MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100723_037PKG1a.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100723_037PKG1a.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	null	228-UNIMOD:510	0.09	45.0	2	1	0
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	57-UNIMOD:510,63-UNIMOD:21,73-UNIMOD:510	0.10	43.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	180-UNIMOD:510,186-UNIMOD:21,182-UNIMOD:21,105-UNIMOD:510,107-UNIMOD:21,119-UNIMOD:510	0.03	40.0	3	2	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	204-UNIMOD:510,222-UNIMOD:510	0.09	37.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	63-UNIMOD:510,64-UNIMOD:21,66-UNIMOD:4,74-UNIMOD:4,78-UNIMOD:510	0.08	34.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	142-UNIMOD:510,175-UNIMOD:35,176-UNIMOD:510	0.05	33.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	19-UNIMOD:510,21-UNIMOD:21,33-UNIMOD:510	0.06	33.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	33.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	418-UNIMOD:510,435-UNIMOD:21,441-UNIMOD:510	0.05	32.0	1	1	0
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	933-UNIMOD:510,936-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	608-UNIMOD:510,608-UNIMOD:21,622-UNIMOD:510,906-UNIMOD:510,908-UNIMOD:21,915-UNIMOD:510	0.03	32.0	2	2	2
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	37-UNIMOD:510,42-UNIMOD:4,43-UNIMOD:21,67-UNIMOD:510,42-UNIMOD:510,45-UNIMOD:21	0.06	31.0	3	2	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	734-UNIMOD:510,739-UNIMOD:21,744-UNIMOD:4,871-UNIMOD:510,886-UNIMOD:21	0.03	31.0	2	2	2
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510	0.04	31.0	1	1	1
PRT	sp|Q12982|BNIP2_HUMAN	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=BNIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	112-UNIMOD:510,114-UNIMOD:21,124-UNIMOD:510	0.04	31.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	221-UNIMOD:510,160-UNIMOD:510,163-UNIMOD:21,37-UNIMOD:510,40-UNIMOD:21	0.09	31.0	3	3	3
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	239-UNIMOD:510	0.05	31.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	31.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	250-UNIMOD:510,251-UNIMOD:510,252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4,281-UNIMOD:510	0.04	30.0	1	1	1
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	43-UNIMOD:510,57-UNIMOD:510	0.07	30.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	30.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	44-UNIMOD:510,55-UNIMOD:21,54-UNIMOD:21	0.10	30.0	2	1	0
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	48-UNIMOD:510,52-UNIMOD:21,62-UNIMOD:510,51-UNIMOD:21	0.09	30.0	2	1	0
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	52-UNIMOD:510,54-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	230-UNIMOD:510,231-UNIMOD:21,232-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	102-UNIMOD:510,102-UNIMOD:21,118-UNIMOD:510,99-UNIMOD:510,99-UNIMOD:21	0.06	30.0	3	2	1
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	373-UNIMOD:510,375-UNIMOD:510,376-UNIMOD:21	0.06	30.0	1	1	0
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	null	388-UNIMOD:510,388-UNIMOD:21,390-UNIMOD:510	0.05	30.0	1	1	0
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	22-UNIMOD:510,24-UNIMOD:21,35-UNIMOD:510,123-UNIMOD:510,126-UNIMOD:21	0.06	29.0	2	2	2
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	null	424-UNIMOD:510,443-UNIMOD:21,447-UNIMOD:510	0.05	29.0	1	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	28.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	81-UNIMOD:510,83-UNIMOD:21,86-UNIMOD:21,93-UNIMOD:510	0.09	28.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	28.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	143-UNIMOD:510,145-UNIMOD:21,155-UNIMOD:510,228-UNIMOD:510	0.14	28.0	2	2	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	28-UNIMOD:510,28-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	21-UNIMOD:510,21-UNIMOD:21,36-UNIMOD:4,37-UNIMOD:510,22-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	19-UNIMOD:510,19-UNIMOD:21,50-UNIMOD:510	0.07	28.0	1	1	1
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	269-UNIMOD:510,295-UNIMOD:21,298-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	427-UNIMOD:510,429-UNIMOD:21,442-UNIMOD:510,1099-UNIMOD:510,1103-UNIMOD:21	0.02	27.0	2	2	2
