MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100625_012PCTAIRE_PCTK1.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100625_012PCTAIRE_PCTK1.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	46.0	null	228-UNIMOD:510,29-UNIMOD:510	0.15	46.0	7	2	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	198-UNIMOD:510,332-UNIMOD:510,342-UNIMOD:510,123-UNIMOD:510,133-UNIMOD:510	0.12	41.0	4	3	2
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	12-UNIMOD:510,27-UNIMOD:510	0.13	38.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	43-UNIMOD:510,57-UNIMOD:510,175-UNIMOD:510,185-UNIMOD:510,100-UNIMOD:510,105-UNIMOD:4	0.15	37.0	3	3	3
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	288-UNIMOD:510	0.03	37.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	221-UNIMOD:510,37-UNIMOD:510	0.06	37.0	2	2	2
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	134-UNIMOD:510,150-UNIMOD:510	0.06	37.0	2	1	0
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	194-UNIMOD:510,202-UNIMOD:4	0.04	37.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	228-UNIMOD:510,133-UNIMOD:510,142-UNIMOD:510	0.13	36.0	2	2	2
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	75-UNIMOD:510	0.13	36.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	431-UNIMOD:510,113-UNIMOD:510	0.07	36.0	2	2	2
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510,689-UNIMOD:510,693-UNIMOD:4,639-UNIMOD:510,697-UNIMOD:35	0.04	36.0	4	3	2
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	8-UNIMOD:510,23-UNIMOD:510,309-UNIMOD:510,310-UNIMOD:510,318-UNIMOD:510,234-UNIMOD:510,244-UNIMOD:510,320-UNIMOD:510,329-UNIMOD:510	0.15	35.0	4	4	4
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	292-UNIMOD:510,306-UNIMOD:510,613-UNIMOD:510,617-UNIMOD:35,620-UNIMOD:35,621-UNIMOD:35,623-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,551-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510,492-UNIMOD:510,276-UNIMOD:510,284-UNIMOD:510,187-UNIMOD:510	0.14	35.0	12	9	7
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	239-UNIMOD:510,360-UNIMOD:510,19-UNIMOD:510	0.11	35.0	4	3	2
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	198-UNIMOD:510,199-UNIMOD:4,212-UNIMOD:510	0.06	35.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	70-UNIMOD:510,38-UNIMOD:510	0.06	35.0	2	2	2
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	20-UNIMOD:510,333-UNIMOD:510	0.04	34.0	2	2	2
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	476-UNIMOD:510,152-UNIMOD:510,152-UNIMOD:4,162-UNIMOD:510,142-UNIMOD:510,149-UNIMOD:35,151-UNIMOD:510,368-UNIMOD:510	0.09	34.0	4	4	4
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	39-UNIMOD:510,40-UNIMOD:21	0.09	34.0	1	1	0
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	14-UNIMOD:510	0.06	34.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	82-UNIMOD:510,96-UNIMOD:510,61-UNIMOD:510,50-UNIMOD:510,563-UNIMOD:510,573-UNIMOD:510,102-UNIMOD:510,113-UNIMOD:510	0.10	34.0	5	5	5
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	387-UNIMOD:510,300-UNIMOD:510,314-UNIMOD:510,251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510,465-UNIMOD:510,478-UNIMOD:510,621-UNIMOD:510,631-UNIMOD:510,500-UNIMOD:510,490-UNIMOD:510,499-UNIMOD:510,628-UNIMOD:35	0.15	34.0	10	8	6
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	null	39-UNIMOD:510,41-UNIMOD:21	0.06	34.0	1	1	0
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	299-UNIMOD:510,302-UNIMOD:510,314-UNIMOD:21,323-UNIMOD:510	0.04	33.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	28-UNIMOD:510,104-UNIMOD:510,115-UNIMOD:510,128-UNIMOD:510,134-UNIMOD:4,139-UNIMOD:510	0.17	33.0	3	3	3
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	435-UNIMOD:510,44-UNIMOD:510,253-UNIMOD:510,265-UNIMOD:510,672-UNIMOD:510,682-UNIMOD:510,76-UNIMOD:510,169-UNIMOD:510,177-UNIMOD:510	0.11	33.0	6	6	6
PRT	sp|Q9UJ70|NAGK_HUMAN	N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	70-UNIMOD:510,76-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	153-UNIMOD:510,167-UNIMOD:510	0.08	32.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	17-UNIMOD:510,17-UNIMOD:4,31-UNIMOD:510	0.12	32.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	76-UNIMOD:510,86-UNIMOD:35	0.11	32.0	3	1	0
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	9-UNIMOD:510,21-UNIMOD:510,75-UNIMOD:510,76-UNIMOD:510	0.31	32.0	2	2	2
PRT	sp|P06744-2|G6PI_HUMAN	Isoform 2 of Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	223-UNIMOD:510,237-UNIMOD:510,146-UNIMOD:510,155-UNIMOD:510,97-UNIMOD:510,104-UNIMOD:35	0.07	32.0	4	3	2
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	97-UNIMOD:510	0.06	31.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510	0.06	31.0	3	2	1
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	138-UNIMOD:510,150-UNIMOD:510,232-UNIMOD:510,97-UNIMOD:510,104-UNIMOD:4,106-UNIMOD:510	0.13	31.0	3	3	3
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	1001-UNIMOD:510,1014-UNIMOD:510	0.01	31.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	31.0	2	1	0
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	28-UNIMOD:510	0.06	30.0	1	1	1
PRT	sp|Q99873-2|ANM1_HUMAN	Isoform 2 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	333-UNIMOD:510,336-UNIMOD:4,340-UNIMOD:4,172-UNIMOD:510	0.07	30.0	2	2	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	28-UNIMOD:510,223-UNIMOD:510	0.16	30.0	2	2	2
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	79-UNIMOD:510	0.07	30.0	1	1	1
PRT	sp|Q99832-3|TCPH_HUMAN	Isoform 3 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	301-UNIMOD:510,301-UNIMOD:4,332-UNIMOD:510	0.05	29.0	2	2	2
PRT	sp|Q9BQA1-2|MEP50_HUMAN	Isoform 2 of Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	116-UNIMOD:510,122-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	44-UNIMOD:510,8-UNIMOD:510	0.17	29.0	2	2	2
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	349-UNIMOD:510,362-UNIMOD:510,578-UNIMOD:510,589-UNIMOD:510,458-UNIMOD:510,467-UNIMOD:510,334-UNIMOD:510	0.07	29.0	4	4	4
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	379-UNIMOD:510,271-UNIMOD:510,281-UNIMOD:510,172-UNIMOD:510,181-UNIMOD:510	0.07	29.0	3	3	3
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	120-UNIMOD:510,123-UNIMOD:21,145-UNIMOD:510,60-UNIMOD:510,219-UNIMOD:510,223-UNIMOD:4,229-UNIMOD:510	0.20	29.0	4	3	2
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	34-UNIMOD:510,46-UNIMOD:510,465-UNIMOD:510,470-UNIMOD:4	0.03	29.0	2	2	2
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	232-UNIMOD:510,245-UNIMOD:510	0.06	29.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	204-UNIMOD:510,222-UNIMOD:510,213-UNIMOD:35,223-UNIMOD:510,85-UNIMOD:510,96-UNIMOD:510	0.19	28.0	5	3	2
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	92-UNIMOD:510,107-UNIMOD:510,330-UNIMOD:510,301-UNIMOD:510,311-UNIMOD:510,306-UNIMOD:35	0.09	28.0	4	3	2
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	28.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	29-UNIMOD:510,42-UNIMOD:510,61-UNIMOD:510	0.07	28.0	2	2	2
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510,82-UNIMOD:510,92-UNIMOD:510	0.15	28.0	3	2	1
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	227-UNIMOD:510,237-UNIMOD:510	0.04	28.0	1	1	1
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	114-UNIMOD:510,127-UNIMOD:510	0.07	28.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	85-UNIMOD:510,91-UNIMOD:4,97-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	282-UNIMOD:510	0.02	27.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	589-UNIMOD:510,599-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|P14324-2|FPPS_HUMAN	Isoform 2 of Farnesyl pyrophosphate synthase OS=Homo sapiens OX=9606 GN=FDPS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	47-UNIMOD:510,57-UNIMOD:510	0.03	27.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	186-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	114-UNIMOD:510,124-UNIMOD:510	0.07	27.0	1	1	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	182-UNIMOD:510,192-UNIMOD:510,204-UNIMOD:510,210-UNIMOD:35,215-UNIMOD:35	0.12	27.0	2	2	2
