MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100607_021SRPK2.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100607_021SRPK2.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	42-UNIMOD:510,42-UNIMOD:4,43-UNIMOD:21,67-UNIMOD:510	0.05	42.0	2	1	0
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	41.0	null	225-UNIMOD:510	0.09	41.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	203-UNIMOD:510,221-UNIMOD:510	0.05	39.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	228-UNIMOD:510	0.09	38.0	4	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	223-UNIMOD:510	0.10	37.0	2	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	204-UNIMOD:510,222-UNIMOD:510,213-UNIMOD:35,223-UNIMOD:510	0.13	36.0	4	2	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	396-UNIMOD:510,397-UNIMOD:21,416-UNIMOD:21	0.05	36.0	4	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	180-UNIMOD:510,186-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	36.0	null	634-UNIMOD:510,641-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P78362|SRPK2_HUMAN	SRSF protein kinase 2 OS=Homo sapiens OX=9606 GN=SRPK2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	357-UNIMOD:510,361-UNIMOD:510,380-UNIMOD:21,382-UNIMOD:510,325-UNIMOD:510,326-UNIMOD:510,328-UNIMOD:21,340-UNIMOD:510,327-UNIMOD:510,327-UNIMOD:21,301-UNIMOD:510,307-UNIMOD:21,320-UNIMOD:4,324-UNIMOD:510,376-UNIMOD:21,308-UNIMOD:21,362-UNIMOD:510,300-UNIMOD:510	0.10	35.0	9	6	3
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	223-UNIMOD:510,237-UNIMOD:4	0.10	34.0	2	1	0
PRT	sp|Q9NYV4-3|CDK12_HUMAN	Isoform 3 of Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	233-UNIMOD:510,249-UNIMOD:21	0.02	33.0	1	1	0
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	74-UNIMOD:510,76-UNIMOD:21,80-UNIMOD:4	0.06	33.0	1	1	1
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	75-UNIMOD:510	0.13	32.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	598-UNIMOD:510,601-UNIMOD:21,603-UNIMOD:21,598-UNIMOD:21,595-UNIMOD:510	0.04	32.0	5	2	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	null	39-UNIMOD:510,41-UNIMOD:21	0.06	32.0	1	1	0
PRT	sp|Q9NYV4|CDK12_HUMAN	Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	null	233-UNIMOD:510,251-UNIMOD:21	0.01	32.0	1	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	871-UNIMOD:510,886-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	239-UNIMOD:510	0.05	31.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510	0.02	30.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510	0.03	30.0	2	1	0
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	114-UNIMOD:510	0.13	30.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	29.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	496-UNIMOD:510,498-UNIMOD:21,500-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	228-UNIMOD:510	0.08	28.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	323-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	28.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	431-UNIMOD:510	0.04	27.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	74-UNIMOD:510	0.11	27.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	120-UNIMOD:510,138-UNIMOD:21,145-UNIMOD:510	0.11	27.0	2	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	134-UNIMOD:510,142-UNIMOD:510,145-UNIMOD:21,154-UNIMOD:510	0.07	27.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	39-UNIMOD:510,43-UNIMOD:21	0.09	26.0	1	1	0
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	1153-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|Q08AD1-2|CAMP2_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	1284-UNIMOD:510,1286-UNIMOD:21,1292-UNIMOD:21	0.01	26.0	1	1	0
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	26-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	116-UNIMOD:510,118-UNIMOD:21	0.02	26.0	1	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	25.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	500-UNIMOD:510,547-UNIMOD:510,558-UNIMOD:510	0.03	25.0	2	2	2
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	103-UNIMOD:510,114-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	186-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	25.0	2	1	0