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	232-UNIMOD:510,233-UNIMOD:21,245-UNIMOD:510,225-UNIMOD:510	0.08	27.0	2	2	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	325-UNIMOD:510,336-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	204-UNIMOD:510,206-UNIMOD:21,210-UNIMOD:35,215-UNIMOD:35	0.07	26.0	4	1	0
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	684-UNIMOD:510,686-UNIMOD:21,695-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	73-UNIMOD:510,79-UNIMOD:21,83-UNIMOD:35	0.20	26.0	3	1	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	120-UNIMOD:510,138-UNIMOD:21,145-UNIMOD:510	0.11	26.0	2	1	0
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	496-UNIMOD:510,498-UNIMOD:21,500-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	22-UNIMOD:510,24-UNIMOD:21,26-UNIMOD:4,27-UNIMOD:4,44-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	128-UNIMOD:510,131-UNIMOD:21,150-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|P13807-2|GYS1_HUMAN	Isoform 2 of Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	644-UNIMOD:510,646-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	221-UNIMOD:510,223-UNIMOD:21,231-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|Q13976|KGP1_HUMAN	cGMP-dependent protein kinase 1 OS=Homo sapiens OX=9606 GN=PRKG1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	61-UNIMOD:510,73-UNIMOD:21,58-UNIMOD:510,58-UNIMOD:21	0.03	25.0	2	2	2
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	74-UNIMOD:510	0.11	25.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	58-UNIMOD:510,65-UNIMOD:21,63-UNIMOD:21	0.09	25.0	2	1	0
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	656-UNIMOD:510,658-UNIMOD:21,660-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	494-UNIMOD:510,495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21,521-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	264-UNIMOD:510,267-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	1227-UNIMOD:510,1228-UNIMOD:510,1230-UNIMOD:21,1237-UNIMOD:510	0.01	25.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	46-UNIMOD:510,48-UNIMOD:21	0.12	24.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	240-UNIMOD:510,242-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	86-UNIMOD:510,89-UNIMOD:21,87-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	193-UNIMOD:510,199-UNIMOD:21,205-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	539-UNIMOD:510,550-UNIMOD:510,187-UNIMOD:510	0.03	23.0	2	2	2
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	30-UNIMOD:510,38-UNIMOD:21,41-UNIMOD:510	0.09	23.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	295-UNIMOD:510,305-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|P62899-3|RL31_HUMAN	Isoform 3 of 60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	13-UNIMOD:510,15-UNIMOD:21	0.10	23.0	1	1	1
PRT	sp|Q5T0N5-3|FBP1L_HUMAN	Isoform 3 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	428-UNIMOD:510,430-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P16333-2|NCK1_HUMAN	Isoform 2 of Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	18-UNIMOD:510,19-UNIMOD:510,21-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	65-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510	0.09	23.0	1	1	1
PRT	sp|O75665-3|OFD1_HUMAN	Isoform 3 of Oral-facial-digital syndrome 1 protein OS=Homo sapiens OX=9606 GN=OFD1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	857-UNIMOD:510,859-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	100-UNIMOD:510,102-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	331-UNIMOD:510,332-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	1203-UNIMOD:510,1211-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	129-UNIMOD:510,130-UNIMOD:21,144-UNIMOD:510,145-UNIMOD:510	0.07	22.0	2	2	2
PRT	sp|Q96GM8-2|TOE1_HUMAN	Isoform 2 of Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	338-UNIMOD:510,340-UNIMOD:21	0.05	22.0	1	1	0
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	225-UNIMOD:510,229-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	512-UNIMOD:510,514-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	447-UNIMOD:510,449-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	97-UNIMOD:510,100-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q86WR7-2|PRSR2_HUMAN	Isoform 2 of Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	41-UNIMOD:510,43-UNIMOD:21,52-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	409-UNIMOD:510,411-UNIMOD:21,419-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	207-UNIMOD:510,218-UNIMOD:35	0.14	22.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	240-UNIMOD:510,242-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	26-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	278-UNIMOD:510,285-UNIMOD:21,298-UNIMOD:510	0.07	22.0	1	1	0