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	112-UNIMOD:510	0.08	27.0	1	1	1
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	370-UNIMOD:510,380-UNIMOD:510,311-UNIMOD:510,320-UNIMOD:510	0.05	26.0	2	2	2
PRT	sp|Q13642-3|FHL1_HUMAN	Isoform 3 of Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	107-UNIMOD:510,118-UNIMOD:510	0.07	26.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	665-UNIMOD:510,671-UNIMOD:4,677-UNIMOD:510,684-UNIMOD:510	0.03	26.0	2	2	2
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	38-UNIMOD:510,38-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	187-UNIMOD:510,194-UNIMOD:4,618-UNIMOD:510,631-UNIMOD:510,830-UNIMOD:510,4-UNIMOD:510	0.06	26.0	4	4	4
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	483-UNIMOD:510,494-UNIMOD:510,496-UNIMOD:510,434-UNIMOD:510,367-UNIMOD:510,379-UNIMOD:510,105-UNIMOD:510,62-UNIMOD:510	0.15	26.0	5	5	5
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	52-UNIMOD:510	0.19	26.0	1	1	1
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	62-UNIMOD:510,73-UNIMOD:510	0.02	26.0	1	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	12-UNIMOD:510,30-UNIMOD:510	0.06	26.0	1	1	1
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	16-UNIMOD:510,35-UNIMOD:21,47-UNIMOD:4,48-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	7-UNIMOD:510	0.04	26.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	129-UNIMOD:510	0.09	26.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	140-UNIMOD:510,152-UNIMOD:510	0.09	26.0	1	1	1
PRT	sp|Q9NQP4|PFD4_HUMAN	Prefoldin subunit 4 OS=Homo sapiens OX=9606 GN=PFDN4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	93-UNIMOD:510	0.10	26.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	240-UNIMOD:510,250-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	207-UNIMOD:510	0.14	26.0	1	1	1
PRT	sp|Q7L1Q6-2|BZW1_HUMAN	Isoform 2 of Basic leucine zipper and W2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BZW1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	303-UNIMOD:510,313-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	78-UNIMOD:510,88-UNIMOD:510	0.05	25.0	2	1	0
PRT	sp|P22492|H1T_HUMAN	Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	69-UNIMOD:510,79-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	74-UNIMOD:510,76-UNIMOD:35,82-UNIMOD:35,95-UNIMOD:510,101-UNIMOD:4	0.23	25.0	4	2	1
PRT	sp|P27635|RL10_HUMAN	60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	176-UNIMOD:510,188-UNIMOD:510	0.07	25.0	1	1	1
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	77-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	25.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	310-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	172-UNIMOD:510,177-UNIMOD:4	0.07	25.0	1	1	1
PRT	sp|Q9UKK9|NUDT5_HUMAN	ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	15-UNIMOD:510,27-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|O75223|GGCT_HUMAN	Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	89-UNIMOD:510,101-UNIMOD:510	0.07	25.0	1	1	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	4-UNIMOD:510,14-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	60-UNIMOD:510	0.27	25.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	59-UNIMOD:510,69-UNIMOD:510,237-UNIMOD:510	0.05	25.0	2	2	2
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	250-UNIMOD:510,262-UNIMOD:510,236-UNIMOD:510,246-UNIMOD:510	0.07	25.0	2	2	2
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	158-UNIMOD:510,167-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	64-UNIMOD:510,74-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P31327-3|CPSM_HUMAN	Isoform 3 of Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	863-UNIMOD:510,875-UNIMOD:510,899-UNIMOD:510,911-UNIMOD:510,926-UNIMOD:510,926-UNIMOD:4	0.03	24.0	3	3	3
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	96-UNIMOD:510	0.09	24.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	82-UNIMOD:510	0.09	24.0	1	1	1
PRT	sp|P32754-2|HPPD_HUMAN	Isoform 2 of 4-hydroxyphenylpyruvate dioxygenase OS=Homo sapiens OX=9606 GN=HPD	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	273-UNIMOD:510,282-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	208-UNIMOD:510,220-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:510	0.13	24.0	1	1	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	99-UNIMOD:510	0.04	24.0	1	1	1
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	56-UNIMOD:510,14-UNIMOD:510	0.11	24.0	2	2	2
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	168-UNIMOD:510,175-UNIMOD:35	0.02	24.0	2	1	0
PRT	sp|O43390-4|HNRPR_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	33-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	746-UNIMOD:510	0.01	24.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	2781-UNIMOD:510,2792-UNIMOD:510	0.01	24.0	1	1	1
PRT	sp|Q92598-2|HS105_HUMAN	Isoform Beta of Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	361-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|Q9H3K6-2|BOLA2_HUMAN	Isoform 2 of BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	15-UNIMOD:510	0.29	23.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	187-UNIMOD:510,197-UNIMOD:510	0.02	23.0	2	1	0
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	115-UNIMOD:510	0.09	23.0	2	1	0
PRT	sp|Q9Y230|RUVB2_HUMAN	RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	30-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	591-UNIMOD:510,599-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	422-UNIMOD:510,426-UNIMOD:4,432-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	120-UNIMOD:510,131-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	60-UNIMOD:510,70-UNIMOD:510,85-UNIMOD:510,94-UNIMOD:510,190-UNIMOD:510,202-UNIMOD:510	0.12	23.0	3	3	3
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	86-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P27105-2|STOM_HUMAN	Isoform 2 of Stomatin OS=Homo sapiens OX=9606 GN=STOM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	56-UNIMOD:510,63-UNIMOD:35	0.11	23.0	1	1	1
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	43-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	635-UNIMOD:510,635-UNIMOD:4,647-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	1350-UNIMOD:510	0.00	22.0	1	1	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	49-UNIMOD:510,58-UNIMOD:510	0.07	22.0	1	1	1
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	211-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	20-UNIMOD:510,30-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	78-UNIMOD:510,87-UNIMOD:35,88-UNIMOD:510,166-UNIMOD:510	0.05	22.0	2	2	2
PRT	sp|P30613-2|KPYR_HUMAN	Isoform L-type of Pyruvate kinase PKLR OS=Homo sapiens OX=9606 GN=PKLR	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	307-UNIMOD:510,317-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	132-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	192-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	44-UNIMOD:510	0.12	22.0	1	1	1
PRT	sp|P28072|PSB6_HUMAN	Proteasome subunit beta type-6 OS=Homo sapiens OX=9606 GN=PSMB6 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	210-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	402-UNIMOD:510,254-UNIMOD:510,266-UNIMOD:4,275-UNIMOD:510	0.08	22.0	2	2	2
PRT	sp|Q00536|CDK16_HUMAN	Cyclin-dependent kinase 16 OS=Homo sapiens OX=9606 GN=CDK16 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	415-UNIMOD:510,417-UNIMOD:21,425-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	177-UNIMOD:510,188-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	143-UNIMOD:510,152-UNIMOD:510,13-UNIMOD:510,23-UNIMOD:510,61-UNIMOD:510,71-UNIMOD:510	0.16	22.0	3	3	3