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,466-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	8-UNIMOD:510,23-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	264-UNIMOD:510,268-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	576-UNIMOD:510,578-UNIMOD:21,580-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	469-UNIMOD:510,502-UNIMOD:510	0.07	24.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	871-UNIMOD:510,872-UNIMOD:4,876-UNIMOD:21,882-UNIMOD:510,1099-UNIMOD:510,1101-UNIMOD:21,1103-UNIMOD:21,1537-UNIMOD:510,1539-UNIMOD:21,1541-UNIMOD:21,1548-UNIMOD:510,1644-UNIMOD:510,1648-UNIMOD:21,1657-UNIMOD:21,1664-UNIMOD:510	0.03	24.0	4	4	4
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	379-UNIMOD:510,292-UNIMOD:510,306-UNIMOD:510	0.04	24.0	2	2	2
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	28-UNIMOD:510,30-UNIMOD:21,32-UNIMOD:21	0.14	23.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	100-UNIMOD:510,101-UNIMOD:21	0.02	23.0	1	1	0
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	1192-UNIMOD:510,1192-UNIMOD:21	0.02	23.0	1	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	25-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	91-UNIMOD:510,94-UNIMOD:4	0.07	22.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	821-UNIMOD:510,823-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	71-UNIMOD:510,80-UNIMOD:21,81-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	494-UNIMOD:510,495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21,521-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	1311-UNIMOD:510,1313-UNIMOD:21,1321-UNIMOD:21	0.01	22.0	1	1	0
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	11-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	995-UNIMOD:510,999-UNIMOD:21,1013-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|Q27J81-2|INF2_HUMAN	Isoform 2 of Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1192-UNIMOD:510,1194-UNIMOD:21	0.02	21.0	1	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	82-UNIMOD:510,92-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|Q9BVR0|HRC23_HUMAN	Putative HERC2-like protein 3 OS=Homo sapiens OX=9606 GN=HERC2P3 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	670-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q8N2K0-3|ABD12_HUMAN	Isoform 3 of Lysophosphatidylserine lipase ABHD12 OS=Homo sapiens OX=9606 GN=ABHD12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	5-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:35,21-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	335-UNIMOD:510,337-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	77-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q96MU7-2|YTDC1_HUMAN	Isoform 2 of YTH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=YTHDC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	306-UNIMOD:510,308-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	154-UNIMOD:510	0.03	20.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	1	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=2532	35.892	2	2487.0381	2487.0381	R	R	42	68
PSM	DNLTLWTSENQGDEGDAGEGEN	2	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:510	ms_run[1]:scan=3801	50.99865166666667	2	2384.0069	2384.0095	R	-	225	247
PSM	DATNVGDEGGFAPNILENK	3	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3582	48.07	2	2028.0436	2028.0436	K	E	203	222
PSM	DNLTLWTSDQQDDDGGEGNN	4	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=3915	52.41	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDTQGDEAEAGEGGEN	5	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:510	ms_run[1]:scan=3931	52.57468000000001	2	2442.048981	2442.051903	R	-	223	246
PSM	DNLTLWTSDMQGDGEEQNK	6	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3700	49.583	2	2248.059	2248.0590	R	E	204	223
PSM	DYEEVGVDSVEGEGEEEGEEY	7	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=3678	49.279	2	2381.9607	2381.9607	K	-	396	417
PSM	INSSGESGDESDEFLQSR	8	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2751	38.084	2	2069.8639	2069.8639	R	K	180	198
PSM	TPEELDDSDFETEDFDVR	9	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=3922	52.46843166666667	2	2271.9131	2271.9151	R	S	634	652
PSM	ENIEKDEDDVDQELANIDPTWIESPK	10	sp|P78362|SRPK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:510,5-UNIMOD:510,24-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=4517	62.03151833333334	3	3223.5527	3223.5541	K	T	357	383