PRT	sp|Q96GM8|TOE1_HUMAN	Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	418-UNIMOD:510,419-UNIMOD:21	0.05	22.0	1	1	0
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	175-UNIMOD:510,177-UNIMOD:21,181-UNIMOD:35	0.04	21.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	92-UNIMOD:510,94-UNIMOD:510,96-UNIMOD:21,106-UNIMOD:510	0.11	21.0	1	1	1
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	161-UNIMOD:510,164-UNIMOD:21,163-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	28-UNIMOD:510,30-UNIMOD:21,32-UNIMOD:21	0.14	21.0	1	1	1
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:510,7-UNIMOD:21	0.21	21.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	383-UNIMOD:510,389-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q9NYF8-4|BCLF1_HUMAN	Isoform 4 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	317-UNIMOD:510,319-UNIMOD:21,332-UNIMOD:510	0.02	21.0	1	1	0
PRT	sp|Q14671-4|PUM1_HUMAN	Isoform 4 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	648-UNIMOD:510,650-UNIMOD:21,659-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	700-UNIMOD:510,706-UNIMOD:21	0.02	21.0	1	1	0
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	39-UNIMOD:510,41-UNIMOD:21,53-UNIMOD:510	0.15	21.0	1	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	305-UNIMOD:510,305-UNIMOD:21,318-UNIMOD:510,307-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1101-UNIMOD:510,1103-UNIMOD:21	0.00	21.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	342-UNIMOD:510,342-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	1130-UNIMOD:510,1132-UNIMOD:21,1146-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|Q8TEW0|PARD3_HUMAN	Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	713-UNIMOD:510,715-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	259-UNIMOD:510,261-UNIMOD:21,264-UNIMOD:4,271-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	85-UNIMOD:510,88-UNIMOD:21,99-UNIMOD:510	0.10	21.0	1	1	0
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	317-UNIMOD:510,322-UNIMOD:21,332-UNIMOD:510	0.02	21.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510	ms_run[2]:scan=4726	48.265	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510	ms_run[2]:scan=4618	47.26	2	2226.9361	2226.9361	R	-	228	248
PSM	SLDSDESEDEEDDYQQK	3	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,7-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1918	25.731	2	2178.8638	2178.8638	K	R	57	74
PSM	INSSGESGDESDEFLQSR	4	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=3125	34.87956333333333	2	2069.858198	2069.863906	R	K	180	198
PSM	INSSGESGDESDEFLQSR	5	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3125	34.88	2	2069.8639	2069.8639	R	K	180	198
PSM	DNLTLWTSDMQGDGEEQNK	6	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4576	46.851	2	2248.059	2248.0590	R	E	204	223
PSM	TPEELDDSDFETEDFDVR	7	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4808	49.139	2	2271.9157	2271.9157	R	S	264	282
PSM	FSVCVLGDQQHCDEAK	8	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,2-UNIMOD:21,4-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=3669	39.126	2	2039.9118	2039.9118	K	A	63	79
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	9	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,34-UNIMOD:35,35-UNIMOD:510	ms_run[2]:scan=2284	28.461	3	4236.62	4236.6200	K	A	142	177
PSM	KQSLGELIGTLNAAK	10	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4722	48.235	2	1724.0334	1724.0334	R	V	19	34
PSM	RVSVCAETYNPDEEEEDTDPR	11	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2564	30.56	3	2624.0798	2624.0798	R	V	97	118
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	12	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2552	30.471	3	2810.1902	2810.1902	R	E	418	442
PSM	RNTTQNTGYSSGTQNANYPVR	13	sp|Q12965|MYO1E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1414	21.947	3	2442.1137	2442.1137	R	A	933	954
PSM	STQGVTLTDLQEAEK	14	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,1-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3900	41.001	2	1766.8976	1766.8976	R	T	608	623
