MTD mzTab-version 1.0 MTD mzTab-mode Complete MTD mzTab-type Identification MTD description JPST000508 phospho -- main MTD ms_run[1]-location D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100712_002BRAF-V600E.maxq.txt MTD ms_run[2]-location D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100712_002BRAF-V600E.maxqFin.txt MTD software[1] [MS, MS:1001583, MaxQuant, 1.6.17.0] MTD software[1]-setting Taxon=userFasta.sprot_human_20211018 MTD software[1]-setting enzymes=Trypsin/P MTD software[1]-setting enzymeMode=0 MTD software[1]-setting fixedModifications=Carbamidomethyl (C) MTD software[1]-setting variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY) MTD software[1]-setting maxMissedCleavages=2 MTD software[1]-setting lcmsRunType=Standard MTD software[1]-setting firstSearchTol=20 MTD software[1]-setting mainSearchTol=4.5 MTD software[2] [MS, MS:1001476, X!Tandem, 2015.04.01.1] MTD software[2]-setting DB=userFasta.sprot_human_20211018 MTD software[2]-setting CLE=[RK]|{} MTD software[2]-setting MODS=Carbamidomethyl (C) MTD software[2]-setting IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term) MTD software[2]-setting TOL(-)=10 MTD software[2]-setting TOL(+)=10 MTD software[2]-setting TOLU=ppm MTD software[2]-setting ITOL=300 MTD software[2]-setting ITOLU=ppm MTD software[2]-setting PEP_ISOTOPE_ERROR=yes MTD software[2]-setting PFA=2 MTD software[3] [MS, MS:1002251, Comet, 2019.01 rev. 5] MTD software[3]-setting Taxon=userFasta.sprot_human_20211018 MTD software[3]-setting search_enzyme_number=2 MTD software[3]-setting FixMod=Carbamidomethyl (C) MTD software[3]-setting VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y) MTD software[3]-setting max_variable_mods_in_peptide=5 MTD software[3]-setting allowed_missed_cleavage=2 MTD software[3]-setting peptide_mass_tolerance=10 MTD software[3]-setting peptide_mass_units=2 MTD software[3]-setting fragment_bin_tol=0.02 MTD software[3]-setting fragment_bin_offset=0.0 MTD fixed_mod[1] [UNIMOD, UNIMOD:4, Carbamidomethyl,] MTD fixed_mod[1]-site C MTD fixed_mod[1]-position Anywhere MTD variable_mod[1] [UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),] MTD variable_mod[1]-site K MTD variable_mod[1]-position Anywhere MTD variable_mod[2] [UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),] MTD variable_mod[2]-site N-term MTD variable_mod[2]-position Any N-term MTD variable_mod[3] [UNIMOD, UNIMOD:35, Oxidation,] MTD variable_mod[3]-site M MTD variable_mod[3]-position Anywhere MTD variable_mod[4] [UNIMOD, UNIMOD:21, Phospho,] MTD variable_mod[4]-site S MTD variable_mod[4]-position Anywhere MTD variable_mod[5] [UNIMOD, UNIMOD:21, Phospho,] MTD variable_mod[5]-site T MTD variable_mod[5]-position Anywhere MTD variable_mod[6] [UNIMOD, UNIMOD:21, Phospho,] MTD variable_mod[6]-site Y MTD variable_mod[6]-position Anywhere MTD protein_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] MTD psm_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] PRH accession description taxid species database database_version search_engine best_search_engine_score[1] ambiguity_members modifications protein_coverage search_engine_score[1]_ms_run[1] num_psms_ms_run[1] num_peptides_distinct_ms_run[1] num_peptides_unique_ms_run[1] PRT sp|P61981|1433G_HUMAN 14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 46.0 null 228-UNIMOD:510 0.09 46.0 5 1 0 PRT sp|P55081|MFAP1_HUMAN Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 44.0 null 257-UNIMOD:510,267-UNIMOD:21,280-UNIMOD:510 0.06 44.0 1 1 1 PRT sp|P15056|BRAF_HUMAN Serine/threonine-protein kinase B-raf OS=Homo sapiens OX=9606 GN=BRAF PE=1 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 43.0 null 444-UNIMOD:510,446-UNIMOD:21,447-UNIMOD:21,445-UNIMOD:510,440-UNIMOD:510,463-UNIMOD:510,465-UNIMOD:21,470-UNIMOD:21,473-UNIMOD:510,467-UNIMOD:21 0.05 43.0 8 4 1 PRT sp|Q13283|G3BP1_HUMAN Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 43.0 null 230-UNIMOD:510,241-UNIMOD:21 0.04 43.0 1 1 1 PRT sp|P84098|RL19_HUMAN 60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 43.0 null 22-UNIMOD:510,29-UNIMOD:21 0.09 43.0 1 1 1 PRT sp|Q15185-2|TEBP_HUMAN Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 40.0 null 75-UNIMOD:510,84-UNIMOD:35,80-UNIMOD:21 