PSM	DNLTLWTSDSAGEECDAAEGAEN	11	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=4005	53.493	3	2488.0396	2488.0396	R	-	223	246
PSM	LKTTGLEEAAEAETAK	12	sp|P78362|SRPK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,2-UNIMOD:510,4-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2852	39.063	2	1843.0076	1843.0076	K	D	325	341
PSM	QDDSPSGASYGQDYDLSPSR	13	sp|Q9NYV4-3|CDK12_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=2603	36.557	2	2257.9225	2257.9225	K	S	233	253
PSM	TQSPGGCSAEAVLAR	14	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2245	32.812	2	1616.7442	1616.7442	R	K	74	89
PSM	DNLTLWTSDQQDDDGGEGNN	15	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=3998	53.419	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDTQGDEAEAGEGGEN	16	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=3935	52.609	3	2442.0519	2442.0519	R	-	223	246
PSM	DWEDDSDEDMSNFDR	17	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=3340	44.894	2	1908.7168	1908.7168	K	F	75	90
PSM	TDGSISGDRQPVTVADYISR	18	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=3520	47.295	2	2330.0405	2330.0405	R	A	598	618
PSM	TTGLEEAAEAETAK	19	sp|P78362|SRPK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2519	35.786	2	1567.7655	1567.7655	K	D	327	341
PSM	DSSTSPGDYVLSVSENSR	20	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3664	49.12515666666666	2	2012.8787	2012.8783	R	V	39	57
PSM	QDDSPSGASYGQDYDLSPSR	21	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,19-UNIMOD:21	ms_run[1]:scan=2603	36.55718666666667	2	2257.921509	2257.922483	K	S	233	253
PSM	EYIPGQPPLSQSSDSSPTR	22	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=2803	38.555	2	2158.9996	2158.9996	K	N	871	890
PSM	SYELPDGQVITIGNER	23	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=3793	50.889	2	1823.9478	1823.9478	K	F	239	255
PSM	LKTTGLEEAAEAETAK	24	sp|P78362|SRPK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=2852	39.062554999999996	2	1843.0066	1843.0071	K	D	325	341
PSM	DNLTLWTSDQQDDDGGEGNN	25	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=3835	51.346	2	2226.9361	2226.9361	R	-	228	248
PSM	ETVSEESNVLCLSK	26	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=2772	38.265	2	1661.8818	1661.8818	R	S	581	595
PSM	EVDEQMLNVQNK	27	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1520	26.236	2	1529.8032	1529.8032	K	N	325	337
PSM	YFQINQDEEEEEDED	28	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=2781	38.362	2	1964.786	1964.7860	R	-	114	129
PSM	IIEENITSAAPSNDQDGEYCPEVK	29	sp|P78362|SRPK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,7-UNIMOD:21,20-UNIMOD:4,24-UNIMOD:510	ms_run[1]:scan=3011	40.736315000000005	2	2826.2874	2826.2938	K	L	301	325
PSM	TDGSISGDRQPVTVADYISR	30	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=3520	47.295498333333335	2	2330.0382	2330.0400	R	A	598	618
PSM	DYEEVGVDSVEGEGEEEGEEY	31	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3827	51.265	2	2461.927	2461.9270	K	-	396	417
PSM	EVDEQMLNVQNK	32	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2309	33.57	2	1513.8083	1513.8083	K	N	325	337
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	33	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=1890	29.59	3	2826.1852	2826.1852	R	E	418	442
PSM	QRSPSPAPAPAPAAAAGPPTR	34	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=1447	25.514	3	2161.0295	2161.0295	R	K	496	517
PSM	DNLTLWTSDQQDEEAGEGN	35	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=3872	51.767	2	2154.9402	2154.9402	R	-	228	247
PSM	TAENATSGETLEENEAGD	36	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=1697	27.793	2	1870.8128	1870.8128	K	-	323	341
PSM	TAFQEALDAAGDK	37	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2743	38.01	2	1403.7569	1403.7569	K	L	9	22
PSM	DYEEVGADSADGEDEGEEY	38	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=3038	41.044	2	2111.8027	2111.8027	K	-	431	450
PSM	DYEEVGVDSVEGEGEEEGEEY	39	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=3990	53.338	2	2541.8933	2541.8933	K	-	396	417
PSM	EGMNIVEAMER	40	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=3269	44.142	2	1311.6375	1311.6375	K	F	74	85
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	41	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,19-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3321	44.714	3	3090.3451	3090.3451	K	E	120	146