PSM	ERPERCSSSSGGGSSGDEDGLELDGAPGGGK	15	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:4,7-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=1981	26.201	3	3154.3783	3154.3783	R	R	37	68
PSM	ERPTPSLNNNCTTSEDSLVLYNR	16	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3524	37.941	3	2793.2853	2793.2853	K	V	734	757
PSM	EYIPGQPPLSQSSDSSPTR	17	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3265	35.941	2	2158.9996	2158.9996	K	N	871	890
PSM	GILAADESTGSIAK	18	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2721	31.752	2	1479.7858	1479.7858	K	R	29	43
PSM	KGSITEYTAAEEK	19	sp|Q12982|BNIP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1654	23.745	2	1607.8544	1607.8544	R	E	112	125
PSM	STAGDTHLGGEDFDNR	20	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=1663	23.814	2	1724.7814	1724.7814	K	M	221	237
PSM	SYELPDGQVITIGNER	21	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=4763	48.592	2	1823.9478	1823.9478	K	F	239	255
PSM	TAFQEALDAAGDK	22	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3214	35.551	2	1403.7569	1403.7569	K	L	9	22
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	23	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4,32-UNIMOD:510	ms_run[2]:scan=4845	49.489	4	4015.8382	4015.8382	R	I	250	282
PSM	DLADELALVDVIEDK	24	sp|P00338-5|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6223	68.006	2	1724.972	1724.9720	K	L	43	58
PSM	DSSTSPGDYVLSVSENSR	25	sp|P46108-2|CRK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4492	46.008	2	2012.8788	2012.8788	R	V	39	57
PSM	ELAPYDENWFYTR	26	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=5205	53.529	2	1816.7922	1816.7922	K	A	44	57
PSM	NRPTSISWDGLDSGK	27	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3607	38.642	2	1779.8829	1779.8829	K	L	48	63
PSM	NVSSFPDDATSPLQENR	28	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3855	40.651	2	1989.8893	1989.8893	R	N	52	69
PSM	SSSPAPADIAQTVQEDLR	29	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=5110	52.362	2	1997.9519	1997.9519	K	T	230	248
PSM	SVGDGETVEFDVVEGEK	30	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,1-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4498	46.056	2	1942.9085	1942.9085	R	G	102	119
PSM	TDKSSASAPDVDDPEAFPALA	31	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4719	48.213	2	2251.057	2251.0570	R	-	373	394
PSM	TDKSSASAPDVDDPEAFPALA	32	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,1-UNIMOD:21,3-UNIMOD:510	ms_run[1]:scan=4719	48.212965	2	2251.051344	2251.056975	R	-	388	409
PSM	SSSPAPADIAQTVQEDLR	33	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=5110	52.361731666666664	2	1997.9493	1997.9514	K	T	230	248
PSM	GVSLTNHHFYDESK	34	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2370	29.108	2	1780.8458	1780.8458	R	P	22	36
PSM	NRPTSISWDGLDSGK	35	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3607	38.642185	2	1779.8801	1779.8824	K	L	48	63
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	36	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,20-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=2552	30.471076666666665	3	2810.182922	2810.190250	R	E	424	448
PSM	AFLAELEQNSPK	37	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4072	42.42	2	1493.7803	1493.7803	K	I	2424	2436
PSM	AITGASLADIMAK	38	sp|P83731|RL24_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5230	53.782	2	1488.7337	1488.7337	R	R	81	94
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	39	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4888	49.977	3	2995.386	2995.3860	R	G	2913	2938
PSM	KNSVVEASEAAYK	40	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1611	23.423	2	1576.8598	1576.8598	K	E	143	156
PSM	SVTEQGAELSNEER	41	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1882	25.458	2	1661.7358	1661.7358	K	N	28	42
PSM	TSDANETEDHLESLICK	42	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21,16-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=4388	45.096	3	2108.961	2108.9610	K	V	21	38
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	43	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21,32-UNIMOD:510	ms_run[2]:scan=1851	25.225	3	2580.1514	2580.1514	R	A	19	51
PSM	TSDANETEDHLESLICK	44	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:4,17-UNIMOD:510	ms_run[1]:scan=4388	45.095814999999995	3	2108.959381	2108.960966	K	V	21	38