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	133-UNIMOD:510,142-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	211-UNIMOD:510,222-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	185-UNIMOD:510,193-UNIMOD:510,129-UNIMOD:510,139-UNIMOD:510	0.11	21.0	2	2	2
PRT	sp|Q9HB07|MYG1_HUMAN	MYG1 exonuclease OS=Homo sapiens OX=9606 GN=MYG1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	244-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1073-UNIMOD:510,928-UNIMOD:510,469-UNIMOD:510	0.01	21.0	3	3	3
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	225-UNIMOD:510,236-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	173-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q09028-3|RBBP4_HUMAN	Isoform 3 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	5-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	130-UNIMOD:510,142-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	126-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|O60506-4|HNRPQ_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	257-UNIMOD:510,265-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|P61081|UBC12_HUMAN	NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	170-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	16-UNIMOD:510,28-UNIMOD:510,270-UNIMOD:510,281-UNIMOD:510	0.06	21.0	2	2	2
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	56-UNIMOD:510,65-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	237-UNIMOD:510,246-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	99-UNIMOD:510,105-UNIMOD:4,111-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q15366-7|PCBP2_HUMAN	Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	47-UNIMOD:510,54-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	376-UNIMOD:510,385-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	197-UNIMOD:510,208-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	80-UNIMOD:510,82-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	97-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	63-UNIMOD:510,97-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P99999|CYC_HUMAN	Cytochrome c OS=Homo sapiens OX=9606 GN=CYCS PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	41-UNIMOD:510,54-UNIMOD:510	0.14	21.0	1	1	1
PRT	sp|Q16719|KYNU_HUMAN	Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	85-UNIMOD:510,93-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	503-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|Q12931|TRAP1_HUMAN	Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	115-UNIMOD:510,126-UNIMOD:510	0.02	21.0	1	1	0
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	28-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P00505-2|AATM_HUMAN	Isoform 2 of Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	128-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	44-UNIMOD:510,52-UNIMOD:510	0.07	20.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	125-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	82-UNIMOD:510,103-UNIMOD:510	0.17	20.0	1	1	1
PRT	sp|Q99584|S10AD_HUMAN	Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	31-UNIMOD:510,39-UNIMOD:510	0.10	20.0	1	1	1
PRT	sp|Q53EL6-2|PDCD4_HUMAN	Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	326-UNIMOD:510,339-UNIMOD:4,341-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	106-UNIMOD:510,109-UNIMOD:4,115-UNIMOD:510,128-UNIMOD:510	0.16	20.0	2	2	2
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	58-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	152-UNIMOD:510,159-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|P40227|TCPZ_HUMAN	T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	105-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	518-UNIMOD:510,529-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q06323-3|PSME1_HUMAN	Isoform 3 of Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	199-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	87-UNIMOD:510,95-UNIMOD:35,96-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	324-UNIMOD:510,334-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	111-UNIMOD:510,120-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	40-UNIMOD:510,50-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	412-UNIMOD:510,420-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	9-UNIMOD:510	0.10	20.0	1	1	1
PRT	sp|P11279|LAMP1_HUMAN	Lysosome-associated membrane glycoprotein 1 OS=Homo sapiens OX=9606 GN=LAMP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	138-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	85-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	143-UNIMOD:510,153-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|P62910|RL32_HUMAN	60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	94-UNIMOD:510,96-UNIMOD:4,106-UNIMOD:510	0.10	20.0	1	1	1
PRT	sp|P51157|RAB28_HUMAN	Ras-related protein Rab-28 OS=Homo sapiens OX=9606 GN=RAB28 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	15-UNIMOD:510,25-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q9HAW4|CLSPN_HUMAN	Claspin OS=Homo sapiens OX=9606 GN=CLSPN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	102-UNIMOD:510,104-UNIMOD:21,113-UNIMOD:21,114-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	171-UNIMOD:510	0.01	20.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:510	ms_run[1]:scan=5321	49.24784	2	2226.9329	2226.9356	R	-	228	248
PSM	AEDGSVIDYELIDQDAR	2	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510	ms_run[2]:scan=4915	45.784	2	1941.938	1941.9380	R	D	198	215
PSM	TITLEVEPSDTIENVK	3	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=4602	43.334	2	1855.0463	1855.0463	K	A	12	28
PSM	DLADELALVDVIEDK	4	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6736	68.177	2	1724.972	1724.9720	K	L	43	58
PSM	ELSLAGNELGDEGAR	5	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=3687	36.719	2	1563.7953	1563.7953	K	L	288	303
PSM	STAGDTHLGGEDFDNR	6	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=1917	24.511	2	1724.7814	1724.7814	K	M	221	237
PSM	SVGDGETVEFDVVEGEK	7	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,17-UNIMOD:510	ms_run[2]:scan=4375	41.642	2	1862.9422	1862.9422	R	G	134	151
PSM	TDDYLDQPCYETINR	8	sp|P50395|GDIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=3811	37.604	2	1935.8733	1935.8733	R	I	194	209
PSM	DNLTLWTSDQQDDDGGEGNN	9	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:510	ms_run[1]:scan=5434	50.25624333333334	2	2226.933451	2226.936145	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	10	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=5632	52.263	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDQQDEEAGEGN	11	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=5266	48.794	2	2154.9402	2154.9402	R	-	228	247
PSM	DWEDDSDEDMSNFDR	12	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=4474	42.391	2	1908.7168	1908.7168	K	F	75	90
PSM	DYEEVGADSADGEDEGEEY	13	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=3903	38.248	2	2111.8027	2111.8027	K	-	431	450
PSM	ETVSEESNVLCLSK	14	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3645	36.424	2	1661.8818	1661.8818	R	S	581	595
PSM	SVGDGETVEFDVVEGEK	15	sp|P16989-2|YBOX3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,17-UNIMOD:510	ms_run[2]:scan=4389	41.757	2	1862.9422	1862.9422	R	G	134	151
PSM	TPEELDDSDFETEDFDVR	16	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=5413	50.03	2	2271.9157	2271.9157	R	S	264	282
PSM	LIAPVAEEEATVPNNK	17	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=3233	33.537	2	1762.0149	1762.0149	K	I	8	24
PSM	NPDDITQEEYGEFYK	18	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=4297	41.051	2	1914.916	1914.9160	R	S	292	307
PSM	SYELPDGQVITIGNER	19	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=5241	48.594	2	1823.9478	1823.9478	K	F	239	255