PSM	NGSLDSPGKQDTEEDEEEDEK	42	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,9-UNIMOD:510,12-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=1162	22.897	3	2532.1125	2532.1125	K	D	134	155
PSM	ENIEKDEDDVDQELANIDPTWIESPK	43	sp|P78362|SRPK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,5-UNIMOD:510,20-UNIMOD:21,24-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=4627	63.72791333333333	3	3303.5190	3303.5204	K	T	357	383
PSM	DNLTLWTSDMQGDGEEQNK	44	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3702	49.601	3	2248.059	2248.0590	R	E	204	223
PSM	DSSTSPGDYVLSVSENSR	45	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3664	49.125	2	2012.8788	2012.8788	R	V	39	57
PSM	DYEEVGVDSVEGEGEEEGEEY	46	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=3684	49.374	3	2381.9607	2381.9607	K	-	396	417
PSM	IAQLEEELEEEQGNTELINDR	47	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=3716	49.793	3	2505.2295	2505.2295	R	L	1153	1174
PSM	IIEENITSAAPSNDQDGEYCPEVK	48	sp|P78362|SRPK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:21,20-UNIMOD:4,24-UNIMOD:510	ms_run[2]:scan=3011	40.736	2	2826.2943	2826.2943	K	L	301	325
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	49	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,26-UNIMOD:510	ms_run[2]:scan=3095	41.714	3	3010.3787	3010.3787	K	E	120	146
PSM	SESVEGFLSPSR	50	sp|Q08AD1-2|CAMP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=3587	48.114	2	1487.6159	1487.6159	R	C	1284	1296
PSM	DEDDVDQELANIDPTWIESPK	51	sp|P78362|SRPK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,19-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=4821	67.27168333333334	3	2576.1842	2576.1838	K	T	362	383
PSM	VEIIANDQGNR	52	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510	ms_run[1]:scan=1422	25.316319999999997	2	1261.6830	1261.6834	K	T	26	37
PSM	SSSPVQVEEEPVR	53	sp|Q8IZ21|PHAR4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1801	28.771718333333336	2	1555.7333	1555.7338	R	L	116	129
PSM	AFLAELEQNSPK	54	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3350	45.016	2	1493.7803	1493.7803	K	I	2424	2436
PSM	DNLTLWTSDQQDDDGGEGNN	55	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3840	51.388	3	2226.9361	2226.9361	R	-	228	248
PSM	DQVANSAFVER	56	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1837	29.073	2	1268.6573	1268.6573	K	L	500	511
PSM	ELISNASDALDK	57	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2359	34.134	2	1342.7616	1342.7616	R	I	103	115
PSM	GDRSEDFGVNEDLADSDAR	58	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=2455	35.14	3	2100.9408	2100.9408	K	A	186	205
PSM	KEESEESDDDMGFGLFD	59	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=4104	55.064	2	2016.8783	2016.8783	K	-	73	90
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	60	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=1650	27.383	3	2863.2161	2863.2161	K	M	445	470
PSM	LIAPVAEEEATVPNNK	61	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2470	35.277	2	1762.0149	1762.0149	K	I	8	24
PSM	TDGSISGDRQPVTVADYISR	62	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3147	42.377	3	2250.0742	2250.0742	R	A	598	618
PSM	VTDSSVSVQLRE	63	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2316	33.622	2	1432.7023	1432.7023	R	-	264	276
PSM	DNLTLWTSDSAGEECDAAEGAEN	64	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[1]:scan=3999	53.42659166666666	2	2488.0365	2488.0391	R	-	223	246
PSM	TRSPSPDDILER	65	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=2525	35.83566833333334	2	1578.6897	1578.6899	R	V	576	588
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	66	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,34-UNIMOD:510	ms_run[2]:scan=3989	53.33	3	3824.5651	3824.5651	K	A	469	503
PSM	KEESEESDDDMGFGLFD	67	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=3566	47.884	2	2032.8732	2032.8732	K	-	73	90
PSM	SCFESSPDPELK	68	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:4,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2270	33.142	2	1542.695	1542.6950	R	S	871	883
PSM	SRSSSPVTELASR	69	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=1920	29.831	2	1569.7013	1569.7013	R	S	1099	1112
PSM	GVVDSEDLPLNISR	70	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510	ms_run[1]:scan=3308	44.535156666666666	2	1546.8410	1546.8410	R	E	379	393
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	71	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=2531	35.884548333333335	3	2487.0371	2487.0376	R	R	42	68
