35,14-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=1276	20.699835	3	2141.0175	2141.0208	K	N	488	507
PSM	TTPSVVAFTADGER	165	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3874	40.33320833333333	2	1563.7384	1563.7389	R	L	86	100
PSM	DMGSVALDAGTAK	166	sp|Q9HCN4-3|GPN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3455	36.889	2	1382.6789	1382.6789	K	D	203	216
PSM	EALQDVEDENQ	167	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2133	27.016	2	1322.605	1322.6050	K	-	223	234
PSM	GDFCIQVGR	168	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=2875	32.524	2	1084.5548	1084.5548	R	N	91	100
PSM	GEPNVSYICSR	169	sp|P49841|GSK3B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2331	28.468	2	1394.6114	1394.6114	R	Y	210	221
PSM	GVQVETISPGDGR	170	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2275	28.054	2	1427.687	1427.6870	M	T	2	15
PSM	INPDGSQSVVEVPYAR	171	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3698	38.811	2	1843.893	1843.8930	R	S	58	74
PSM	ISVIGQTMSWTWSSLQR	172	sp|Q86VH5-2|LRRT3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=5744	60.299	2	2218.8925	2218.8925	K	L	241	258
PSM	KSEAAVGAEVSMTSPGQSK	173	sp|Q9NR20-5|DYRK4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,12-UNIMOD:35,14-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=1169	19.899	3	2061.055	2061.0550	K	N	485	504
PSM	NELESYAYSLK	174	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3719	38.98	2	1383.7558	1383.7558	R	N	563	574
PSM	NFSDNQLQEGK	175	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1712	23.926	2	1346.7103	1346.7103	R	N	182	193
PSM	NNSGEEFDCAFR	176	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2727	31.427	2	1478.6309	1478.6309	R	L	355	367
PSM	SEVERPASIPLSSGYSTASSDSTPR	177	sp|Q9C0F1|CEP44_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3173	34.765	3	2694.2598	2694.2598	K	A	324	349
PSM	SRSAMDSPVPASMFAPEPSSPGAAR	178	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=3963	41.08	3	2712.1538	2712.1538	R	A	6	31
PSM	STPFIVPSSPTEQEGR	179	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3728	39.048	2	1844.877	1844.8770	R	Q	372	388
PSM	VLENAEGARTTPSVVAFTADGER	180	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=3902	40.544	3	2583.1831	2583.1831	K	L	77	100
PSM	YNTEGRVSPSPSQESLSSSK	181	sp|Q5JSH3-2|WDR44_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=1687	23.74	3	2287.1006	2287.1006	K	S	554	574
PSM	YYVTIIDAPGHR	182	sp|Q5VTE0|EF1A3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2980	33.303	3	1437.7829	1437.7829	K	D	85	97
PSM	SGTPPRQGSITSPQANEQSVTPQR	183	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=1785	24.464036666666665	3	2636.2700	2636.2763	K	R	846	870
PSM	LDSPPPSPITEASEAAEAAEAGNLAVSSR	184	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=6103	65.84022833333333	3	3030.3631	3030.3679	R	E	492	521
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	185	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=2701	31.234645	3	2483.1075	2483.1108	R	A	90	114
PSM	SRSAMDSPVPASMFAPEPSSPGAAR	186	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=3963	41.079865000000005	3	2712.1513	2712.1533	R	A	6	31
PSM	EFITGDVEPTDAESEWHSENEEEEK	187	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,14-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=4056	41.83883333333333	3	3083.2972	3083.3072	R	L	108	133
PSM	YFEADPPGQVAASPDPTT	188	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=3660	38.523286666666664	2	1975.864308	1975.866472	R	-	157	175
PSM	MSSEVVDSNPYSRLMALK	189	sp|Q9GZZ9|UBA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=4871	49.185966666666666	2	2265.881375	2265.885341	K	R	43	61
PSM	AFGESSTESDEEEEEGCGHTHCVR	190	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=1494	22.31	4	2852.0751	2852.0751	R	G	69	93
PSM	DNSTMGYMMAK	191	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=828	17.12	2	1363.6094	1363.6094	R	K	613	624
PSM	EITALAPSTMK	192	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2298	28.224	2	1324.6986	1324.6986	K	I	316	327
PSM	EQFLDGDGWTSR	193	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=3732	39.079	2	1443.6843	1443.6843	K	W	25	37
PSM	GEPNVSYICSR	194	sp|P49841|GSK3B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2465	29.489	2	1394.6114	1394.6114	R	Y	210	221