PSM	TCTTVAFTQVNSEDK	20	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,2-UNIMOD:4,15-UNIMOD:510	ms_run[2]:scan=2729	30.045	2	1767.8985	1767.8985	K	G	198	213
PSM	TDYNASVSVPDSSGPER	21	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=2639	29.426	2	1813.8543	1813.8543	R	I	70	87
PSM	DNLTLWTSDQQDDDGGEGNN	22	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:510	ms_run[1]:scan=5196	48.238515	2	2226.9347	2226.9356	R	-	228	248
PSM	AGGIETIANEYSDR	23	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=3659	36.523	2	1528.7582	1528.7582	R	C	20	34
PSM	DPVQEAWAEDVDLR	24	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=5360	49.607	2	1675.8266	1675.8266	K	V	476	490
PSM	DSSTSPGDYVLSVSENSR	25	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4984	46.386	2	2012.8788	2012.8788	R	V	39	57
PSM	IQALQQQADEAEDR	26	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=2148	26.077	2	1647.8276	1647.8276	K	A	14	28
PSM	NQLTSNPENTVFDAK	27	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3388	34.617	2	1744.9268	1744.9268	K	R	82	97
PSM	SYELPDGQVITIGNER	28	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4777	44.678	2	1823.9478	1823.9478	K	F	239	255
PSM	GVVDSEDLPLNISR	29	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510	ms_run[1]:scan=4546	42.93306333333333	2	1546.8418	1546.8410	R	E	387	401
PSM	DSSTSPGDYVLSVSENSR	30	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=4984	46.38563166666667	2	2012.8783	2012.8783	R	V	39	57
PSM	ALFKPPEDSQDDESDSDAEEEQTTK	31	sp|Q13769|THOC5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,4-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3130	32.813	3	2992.3447	2992.3447	K	R	299	324
PSM	AVTEQGAELSNEER	32	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=1575	22.195	2	1565.7745	1565.7745	K	N	28	42
PSM	GVVDSDDLPLNVSR	33	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4087	39.55	2	1518.8102	1518.8102	K	E	435	449
PSM	NPDDITNEEYGEFYK	34	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=4211	40.433	2	1900.9003	1900.9003	R	S	300	315
PSM	SLGLSLSGGDQEDAGR	35	sp|Q9UJ70|NAGK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4230	40.567	2	1674.7674	1674.7674	R	I	70	86
PSM	AEEYEFLTPVEEAPK	36	sp|P52565|GDIR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=4835	45.13	2	1818.9564	1818.9564	R	G	153	168
PSM	CTGGEVGATSALAPK	37	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,1-UNIMOD:4,15-UNIMOD:510	ms_run[2]:scan=2031	25.281	2	1485.8134	1485.8134	R	I	17	32
PSM	DSLLQDGEFSMDLR	38	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=5008	46.578	2	1674.7983	1674.7983	R	T	76	90
PSM	TAFQEALDAAGDK	39	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3588	36.023	2	1403.7569	1403.7569	K	L	9	22
PSM	TFTTQETITNAETAK	40	sp|P06744-2|G6PI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=2875	31.051	2	1722.9312	1722.9312	K	E	223	238
PSM	EALTYDGALLGDR	41	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=4238	40.626	2	1426.7516	1426.7516	K	S	97	110
PSM	EVDEQMLNVQNK	42	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1868	24.185	2	1529.8032	1529.8032	K	N	325	337
PSM	HVFGESDELIGQK	43	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2934	31.459	2	1525.8413	1525.8413	R	V	138	151
PSM	IAEFTTNLTEEEEK	44	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=3741	37.102	2	1720.9043	1720.9043	R	S	1001	1015
PSM	KEESEESDDDMGFGLFD	45	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4910	45.746	2	2032.8732	2032.8732	K	-	73	90
PSM	GVVDSEDLPLNISR	46	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:510	ms_run[1]:scan=4522	42.755845	2	1546.842295	1546.841504	R	E	387	401
PSM	EDIYAVEIVGGATR	47	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=4783	44.724	2	1525.82	1525.8200	K	I	333	347
PSM	ELAEDGYSGVEVR	48	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=2897	31.205	2	1456.7258	1456.7258	R	V	28	41
PSM	GQLCELSCSTDYR	49	sp|Q99873-2|ANM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,4-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=2824	30.696	2	1621.7289	1621.7289	K	M	333	346
PSM	SVTEQGAELSNEER	50	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=1706	23.083	2	1581.7695	1581.7695	K	N	28	42
PSM	TAVVVGTITDDVR	51	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=3657	36.509	2	1378.788	1378.7880	K	V	79	92
PSM	CQVFEETQIGGER	52	sp|Q99832-3|TCPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=3081	32.466	2	1585.7619	1585.7619	R	Y	301	314
PSM	DSLLQDGEFSMDLR	53	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=5744	53.623	2	1658.8034	1658.8034	R	T	76	90
PSM	DSVFLSCSEDNR	54	sp|Q9BQA1-2|MEP50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=3086	32.502	2	1461.6618	1461.6618	K	I	116	128
PSM	ELAPYDENWFYTR	55	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=5480	50.747	2	1736.8259	1736.8259	K	A	44	57
PSM	EVDEQMLNVQNK	56	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2964	31.667	2	1513.8083	1513.8083	K	N	325	337
PSM	FGYVDFESAEDLEK	57	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=5457	50.535	2	1715.8567	1715.8567	K	A	349	363
PSM	GSTDNLMDDIER	58	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=3933	38.458	2	1398.6509	1398.6509	R	A	379	391
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	59	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4562	43.048	3	3090.3451	3090.3451	K	E	120	146
PSM	QPLLLSEDEEDTK	60	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3219	33.44	2	1583.8567	1583.8567	K	R	34	47
PSM	SSGPYGGGGQYFAK	61	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=2518	28.595	2	1442.7467	1442.7467	R	P	232	246
PSM	ESEDKPEIEDVGSDEEEEK	62	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[1]:scan=2245	26.735355	3	2294.1044	2294.1017	K	K	251	270
PSM	DNLTLWTSDQQDDDGGEGNN	63	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510	ms_run[1]:scan=5317	49.21706666666667	3	2226.9370	2226.9356	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	64	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=5096	47.274	3	2248.059	2248.0590	R	E	204	223
PSM	EALLSSAVDHGSDEVK	65	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2957	31.62	3	1723.9265	1723.9265	R	F	92	108
PSM	ESLKEEDESDDDNM	66	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=1083	18.759	2	1738.7364	1738.7364	K	-	235	249
PSM	GILAADESTGSIAK	67	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=2680	29.713	2	1399.8195	1399.8195	K	R	29	43
PSM	HELQANCYEEVK	68	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1642	22.646	2	1586.8035	1586.8035	K	D	133	145
PSM	HQEGEIFDTEK	69	sp|Q02878|RL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1843	24.018	2	1399.7256	1399.7256	R	E	227	238
PSM	SPASDTYIVFGEAK	70	sp|Q13765|NACA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=4291	41.007	2	1551.8457	1551.8457	K	I	114	128
PSM	TDDEVVQREEEAIQLDGLNASQIR	71	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=5312	49.165	3	2761.3942	2761.3942	R	E	44	68
PSM	EEASDYLELDTIK	72	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[1]:scan=4769	44.620470000000005	2	1592.8464	1592.8452	K	N	253	266
PSM	DINAYNCEEPTEK	73	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2318	27.227	2	1649.7879	1649.7879	K	L	85	98
PSM	DNLTLWTSDTQGDEAEAGEGGEN	74	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=5367	49.658	3	2442.0519	2442.0519	R	-	223	246
PSM	ELISNSSDALDK	75	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2472	28.28	2	1358.7566	1358.7566	R	I	47	59
PSM	ELVVTQLGYDTR	76	sp|Q01813-2|PFKAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4128	39.842	2	1426.788	1426.7880	K	V	282	294
PSM	ESEDFIVEQYK	77	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3770	37.308	2	1453.7613	1453.7613	K	H	589	600
PSM	EVLEYNAIGGK	78	sp|P14324-2|FPPS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3060	32.319	2	1259.7398	1259.7398	K	Y	47	58