PSM	EGLELPEDEEEK	72	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2443	35.012	2	1483.7566	1483.7566	K	K	547	559
PSM	ERSPSPLRGNVVPSPLPTR	73	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2707	37.676	3	2252.1292	2252.1292	R	R	28	47
PSM	SSSPVQVEEEPVR	74	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=1801	28.772	2	1555.7343	1555.7343	R	L	100	113
PSM	TDGSISGDRQPVTVADYISR	75	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=3512	47.159009999999995	3	2330.0397	2330.0400	R	A	598	618
PSM	SFSEDAVTDSSGSGTLPR	76	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=2955	40.16869166666667	2	1925.8455	1925.8463	K	A	1192	1210
PSM	DNLTLWTSDMQGDGEEQNK	77	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3212	43.331	3	2264.0539	2264.0539	R	E	204	223
PSM	EQFLDGDGWTSR	78	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3137	42.249	2	1443.6843	1443.6843	K	W	25	37
PSM	GDFCIQVGR	79	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=2479	35.383	2	1084.5548	1084.5548	R	N	91	100
PSM	KIIEENITSAAPSNDQDGEYCPEVK	80	sp|P78362|SRPK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,21-UNIMOD:4,25-UNIMOD:510	ms_run[2]:scan=2679	37.362	3	2988.4524	2988.4524	R	L	300	325
PSM	SGSYSYLEER	81	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2345	33.96	2	1303.5546	1303.5546	R	K	821	831
PSM	SRSGSSQELDVKPSASPQER	82	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1389	25.048	3	2372.1047	2372.1047	R	S	1537	1557
PSM	TFDQLTPDESK	83	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2490	35.514	2	1427.6858	1427.6858	K	E	71	82
PSM	DNLTLWTSENQGDEGDAGEGEN	84	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510	ms_run[1]:scan=3800	50.99095	3	2384.0095	2384.0095	R	-	225	247
PSM	GNRTDGSISGDRQPVTVADYISR	85	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=3029	40.92646666666667	3	2657.205582	2657.206007	R	A	595	618
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	86	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510	ms_run[1]:scan=1050	21.819426666666665	4	3246.2850	3246.2869	R	K	494	522
PSM	SESVEGFLSPSR	87	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=3587	48.11351333333333	2	1487.615889	1487.615874	R	C	1311	1323
PSM	DVIELTDDSFDK	88	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3627	48.647	2	1463.7668	1463.7668	K	N	158	170
PSM	EALQDVEDENQ	89	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1977	30.351	2	1322.605	1322.6050	K	-	223	234
PSM	EYIPGQPPLSQSSDSSPTR	90	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=2813	38.635	3	2158.9996	2158.9996	K	N	871	890
PSM	GRGPSPEGSSSTESSPEHPPK	91	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=875	19.942	3	2334.0203	2334.0203	K	S	1644	1665
PSM	HGESAWNLENR	92	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1576	26.713	2	1345.6587	1345.6587	R	F	11	22
PSM	QREESETRSESSDFEVVPK	93	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=1905	29.707	3	2386.1326	2386.1326	R	R	995	1014
PSM	SFSEDAVTDSSGSGTLPR	94	sp|Q27J81-2|INF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2955	40.169	2	1925.8468	1925.8468	K	A	1192	1210
PSM	YALYDATYETK	95	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2589	36.428	2	1404.7449	1404.7449	R	E	82	93
PSM	LAELPAPAQPSAEDSDTEDDSEAEQTER	96	sp|Q9BVR0|HRC23_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=2854	39.07946333333333	3	3082.2762	3080.2612	K	N	656	684
PSM	TEPVALEPRCAADAGMKR	97	sp|Q8N2K0-3|ABD12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:4,16-UNIMOD:35,17-UNIMOD:510	ms_run[1]:scan=3610	48.4051	2	2137.0522	2135.0532	R	A	5	23
PSM	ARSVDALDDLTPPSTAESGSR	98	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2872	39.296	3	2258.064	2258.0640	R	S	335	356
PSM	DLIHDQDEDEEEEEGQR	99	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1767	28.48	3	2118.9038	2118.9038	R	F	77	94
PSM	GEPNVSYICSR	100	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2081	31.244	2	1394.6114	1394.6114	R	Y	210	221
PSM	GISPIVFDR	101	sp|Q96MU7-2|YTDC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3445	46.135	2	1116.5793	1116.5793	R	S	306	315
PSM	NPDDITQEEYGEFYK	102	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3210	43.313	2	1914.916	1914.9160	R	S	292	307
PSM	TNQELQEINR	103	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1314	24.334	2	1277.6788	1277.6788	R	V	154	164