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	45	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	ms_run[2]:scan=1439	22.133	3	3241.4532	3241.4532	K	E	269	299
PSM	RFSEGVLQSPSQDQEK	46	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2532	30.321	2	1981.9783	1981.9783	R	L	427	443
PSM	SSGPYGGGGQYFAK	47	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2811	32.427	2	1522.713	1522.7130	R	P	232	246
PSM	ELAPYDENWFYTR	48	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=5205	53.52886166666667	2	1816.7914	1816.7917	K	A	44	57
PSM	EVDEQMLNVQNK	49	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2638	31.118	2	1513.8083	1513.8083	K	N	325	337
PSM	GASQAGMTGYGMPR	50	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2777	32.175	2	1496.6366	1496.6366	R	Q	204	218
PSM	GGSISVQVNSIK	51	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2872	32.883	2	1335.7436	1335.7436	R	F	684	696
PSM	KEESEESDDDMGFGLFD	52	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4891	50.015	2	2112.8395	2112.8395	K	-	73	90
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	53	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,19-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4026	42.071	3	3090.3451	3090.3451	K	E	120	146
PSM	QRSPSPAPAPAPAAAAGPPTR	54	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=1594	23.296	3	2161.0295	2161.0295	R	K	496	517
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	55	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,6-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=3887	40.897	3	2895.1876	2895.1876	R	L	22	47
PSM	RHASSSDDFSDFSDDSDFSPSEK	56	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=3398	36.971	3	2712.1137	2712.1137	K	G	128	151
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	57	sp|P13807-2|GYS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3397	36.963	3	3219.4993	3219.4993	K	-	644	674
PSM	SASWGSADQLK	58	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2829	32.561	2	1296.6388	1296.6388	R	E	221	232
PSM	TVIIEQSWGSPK	59	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3838	40.523	2	1491.8011	1491.8011	R	V	61	73
PSM	AQGISAEPQTYRSFHDLR	60	sp|Q13976|KGP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2716	31.714	2	2189.0479	2189.0479	R	Q	61	79
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	61	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:4,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=2892	33.034	2	2487.0381	2487.0381	R	R	42	68
PSM	EGMNIVEAMER	62	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3975	41.621	2	1311.6375	1311.6375	K	F	74	85
PSM	FASENDLPEWK	63	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4309	44.384	2	1482.7068	1482.7068	R	E	58	69
PSM	GASQAGMTGYGMPR	64	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=1184	20.201	2	1528.6264	1528.6264	R	Q	204	218
PSM	INPDGSQSVVEVPYAR	65	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3623	38.776	2	1843.893	1843.8930	R	S	58	74
PSM	KEESEESDDDMGFGLFD	66	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4342	44.712	2	2032.8732	2032.8732	K	-	73	90
PSM	RRTSTPVIMEGVQEETDTR	67	sp|Q8NFC6|BD1L1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2676	31.401	3	2318.115	2318.1150	K	D	656	675
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	68	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510	ms_run[2]:scan=1126	19.758	4	3246.2875	3246.2875	R	K	494	522
PSM	VTDSSVSVQLRE	69	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2907	33.146	2	1432.7023	1432.7023	R	-	264	276
PSM	YKASITALEAK	70	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2508	30.143	2	1375.8213	1375.8213	K	I	1227	1238
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	71	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=2892	33.03371166666666	2	2487.0252	2487.0372	R	R	42	68
PSM	RRTSTPVIMEGVQEETDTR	72	sp|Q8NFC6|BD1L1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=2676	31.400521666666666	3	2318.1117	2318.1145	K	D	656	675
PSM	GASQAGMTGYGMPR	73	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=1815	24.95	2	1512.6315	1512.6315	R	Q	204	218
PSM	GGNFGGRSSGPYGGGGQYFAK	74	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=2818	32.48	3	2168.0113	2168.0113	K	P	225	246
PSM	RISGLIYEETR	75	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3159	35.135	2	1449.7441	1449.7441	K	G	46	57
PSM	RVSHQGYSTEAEFEEPR	76	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1863	25.316	3	2134.9533	2134.9533	R	V	240	257