PSM	GDRSEDFGVNEDLADSDAR	79	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=3186	33.209	3	2100.9408	2100.9408	K	A	186	205
PSM	GYTLVEYETYK	80	sp|Q9Y5S9-2|RBM8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3947	38.557	2	1432.7762	1432.7762	K	E	114	125
PSM	ITPSYVAFTPEGER	81	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4045	39.249	2	1599.8357	1599.8357	R	L	61	75
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	82	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,26-UNIMOD:510	ms_run[2]:scan=4145	39.962	3	3010.3787	3010.3787	K	E	120	146
PSM	NFSDNQLQEGK	83	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1926	24.574	2	1346.7103	1346.7103	R	N	182	193
PSM	NGESSELDLQGIR	84	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=3321	34.152	2	1450.7476	1450.7476	R	I	112	125
PSM	SLYYYIQQDTK	85	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=4216	40.469	2	1488.8137	1488.8137	K	G	332	343
PSM	YLIANATNPESK	86	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2430	27.991	2	1387.7984	1387.7984	K	V	104	116
PSM	YYTSASGDEMVSLK	87	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=3293	33.96	2	1617.8233	1617.8233	R	D	465	479
PSM	VEIIANDQGNR	88	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510	ms_run[1]:scan=1750	23.383155	2	1261.6833	1261.6834	R	I	50	61
PSM	ADVLSEEAILK	89	sp|Q9Y6E2|BZW2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=4268	40.844	2	1254.7708	1254.7708	K	W	370	381
PSM	AIVAGDQNVEYK	90	sp|Q13642-3|FHL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2146	26.063	2	1373.7827	1373.7827	K	G	107	119
PSM	AVYTQDCPLAAAK	91	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2589	29.081	2	1474.8126	1474.8126	K	A	665	678
PSM	CEGINISGNFYR	92	sp|P40429|RL13A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=3992	38.873	2	1462.7087	1462.7087	R	N	38	50
PSM	DNLTLWTSDMQGDGEEQNK	93	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=4436	42.112	3	2264.0539	2264.0539	R	E	204	223
PSM	DNPGVVTCLDEAR	94	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:4	ms_run[2]:scan=3275	33.833	2	1478.7248	1478.7248	K	H	187	200
PSM	DVIELTDDSFDK	95	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=4983	46.379	2	1463.7668	1463.7668	K	N	158	170
PSM	EATNPPVIQEEKPK	96	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=1496	21.646	3	1681.0147	1681.0147	R	K	483	497
PSM	EGDVLTLLESER	97	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=5573	51.637	2	1393.7513	1393.7513	R	E	52	64
PSM	ELISNASDALEK	98	sp|Q12931-2|TRAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3124	32.771	2	1356.7773	1356.7773	R	L	62	74
PSM	GATQQILDEAER	99	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=2721	29.989	2	1363.7156	1363.7156	R	S	330	342
PSM	GEAAAERPGEAAVASSPSK	100	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=1163	19.334	3	1851.9963	1851.9963	K	A	12	31
PSM	GEENLMDAQVK	101	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2433	28.011	2	1300.6969	1300.6969	K	A	271	282
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	102	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,20-UNIMOD:21,32-UNIMOD:4,33-UNIMOD:510	ms_run[2]:scan=4362	41.549	3	3881.5895	3881.5895	R	G	16	49
PSM	GTVTDFPGFDER	103	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4196	40.327	2	1373.6676	1373.6676	R	A	7	19
PSM	IEDVTPIPSDSTR	104	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=2745	30.159	2	1462.7728	1462.7728	R	R	129	142
PSM	LAPDYDALDVANK	105	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4011	39.007	2	1471.8195	1471.8195	R	I	140	153
PSM	NLQEEIDALESR	106	sp|Q9NQP4|PFD4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=5165	47.986	2	1449.7524	1449.7524	K	V	93	105
PSM	NVTELNEPLSNEER	107	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=2943	31.521	2	1676.843	1676.8430	K	N	29	43
PSM	QEYDESGPSIVHR	108	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1798	23.716	2	1549.7585	1549.7585	K	K	360	373
PSM	TGLYNYYDDEK	109	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3226	33.489	2	1447.7144	1447.7144	R	E	240	251
PSM	TTPSYVAFTDTER	110	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=3577	35.942	2	1520.7571	1520.7571	R	L	37	50
PSM	YALYDATYETK	111	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3366	34.465	2	1404.7449	1404.7449	R	E	82	93
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	112	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510	ms_run[1]:scan=5213	48.364311666666666	3	3490.5012	3490.5049	R	-	207	238
PSM	AEVLSEEPILK	113	sp|Q7L1Q6-2|BZW1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3638	36.375	2	1294.8021	1294.8021	K	W	303	314
PSM	AGNFYVPAEPK	114	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2979	31.764	2	1259.7187	1259.7187	K	L	78	89
PSM	ALAAAGYDVEK	115	sp|P22492|H1T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2289	27.037	2	1174.687	1174.6870	K	N	69	80
PSM	AVFDETYPDPVR	116	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3844	37.833	2	1441.7302	1441.7302	R	V	684	696
PSM	DNLTLWTSDMQGDGEEQNK	117	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=4304	41.099	3	2264.0539	2264.0539	R	E	204	223
PSM	DNSTMGYMAAK	118	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2301	27.114	2	1255.6213	1255.6213	R	K	621	632
PSM	DNSTMGYMMAK	119	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=856	16.668	2	1363.6094	1363.6094	R	K	613	624
PSM	EGLELPEDEEEK	120	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3146	32.928	2	1483.7566	1483.7566	K	K	539	551
PSM	EGMNIVEAMER	121	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=1426	21.167	2	1343.6274	1343.6274	K	F	74	85
PSM	ELISNASDALDK	122	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3054	32.279	2	1342.7616	1342.7616	R	I	42	54
PSM	FNADEFEDMVAEK	123	sp|P27635|RL10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=5407	49.972	2	1611.7763	1611.7763	K	R	176	189
PSM	GASQAGMTGYGMPR	124	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=926	17.467	2	1448.6601	1448.6601	R	Q	204	218
PSM	GLVYETSVLDPDEGIR	125	sp|O75390|CISY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=4916	45.791	2	1795.9416	1795.9416	K	F	77	93
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	126	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=5501	50.932	3	2995.386	2995.3860	R	G	2913	2938
PSM	KEESEESDDDMGFGLFD	127	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=5678	52.772	2	2016.8783	2016.8783	K	-	73	90
PSM	LISWYDNEFGYSNR	128	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=5290	49	2	1796.8582	1796.8582	K	V	310	324
PSM	LKDDEVAQLK	129	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=1831	23.937	2	1259.8186	1259.8186	K	K	309	319
PSM	LTWHSCPEDEAQ	130	sp|Q13185|CBX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=2651	29.511	2	1505.6669	1505.6669	R	-	172	184
PSM	MDATANDVPSPYEVR	131	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3368	34.476	2	1697.8143	1697.8143	K	G	434	449
PSM	QPAENVNQYLTDPK	132	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=3120	32.741	2	1683.9104	1683.9104	K	F	618	632
PSM	QYIISEELISEGK	133	sp|Q9UKK9|NUDT5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4875	45.475	2	1575.9032	1575.9032	K	W	15	28
PSM	SNLNSLDEQEGVK	134	sp|O75223|GGCT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2107	25.797	2	1499.8104	1499.8104	K	S	89	102
PSM	SYNDELQFLEK	135	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=4837	45.145	2	1452.7773	1452.7773	R	I	4	15
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	136	sp|Q9BXV9|GON7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3055	32.284	3	2865.1757	2865.1757	R	T	60	86
PSM	VTADVINAAEK	137	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2342	27.389	2	1197.7241	1197.7241	K	L	59	70
PSM	YDYNSGEELESYK	138	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3301	34.018	2	1663.789	1663.7890	K	G	250	263
PSM	AGDLLEDSPK	139	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2188	26.354	2	1111.6397	1111.6397	R	R	158	168