PSM	HSSDINHLVTQGRESPEGSYTDDANQEVR	195	sp|Q5T0N5-3|FBP1L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=2518	29.877	4	3354.4962	3354.4962	R	G	429	458
PSM	LRVQSPEPPAPER	196	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1750	24.207	2	1588.8187	1588.8187	R	A	1390	1403
PSM	LSSPVPAVCR	197	sp|O75792|RNH2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2000	26.05	2	1198.5994	1198.5994	R	K	16	26
PSM	MESALDQLK	198	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:35,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2486	29.639	2	1197.5989	1197.5989	R	Q	11	20
PSM	NSVTPDMMEEMYK	199	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4363	44.565	2	1721.7388	1721.7388	K	K	229	242
PSM	RSTSPIIGSPPVR	200	sp|Q86TB9-2|PATL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1896	25.284	2	1479.8023	1479.8023	R	A	33	46
PSM	SGLTVPTSPK	201	sp|Q53EL6-2|PDCD4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2174	27.318	2	1133.637	1133.6370	R	G	76	86
PSM	SGTPPRQGSITSPQANEQSVTPQR	202	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1785	24.464	3	2636.2768	2636.2768	K	R	846	870
PSM	SHSPSSPDPDTPSPVGDSR	203	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1366	21.364	3	2034.8744	2034.8744	R	A	616	635
PSM	SIYYITGESK	204	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2702	31.242	2	1227.7023	1227.7023	K	E	482	492
PSM	SPSPGPNHTSNSSNASNATVVPQNSSAR	205	sp|Q9BTA9-5|WAC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1244	20.464	3	2878.3055	2878.3055	R	S	420	448
PSM	SSSPELVTHLK	206	sp|Q07960|RHG01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2231	27.733	2	1344.7327	1344.7327	K	W	49	60
PSM	SVTSNQSDGTQESCESPDVLDR	207	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,14-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=2405	29.044	3	2524.0485	2524.0485	R	H	257	279
PSM	SWQQTTFQNRPDSR	208	sp|Q9BYW2-3|SETD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2158	27.198	2	1863.8477	1863.8477	K	L	1216	1230
PSM	TGAAPIIDVVR	209	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=3260	35.416	2	1144.7028	1144.7028	K	S	95	106
PSM	TTSPEPQESPTLPSTEGQVVNK	210	sp|P53814-5|SMTN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=3008	33.51	3	2473.2262	2473.2262	K	L	243	265
PSM	VASVLGTMEMGR	211	sp|O43488|ARK72_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3549	37.613	2	1379.6402	1379.6402	R	R	38	50
PSM	VEIIANDQGNRITPSYVAFTPEGER	212	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=4769	48.281	3	2969.3785	2969.3786	R	L	50	75
PSM	VIGSGCNLDSAR	213	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1393	21.568	2	1281.656	1281.6560	R	F	100	112
PSM	EAAENSLVAYK	214	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[1]:scan=2053	26.434045	2	1261.7173	1261.7185	K	A	143	154
PSM	SRSPESQVIGENTK	215	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=1335	21.135433333333335	3	1678.8545	1678.8558	R	Q	305	319
PSM	SHSPSSPDPDTPSPVGDSR	216	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=1366	21.363976666666666	3	2034.8720	2034.8739	R	A	616	635
PSM	PGTETEESMGGGEGNHR	217	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0		ms_run[1]:scan=770	16.41916833333333	3	1743.7087	1743.7113	D	A	2014	2031
PSM	AACALLNSGGGVIRMAK	218	sp|Q7Z7L1|SLN11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:4,8-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=4749	48.11548333333333	2	1817.9146	1817.9100	R	K	49	66
PSM	SGLTVPTSPK	219	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=2174	27.318093333333334	2	1133.6359	1133.6365	R	G	87	97
PSM	TTPSVVAFTADGER	220	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3946	40.89532833333333	2	1563.7384	1563.7389	R	L	86	100
PSM	TTSPEPQESPTLPSTEGQVVNK	221	sp|P53814|SMTN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=3008	33.50971333333333	3	2473.2233	2473.2256	K	L	243	265
PSM	EITALAPSTMK	222	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:35,11-UNIMOD:510	ms_run[1]:scan=2298	28.223743333333335	2	1324.697590	1324.698590	K	I	318	329
PSM	KSEAAVGAEVSMTSPGQSK	223	sp|Q9NR20|DYRK4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,12-UNIMOD:35,13-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=1169	19.898963333333334	3	2061.052762	2061.054989	K	N	488	507