PSM	TTPSVVAFTADGER	77	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3615	38.715	2	1563.7394	1563.7394	R	L	86	100
PSM	VPTANVSVVDLTCR	78	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3833	40.486	2	1643.8166	1643.8166	R	L	193	207
PSM	YLRSVGDGETVEFDVVEGEK	79	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4256	43.926	3	2375.157	2375.1570	K	G	99	119
PSM	YLRSVGDGETVEFDVVEGEK	80	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,1-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=4256	43.925823333333334	3	2375.1546	2375.1565	K	G	99	119
PSM	DNLTLWTSDQQDEEAGEGN	81	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=4696	47.978	2	2154.9402	2154.9402	R	-	228	247
PSM	EGLELPEDEEEK	82	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2793	32.292	2	1483.7566	1483.7566	K	K	539	551
PSM	ERESLQQMAEVTR	83	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2381	29.192	2	1689.797	1689.7970	K	E	123	136
PSM	ESVPEFPLSPPK	84	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4488	45.978	2	1473.7793	1473.7793	K	K	30	42
PSM	GASQAGMTGYGMPR	85	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=1976	26.163	2	1512.6315	1512.6315	R	Q	204	218
PSM	GDLGIEIPAEK	86	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3492	37.696	2	1208.7289	1208.7289	R	V	295	306
PSM	GPLQSVQVFGR	87	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3928	41.245	2	1300.6753	1300.6753	K	K	5	16
PSM	GRSAINEVVTR	88	sp|P62899-3|RL31_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1694	24.045	2	1314.6869	1314.6869	K	E	13	24
PSM	KEESEESDDDMGFGLFD	89	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=5472	56.953	2	2096.8446	2096.8446	K	-	73	90
PSM	RHSSDINHLVTQGR	90	sp|Q5T0N5-3|FBP1L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1350	21.467	3	1732.8582	1732.8582	R	E	428	442
PSM	RKPSVPDSASPADDSFVDPGER	91	sp|P16333-2|NCK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2600	30.831	3	2476.1908	2476.1908	K	L	18	40
PSM	RNQSFCPTVNLDK	92	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2555	30.493	2	1725.8546	1725.8546	K	L	65	78
PSM	RQSNLQEVLER	93	sp|O75665-3|OFD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2490	30.006	2	1484.7561	1484.7561	R	E	857	868
PSM	SSSPVQVEEEPVR	94	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1945	25.931	2	1555.7343	1555.7343	R	L	100	113
PSM	SSTVTEAPIAVVTSR	95	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3718	39.516	2	1630.8391	1630.8391	R	T	331	346
PSM	TDYNASVSVPDSSGPER	96	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2560	30.529	2	1893.8206	1893.8206	R	I	70	87
PSM	INPDGSQSVVEVPYAR	97	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=3623	38.775531666666666	2	1843.8885	1843.8924	R	S	58	74
PSM	SATSSSPGSPLHSLETSL	98	sp|P20020|AT2B1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=4883	49.92464666666667	2	1870.8750	1870.8768	K	-	1203	1221
PSM	ASGNYATVISHNPETK	99	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2220	27.981	3	1835.9091	1835.9091	R	K	129	145
PSM	ATSEVPGSQASPNPVPGDGLHR	100	sp|Q96GM8-2|TOE1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2391	29.267	3	2286.0854	2286.0854	R	A	338	360
PSM	DAGTIAGLNVLR	101	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4885	49.941	2	1312.6964	1312.6964	K	I	160	172
PSM	EDQTEYLEER	102	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1879	25.437	2	1344.6258	1344.6258	K	R	187	197
PSM	ENRESLVVNYEDLAAR	103	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3962	41.522	3	1990.9574	1990.9574	K	E	225	241
PSM	FQSSHHPTDITSLDQYVER	104	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3700	39.362	3	2373.0851	2373.0851	R	M	512	531
PSM	RISAVSVAER	105	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1547	22.941	2	1200.644	1200.6440	R	V	447	457
PSM	SLQSVAEER	106	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2314	28.683	2	1131.5385	1131.5385	R	A	97	106
PSM	SRSFTLDDESLK	107	sp|Q86WR7-2|PRSR2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2935	33.357	2	1544.776	1544.7760	R	Y	41	53
PSM	SSSGLLEWESK	108	sp|P14866-2|HNRPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4228	43.71	2	1369.6803	1369.6803	R	S	409	420
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	109	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:35	ms_run[2]:scan=4195	43.414	3	3506.5004	3506.5004	R	-	207	238