PSM	AGQAVDDFIEK	140	sp|P52209-2|6PGD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3141	32.892	2	1259.7034	1259.7034	K	L	64	75
PSM	AIDDNMSLDEIEK	141	sp|P31327-3|CPSM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4174	40.171	2	1559.8025	1559.8025	K	L	863	876
PSM	ATLYVTAIEDR	142	sp|Q99873-2|ANM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=3753	37.187	2	1284.7138	1284.7138	R	Q	172	183
PSM	CDENILWLDYK	143	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=5464	50.6	2	1535.7966	1535.7967	K	N	152	163
PSM	DGNGYISAAELR	144	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=3499	35.393	2	1298.6679	1298.6679	K	H	96	108
PSM	DNLTLWTSDQQDDDGGEGNN	145	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=5583	51.741	3	2226.9361	2226.9361	R	-	228	248
PSM	DQGTYEDYVEGLR	146	sp|P60660-2|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=4678	43.912	2	1577.7422	1577.7422	K	V	82	95
PSM	DQVANSAFVER	147	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2287	27.026	2	1268.6573	1268.6573	K	L	500	511
PSM	EALQDVEDENQ	148	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2436	28.032	2	1322.605	1322.6050	K	-	223	234
PSM	EFLVAGGEDFK	149	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=4218	40.484	2	1278.7132	1278.7132	K	L	236	247
PSM	EGALCEENMR	150	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:4	ms_run[2]:scan=1521	21.82	2	1241.5593	1241.5593	K	G	689	699
PSM	EGMNIVEAMER	151	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:35	ms_run[2]:scan=3243	33.61	2	1327.6324	1327.6324	K	F	74	85
PSM	ENIDALEELK	152	sp|P32754-2|HPPD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=4137	39.904	2	1240.7187	1240.7187	K	I	273	283
PSM	EVSFQSTGESEWK	153	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3485	35.295	2	1580.7995	1580.7995	R	D	208	221
PSM	GGAEQFMEETER	154	sp|Q99832-3|TCPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2921	31.369	2	1416.6404	1416.6404	R	S	332	344
PSM	GLNSESMTEETLK	155	sp|P31327-3|CPSM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2802	30.549	2	1505.792	1505.7920	K	R	899	912
PSM	GVQVETISPGDGR	156	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2182	26.311	2	1347.7207	1347.7207	M	T	2	15
PSM	HTGPNSPDTANDGFVR	157	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1515	21.777	3	1717.8232	1717.8232	K	L	99	115
PSM	IASLEVENQSLR	158	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=3102	32.615	2	1391.7833	1391.7833	R	G	60	72
PSM	IQLVEEELDR	159	sp|P06753-4|TPM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=3829	37.731	2	1276.7087	1276.7087	R	A	56	66
PSM	LQIQCVVEDDK	160	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=3554	35.776	2	1413.781	1413.7810	K	V	219	230
PSM	QENCGAQQVPAGPGTSTPPSSPVR	161	sp|Q96G46-2|DUS3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=2617	29.27	3	2535.1637	2535.1637	R	T	257	281
PSM	QVVESAYEVIK	162	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3307	34.06	2	1331.7973	1331.7973	K	L	175	186
PSM	SLEDQVEMLR	163	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=4140	39.926	2	1252.6546	1252.6546	K	T	168	178
PSM	SNTPILVDGK	164	sp|P06744-2|G6PI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2049	25.402	2	1110.6921	1110.6921	R	D	146	156
PSM	SNVSDAVAQSTR	165	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1505	21.706	2	1267.6581	1267.6581	K	I	232	244
PSM	TGYTLDVTTGQR	166	sp|O43390-4|HNRPR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2864	30.973	2	1344.7098	1344.7098	R	K	33	45
PSM	TINEVENQILTR	167	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=3568	35.876	2	1462.8204	1462.8204	R	D	746	758
PSM	GLSEDTTEETLK	168	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=2158	26.144096666666666	2	1390.7532	1389.7502	K	E	578	590
PSM	GEGPDVDVNLPK	169	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=3133	32.83457666666666	2	1306.7272	1306.7402	K	A	2781	2793
PSM	AGFAGDDAPR	170	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1301	20.312	2	1009.5041	1009.5041	K	A	19	29
PSM	DEAQVCAIIER	171	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=3899	38.219	2	1336.6869	1336.6869	K	V	465	476
PSM	DISTTLNADEAVAR	172	sp|Q92598-2|HS105_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=3772	37.323	2	1508.7895	1508.7895	K	G	361	375
PSM	DLEAEHVEVEDTTLNR	173	sp|Q9H3K6-2|BOLA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=3432	34.927	3	1902.9383	1902.9383	R	C	15	31
PSM	EDFDSLLQSAK	174	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=4890	45.584	2	1319.7245	1319.7245	K	K	187	198
PSM	EGLELPEDEEEKK	175	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2562	28.897	3	1645.9147	1645.9147	K	K	539	552
PSM	EQISDIDDAVR	176	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2977	31.751	2	1293.6625	1293.6625	K	K	115	126
PSM	GLGLDDALEPR	177	sp|Q9Y230|RUVB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=4067	39.404	2	1188.6563	1188.6563	R	Q	30	41
PSM	HLIPAANTGESK	178	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1167	19.364	2	1304.7725	1304.7725	K	V	85	97
PSM	ISVYYNEATGGK	179	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2678	29.704	2	1368.7562	1368.7562	R	Y	47	59
PSM	ITLDNAYMEK	180	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:35,10-UNIMOD:510	ms_run[2]:scan=2723	30.002	2	1280.6959	1280.6959	K	C	142	152
PSM	NELESYAYSLK	181	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=4150	40	2	1383.7558	1383.7558	R	N	563	574
PSM	NNSGEEFDCAFR	182	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=3091	32.538	2	1478.6309	1478.6309	R	L	591	603
PSM	NSLDCEIVSAK	183	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=2575	28.985	2	1302.7126	1302.7126	K	S	422	433
PSM	NSNPALNDNLEK	184	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1772	23.538	2	1395.763	1395.7630	K	G	120	132
PSM	SEPIPESNDGPVK	185	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=1810	23.797	2	1435.7831	1435.7831	K	V	367	380
PSM	SIYYITGESK	186	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3038	32.171	2	1227.7023	1227.7023	K	E	482	492
PSM	TFDQLTPEESK	187	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2646	29.477	2	1361.7351	1361.7351	K	E	60	71
PSM	TPAQYDASELK	188	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1895	24.368	2	1289.714	1289.7140	K	A	123	134
PSM	TTPSVVAFTADGER	189	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=3661	36.537	2	1483.7731	1483.7731	R	L	86	100
PSM	TWNDPSVQQDIK	190	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2965	31.673	2	1497.81	1497.8100	R	F	102	114
PSM	VIAAEGEMNASR	191	sp|P27105-2|STOM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:35	ms_run[2]:scan=983	17.949	2	1296.6556	1296.6556	K	A	56	68
PSM	VLANPGNSQVAR	192	sp|Q14974|IMB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1295	20.269	2	1258.7206	1258.7206	R	V	43	55
PSM	DNSTMGYMMAK	193	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,8-UNIMOD:35,11-UNIMOD:510	ms_run[1]:scan=2171	26.230884999999997	2	1331.6193	1331.6191	R	K	613	624
PSM	EQISDIDDAVR	194	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510	ms_run[1]:scan=2968	31.692696666666667	2	1293.6621	1293.6620	K	K	115	126
PSM	AEDGSVIDYELIDQDAR	195	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4911	45.754	3	1941.938	1941.9380	R	D	198	215
PSM	CLGLTEAQTR	196	sp|P31327-3|CPSM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=2069	25.54	2	1181.6287	1181.6287	K	E	926	936
PSM	CSLPAEEDSVLEK	197	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=3271	33.804	2	1543.8076	1543.8076	K	L	635	648
PSM	DGFVTVDELK	198	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=4368	41.593	2	1189.6867	1189.6867	K	D	85	95
PSM	DISTNYYASQK	199	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2443	28.079	2	1356.7198	1356.7198	K	K	672	683
PSM	DSLLQDGEFSMDLR	200	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=5003	46.541	3	1674.7983	1674.7983	R	T	76	90
PSM	DVNQQEFVR	201	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2269	26.901	2	1167.6097	1167.6097	K	A	8	17
PSM	DVTGAEALLER	202	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4569	43.098	2	1206.6668	1206.6668	K	H	1350	1361
PSM	EAIEGTYIDK	203	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2476	28.307	2	1205.6816	1205.6816	K	K	49	59
PSM	EQVANSAFVER	204	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1958	24.785	2	1282.673	1282.6730	K	V	492	503
PSM	ERNVEDLSGGELQR	205	sp|P61221|ABCE1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2190	26.367	3	1634.8436	1634.8436	K	F	211	225
PSM	EVYELLDSPGK	206	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3782	37.394	2	1316.75	1316.7500	K	V	20	31
PSM	FGDPVVQSDMK	207	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2021	25.211	2	1305.6911	1305.6911	K	H	78	89
PSM	GDLGIEIPAEK	208	sp|P30613-2|KPYR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3930	38.441	2	1208.7289	1208.7289	R	V	307	318
PSM	GEFVTTVQQR	209	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1934	24.627	2	1197.6566	1197.6566	K	G	132	142
PSM	GGIVDEGALLR	210	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3839	37.799	2	1132.6664	1132.6664	R	A	237	248
PSM	GGNFGFGDSR	211	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2401	27.789	2	1046.4994	1046.4994	R	G	192	202
PSM	HGYIGEFEIIDDHR	212	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4242	40.654	3	1733.8586	1733.8586	K	A	44	58
PSM	HIYYITGETK	213	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2213	26.517	2	1291.7449	1291.7449	K	D	490	500
PSM	IFRDGEEAGAYDGPR	214	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2025	25.238	3	1685.8222	1685.8222	K	T	105	120
PSM	LAAIAESGVER	215	sp|P28072|PSB6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2136	25.994	2	1148.6614	1148.6614	R	Q	210	221
PSM	LDPGSEETQTLVR	216	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2866	30.987	2	1477.7837	1477.7837	K	E	402	415
PSM	LDSDGADLLTK	217	sp|Q00536|CDK16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3939	38.499	2	1294.6694	1294.6694	R	L	415	426
PSM	LIEEVMIGEDK	218	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3757	37.216	2	1342.769	1342.7690	K	L	301	312
PSM	LSEIDVSSEGVK	219	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2952	31.585	2	1329.7664	1329.7664	R	G	177	189
PSM	MVVESAYEVIK	220	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3962	38.662	2	1334.7792	1334.7792	K	L	234	245
PSM	NLQYYDISAK	221	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3339	34.279	2	1281.7241	1281.7241	K	S	143	153
PSM	QLLLTADDR	222	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2863	30.966	2	1077.6242	1077.6242	R	V	61	70
PSM	RLAPEYEAAATR	223	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1636	22.605	2	1380.7574	1380.7574	K	L	62	74
PSM	SISLYYTGEK	224	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3389	34.624	2	1227.7023	1227.7023	R	G	458	468
PSM	SLEDQVEMLR	225	sp|P14314-2|GLU2B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:35	ms_run[2]:scan=3627	36.296	2	1268.6495	1268.6495	K	T	168	178
PSM	VIGSGCNLDSAR	226	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1572	22.178	2	1281.656	1281.6560	R	F	100	112
PSM	YALYDATYETK	227	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3356	34.395	2	1404.7449	1404.7449	R	E	82	93
PSM	YLAEVASGEK	228	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=1582	22.244	2	1133.6605	1133.6605	R	K	133	143
PSM	VEVTEFEDIK	229	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[1]:scan=4106	39.68728333333333	2	1275.7238	1275.7229	K	S	133	143
PSM	LDYDEDASAMLK	230	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=4156	40.042053333333335	2	1437.7336	1437.7329	K	E	211	223
PSM	AAAPAPEEEMDECEQALAAEPK	231	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:4,22-UNIMOD:510	ms_run[2]:scan=4334	41.347	3	2424.1461	2424.1461	K	A	254	276
PSM	ADGYVLEGK	232	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=1977	24.909	2	1018.5971	1018.5971	R	E	185	194
PSM	AENYDIPSADR	233	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2094	25.704	2	1283.6206	1283.6206	R	H	830	841
PSM	ALVEEALAQR	234	sp|Q9HB07|MYG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3087	32.509	2	1132.6664	1132.6664	R	F	244	254
PSM	AQVADVVVSR	235	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2038	25.328	2	1076.6402	1076.6402	K	W	1073	1083
PSM	ATAGDTHLGGEDFDNR	236	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1948	24.718	3	1708.7865	1708.7865	K	L	166	182
PSM	DDSIEGIYDTLK	237	sp|P23921|RIR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=5704	53.124	2	1435.7719	1435.7719	K	Q	225	237
PSM	DNSTMGYMAAK	238	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=1360	20.717	2	1271.6162	1271.6162	R	K	621	632
PSM	DYTYEELLNR	239	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=4843	45.188	2	1348.6723	1348.6723	R	V	173	183
PSM	EAAFDDAVEER	240	sp|Q09028-3|RBBP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2511	28.544	2	1284.6046	1284.6046	K	V	5	16
PSM	EFHLNESGDPSSK	241	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=1961	24.802	3	1513.7685	1513.7685	K	S	130	143
PSM	EGMNIVEAMER	242	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:35	ms_run[2]:scan=2485	28.369	2	1327.6324	1327.6324	K	F	74	85
PSM	EGYSGVGLLSR	243	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3422	34.856	2	1170.6457	1170.6457	K	Q	126	137
PSM	EKLEATINELV	244	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:510	ms_run[2]:scan=4912	45.762	2	1325.8079	1325.8079	K	-	75	86
PSM	EQILEEFSK	245	sp|O60506-4|HNRPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=4002	38.943	2	1189.6867	1189.6867	K	V	257	266
PSM	FAFQAEVNR	246	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3266	33.77	2	1114.5984	1114.5984	K	M	76	85
PSM	GEPNVSYICSR	247	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2607	29.2	2	1394.6114	1394.6114	R	Y	210	221
PSM	GGYIGSTYFER	248	sp|P61081|UBC12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3613	36.199	2	1282.6406	1282.6406	R	C	170	181
PSM	GNPTVEVDLFTSK	249	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4572	43.12	2	1473.8351	1473.8351	R	G	16	29
PSM	GTAVVNGEFK	250	sp|P30048-2|PRDX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=1775	23.559	2	1088.6502	1088.6502	K	D	56	66
PSM	GYFEYIEENK	251	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=4099	39.637	2	1358.7031	1358.7031	R	Y	237	247
PSM	HEQNIDCGGGYVK	252	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1323	20.464	3	1543.7726	1543.7726	K	L	99	112
PSM	INISEGNCPER	253	sp|Q15366-7|PCBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:4	ms_run[2]:scan=1742	23.328	2	1321.6509	1321.6509	R	I	47	58
PSM	IQVLQQQADDAEER	254	sp|P06753-4|TPM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2544	28.775	2	1675.8589	1675.8589	K	A	14	28
PSM	KITIADCGQLE	255	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2973	31.727	2	1314.749	1314.7490	K	-	95	106
PSM	LTPEEEEILNK	256	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3390	34.631	2	1381.7977	1381.7977	K	K	129	140
PSM	LVLVGDGGTGK	257	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2445	28.093	2	1082.6972	1082.6972	K	T	13	24
PSM	NDLAVVDVR	258	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2940	31.502	2	1033.598	1033.5980	K	I	334	343
PSM	NFEDVAFDEK	259	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3817	37.645	2	1280.6561	1280.6561	K	K	376	386
PSM	NFGEEVDDESLK	260	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3163	33.044	2	1448.7307	1448.7307	K	E	197	209
PSM	NLVTEDVMR	261	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3048	32.239	2	1109.5963	1109.5963	K	M	97	106
PSM	QLSSGVSEIR	262	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1793	23.683	2	1108.6301	1108.6301	R	H	80	90
PSM	QYGNEVFLAK	263	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3193	33.259	2	1235.7187	1235.7187	K	L	172	182