PSM	THSTSSSLGSGESPFSR	110	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2169	27.603	2	1836.8104	1836.8104	R	S	240	257
PSM	TTPSYVAFTDTER	111	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3544	38.122	2	1600.7234	1600.7234	R	L	37	50
PSM	TTRAQGISAEPQTYR	112	sp|Q13976|KGP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1489	22.511	3	1791.8729	1791.8729	R	S	58	73
PSM	VEIIANDQGNR	113	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510	ms_run[1]:scan=1538	22.87504333333333	2	1261.6818	1261.6834	K	T	26	37
PSM	GGNFGGRSSGPYGGGGQYFAK	114	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=2818	32.480270000000004	3	2168.0090	2168.0108	K	P	278	299
PSM	ATSEVPGSQASPNPVPGDGLHR	115	sp|Q96GM8|TOE1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=2391	29.266931666666665	3	2286.0798	2286.0849	R	A	418	440
PSM	ALSRQEMQEVQSSR	116	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=1085	19.45	3	1777.8242	1777.8242	K	S	175	189
PSM	ASGNYATVISHNPETKK	117	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510,17-UNIMOD:510	ms_run[2]:scan=1788	24.746	3	1998.0672	1998.0672	R	T	129	146
PSM	DGKYSQVLANGLDNK	118	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3500	37.755	2	1802.9664	1802.9664	K	L	92	107
PSM	DRSSPPPGYIPDELHQVAR	119	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3425	37.175	3	2247.0898	2247.0898	R	N	161	180
PSM	EAAFSPGQQDWSR	120	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3328	36.437	2	1591.6881	1591.6881	R	D	1099	1112
PSM	ERSPSPLRGNVVPSPLPTR	121	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=3190	35.372	3	2252.1292	2252.1292	R	R	28	47
PSM	GHQQLYWSHPR	122	sp|P62273|RS29_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1549	22.957	3	1521.7091	1521.7091	M	K	2	13
PSM	GNSRPGTPSAEGGSTSSTLR	123	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1039	19.093	3	2031.9435	2031.9435	R	A	383	403
PSM	GRSSFYPDGGDQETAK	124	sp|Q9NYF8-4|BCLF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1572	23.128	3	1861.852	1861.8520	R	T	317	333
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	125	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,26-UNIMOD:510	ms_run[2]:scan=3674	39.164	3	3010.3787	3010.3787	K	E	120	146
PSM	KQSFDDNDSEELEDK	126	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1850	25.217	3	1979.9098	1979.9098	K	D	105	120
PSM	RDSLTGSSDLYK	127	sp|Q14671-4|PUM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1928	25.806	2	1488.7498	1488.7498	R	R	648	660
PSM	RISEMEEELK	128	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2757	32.027	2	1410.7102	1410.7102	R	M	906	916
PSM	RISHSLYSGIEGLDESPSR	129	sp|Q8TEW0-9|PARD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3504	37.785	3	2216.0687	2216.0687	R	N	700	719
PSM	RNSSEASSGDFLDLK	130	sp|Q9UK76-3|JUPI1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3424	37.167	2	1772.8618	1772.8618	R	G	39	54
PSM	SRSPESQVIGENTKQP	131	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1623	23.513	3	1903.9677	1903.9677	R	-	305	321
PSM	SSSPVTELASR	132	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2209	27.897	2	1246.6019	1246.6019	R	S	1101	1112
PSM	SWASPVYTEADGTFSR	133	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4543	46.51	2	1886.83	1886.8300	R	L	342	358
PSM	TTPSVVAFTADGER	134	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3839	40.53	2	1563.7394	1563.7394	R	L	86	100
PSM	VRYSLDPENPTK	135	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2398	29.321	2	1565.8127	1565.8127	M	S	2	14
PSM	SRSPESQVIGENTKQP	136	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=1623	23.51305	3	1903.9666	1903.9672	R	-	305	321
PSM	VASETHSEGSEYEELPK	137	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=2092	27.028881666666663	3	2039.9422	2038.9402	R	R	1130	1147
PSM	RISHSLYSGIEGLDESPSR	138	sp|Q8TEW0|PARD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3504	37.78458666666666	3	2216.0664	2216.0682	R	N	713	732
PSM	DRSSPPPGYIPDELHQVAR	139	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3425	37.17456333333333	3	2247.0862	2247.0892	R	N	161	180
PSM	VDSTTCLFPVEEK	140	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[1]:scan=4267	44.009881666666665	2	1673.8122	1671.8102	R	A	259	272
PSM	RNSSEASSGDFLDLK	141	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3424	37.16712666666667	2	1772.8581	1772.8613	R	G	85	100
PSM	GRSSFYPDGGDQETAK	142	sp|Q9NYF8|BCLF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=1572	23.128404999999997	3	1861.851454	1861.852007	R	T	317	333