PSM	SADTLWDIQK	264	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=4101	39.651	2	1243.7085	1243.7085	K	D	320	330
PSM	SLQSVAEER	265	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1760	23.456	2	1051.5722	1051.5722	R	A	97	106
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK	266	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,35-UNIMOD:510	ms_run[2]:scan=956	17.745	4	3048.3215	3048.3215	K	T	63	98
PSM	TGQAPGYSYTAANK	267	sp|P99999|CYC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=1560	22.092	2	1495.7943	1495.7943	K	N	41	55
PSM	TGTVSLEVR	268	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2102	25.761	2	994.58713	994.5871	K	L	928	937
PSM	TYLEEELDK	269	sp|Q16719|KYNU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=3248	33.644	2	1206.6656	1206.6656	K	W	85	94
PSM	WIDNPTVDDR	270	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2516	28.581	2	1263.6308	1263.6308	R	G	503	513
PSM	YEWDVAEAR	271	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3350	34.354	2	1171.5722	1171.5722	K	K	639	648
PSM	YIDQEELNK	272	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=1695	23.014	2	1218.6769	1218.6769	K	T	276	285
PSM	YISPDQLADLYK	273	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=5010	46.592	2	1492.845	1492.8450	R	S	270	282
PSM	YLAEVACGDDRK	274	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1456	21.376	3	1463.7715	1463.7715	R	Q	128	140
PSM	NPDDITQEEYGEFYK	275	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[1]:scan=4305	41.106415000000005	3	1914.916623	1914.915974	R	S	292	307
PSM	ELISNASDALEK	276	sp|Q12931|TRAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=3136	32.855755	2	1356.7770	1356.7768	R	L	115	127
PSM	EIIDLVLDR	277	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=5253	48.69701666666667	2	1118.6763	1118.6754	K	I	113	122
PSM	AGNFYVPAEPK	278	sp|P18124|RL7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[1]:scan=2995	31.875453333333333	2	1259.719292	1259.718658	K	L	78	89
PSM	AVTEQGHELSNEER	279	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1114	18.986	3	1631.7963	1631.7963	K	N	28	42
PSM	DAGMQLQGYR	280	sp|P00505-2|AATM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2621	29.3	2	1171.5868	1171.5868	R	Y	128	138
PSM	DIVVQETMEDIDK	281	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4961	46.205	2	1601.8495	1601.8495	K	N	190	203
PSM	DLSLEEIQK	282	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=3805	37.56	2	1141.6867	1141.6867	K	K	44	53
PSM	DNNQFASASLDR	283	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2574	28.978	2	1370.6639	1370.6639	K	T	125	137
PSM	DNSTMGYMMAK	284	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2171	26.231	2	1331.6196	1331.6196	R	K	613	624
PSM	DNYVPEVSALDQEIIEVDPDTK	285	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,22-UNIMOD:510	ms_run[2]:scan=6249	60.609	3	2556.3119	2556.3119	R	E	82	104
PSM	DSLSVNEFK	286	sp|Q99584|S10AD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=3261	33.735	2	1105.6292	1105.6292	K	E	31	40
PSM	EDFDSLLQSAK	287	sp|P08195-2|4F2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=4902	45.686	2	1319.7245	1319.7245	K	K	187	198
PSM	EDQTEYLEER	288	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2134	25.983	2	1344.6258	1344.6258	K	R	187	197
PSM	EYLLSGDISEAEHCLK	289	sp|Q53EL6-2|PDCD4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,14-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=5066	47.02	3	1930.9983	1930.9983	K	E	326	342
PSM	FNVWDTAGQEK	290	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3983	38.811	2	1361.7252	1361.7252	K	F	61	72
PSM	GDFCIQVGR	291	sp|P15531|NDKA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=3223	33.469	2	1084.5548	1084.5548	R	N	106	115
PSM	GDYPLEAVR	292	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2819	30.665	2	1052.5715	1052.5715	K	M	368	377
PSM	GYAVLGGER	293	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2129	25.948	2	954.5347	954.5347	R	G	469	478
PSM	IAVAAQNCYK	294	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:4,10-UNIMOD:510	ms_run[2]:scan=1618	22.488	2	1204.6911	1204.6911	K	V	97	107
PSM	IDYIAGLDSR	295	sp|P07741-2|APT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3935	38.472	2	1155.6348	1155.6348	R	G	58	68
PSM	LIEEVMIGEDK	296	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=3136	32.856	2	1358.764	1358.7640	K	L	301	312
PSM	LLVGVDEK	297	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:510	ms_run[2]:scan=2455	28.162	2	939.62772	939.6277	K	L	152	160
PSM	NGSEADIDEGLYSR	298	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2825	30.703	2	1558.7323	1558.7323	K	Q	4	18
PSM	NIIHGSDSVESAEK	299	sp|P15531|NDKA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=1455	21.371	3	1552.8369	1552.8369	R	E	115	129
PSM	NLVTEDVMR	300	sp|P06744-2|G6PI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:35	ms_run[2]:scan=1939	24.66	2	1125.5912	1125.5912	K	M	97	106
PSM	NTDEMVELR	301	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2537	28.727	2	1139.5705	1139.5705	R	I	38	47
PSM	QADLYISEGLHPR	302	sp|P40227|TCPZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3240	33.588	3	1531.8207	1531.8207	K	I	105	118
PSM	QLENSLNEFGEK	303	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3239	33.581	2	1474.794	1474.7940	K	W	518	530
PSM	QLSSGVSEIR	304	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2475	28.3	2	1188.5964	1188.5964	R	H	80	90
PSM	QLVHELDEAEYR	305	sp|Q06323-3|PSME1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2769	30.328	3	1534.784	1534.7840	R	D	199	211
PSM	SGQGAFGNMCR	306	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=943	17.603	2	1233.5443	1233.5443	R	G	87	98
PSM	SGTSEFLNK	307	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=1835	23.964	2	1049.603	1049.6030	K	M	169	178
PSM	STYEQVDLIGK	308	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3383	34.582	2	1319.7609	1319.7609	K	K	324	335
PSM	TIAQDYGVLK	309	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2953	31.592	2	1174.7234	1174.7234	R	A	111	121
PSM	TLEEDEEELFK	310	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=4162	40.085	2	1448.7559	1448.7559	K	M	40	51
PSM	TLSGMESYCVR	311	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2915	31.327	2	1335.6375	1335.6375	R	A	412	423
PSM	TPVEPEVAIHR	312	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1981	24.937	3	1280.7301	1280.7301	K	I	9	20
PSM	TVESITDIR	313	sp|P11279|LAMP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2712	29.926	2	1066.6083	1066.6083	K	A	138	147
PSM	YYVTIIDAPGHR	314	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3398	34.688	3	1437.7829	1437.7829	K	D	85	97
PSM	EGALCEENMR	315	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,5-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=954	17.730495	2	1257.5537	1257.5537	K	G	689	699
PSM	EAAENSLVAYK	316	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[1]:scan=2309	27.169884999999997	2	1261.718364	1261.719052	K	A	143	154
PSM	EELVAEQALK	317	sp|Q9Y6E2|BZW2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[1]:scan=2599	29.149173333333334	2	1196.7287	1196.7284	K	H	311	321
PSM	PGTETEESMGGGEGNHR	318	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0		ms_run[1]:scan=839	16.396903333333334	3	1743.7114	1743.7113	D	A	2014	2031
PSM	SYCAEIAHNVSSK	319	sp|P62910|RL32_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:4,13-UNIMOD:510	ms_run[1]:scan=2053	25.429015	3	1532.7933	1532.7924	K	N	94	107
PSM	IVVLGDGASGK	320	sp|P51157|RAB28_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[1]:scan=2445	28.092651666666665	2	1082.6975	1082.6967	K	T	15	26
PSM	RIYKTVADSDESYMEK	321	sp|Q9HAW4|CLSPN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=5162	47.96311666666667	2	2208.8972	2207.8712	K	S	102	118
PSM	EAQNLSAMEIR	322	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510	ms_run[1]:scan=2823	30.688865000000003	2	1294.6662	1294.6762	R	K	171	182