0.13 40.0 3 1 0 PRT sp|Q9UPR0-2|PLCL2_HUMAN Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 40.0 null 445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,446-UNIMOD:510 0.03 40.0 2 2 2 PRT sp|P62258-2|1433E_HUMAN Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 39.0 null 204-UNIMOD:510,222-UNIMOD:510,213-UNIMOD:35,121-UNIMOD:510,126-UNIMOD:21,131-UNIMOD:510 0.14 39.0 3 2 1 PRT sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 38.0 null 203-UNIMOD:510,221-UNIMOD:510,205-UNIMOD:21,389-UNIMOD:4,93-UNIMOD:510,100-UNIMOD:21,103-UNIMOD:510 0.13 38.0 4 3 2 PRT sp|P35221-3|CTNA1_HUMAN Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 38.0 null 264-UNIMOD:510,271-UNIMOD:21 0.04 38.0 1 1 1 PRT sp|Q96K76-2|UBP47_HUMAN Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 37.0 null 916-UNIMOD:510,927-UNIMOD:21,936-UNIMOD:510 0.02 37.0 1 1 1 PRT sp|P54105|ICLN_HUMAN Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 36.0 null 86-UNIMOD:510,91-UNIMOD:510,102-UNIMOD:21,207-UNIMOD:510 0.26 36.0 2 2 2 PRT sp|P08238|HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 36.0 null 292-UNIMOD:510,306-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,492-UNIMOD:510,379-UNIMOD:510,527-UNIMOD:510,531-UNIMOD:510,532-UNIMOD:21,535-UNIMOD:21,538-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510 0.13 36.0 7 7 6 PRT sp|Q04917|1433F_HUMAN 14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 35.0 null 228-UNIMOD:510 0.08 35.0 1 1 1 PRT sp|P09923|PPBI_HUMAN Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 35.0 null 107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510 0.03 35.0 1 1 1 PRT sp|Q9BQE3|TBA1C_HUMAN Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 null 65-UNIMOD:510,73-UNIMOD:21,327-UNIMOD:510,334-UNIMOD:21,336-UNIMOD:510,431-UNIMOD:510,439-UNIMOD:21 0.10 34.0 3 3 3 PRT sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 null 595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4 0.02 34.0 1 1 1 PRT sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 null 581-UNIMOD:510,591-UNIMOD:4,593-UNIMOD:21,594-UNIMOD:510,587-UNIMOD:21,595-UNIMOD:21,598-UNIMOD:510,33-UNIMOD:510,38-UNIMOD:21,41-UNIMOD:4,42-UNIMOD:510 0.03 34.0 5 3 2 PRT sp|P67936|TPM4_HUMAN Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 null 14-UNIMOD:510 0.06 34.0 1 1 1 PRT sp|P11142-2|HSP7C_HUMAN Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 null 221-UNIMOD:510,160-UNIMOD:510,163-UNIMOD:21,57-UNIMOD:510,61-UNIMOD:35,64-UNIMOD:21,71-UNIMOD:510,37-UNIMOD:510,45-UNIMOD:21 0.12 34.0 4 4 2 PRT sp|P63261|ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 null 239-UNIMOD:510,249-UNIMOD:21,19-UNIMOD:510,360-UNIMOD:510,184-UNIMOD:510,190-UNIMOD:35,191-UNIMOD:510,316-UNIMOD:510,323-UNIMOD:21,325-UNIMOD:35,326-UNIMOD:510 0.17 34.0 5 5 5 PRT sp|Q9UQ80-2|PA2G4_HUMAN Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 null 323-UNIMOD:510 0.06 34.0 1 1 1 PRT sp|P13861-2|KAP2_HUMAN Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 33.0 null 97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4 0.06 33.0 1 1 1 PRT sp|P61978-3|HNRPK_HUMAN Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 33.0 null 70-UNIMOD:510 0.04 33.0 1 1 1 PRT sp|Q9H1E3-2|NUCKS_HUMAN Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 null 89-UNIMOD:510,98-UNIMOD:35,110-UNIMOD:510 0.11 32.0 1 1 1 PRT sp|P04075|ALDOA_HUMAN Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 null 29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,331-UNIMOD:510,336-UNIMOD:21,339-UNIMOD:4,342-UNIMOD:510 0.08 32.0 2 2 2 PRT sp|Q9NPQ8-2|RIC8A_HUMAN Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 null 418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510 0.05 32.0 2 1 0 PRT sp|P14625|ENPL_HUMAN Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 null 435-UNIMOD:510,253-UNIMOD:510,265-UNIMOD:510 0.04 32.0 2 2 2 PRT sp|P63104|1433Z_HUMAN 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 null 28-UNIMOD:510,28-UNIMOD:21 0.06 32.0 2 1 0 PRT sp|P10599-2|THIO_HUMAN Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 null 9-UNIMOD:510,21-UNIMOD:510 0.16 32.0 1 1 1 PRT sp|P07437|TBB5_HUMAN Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 null 325-UNIMOD:510,336-UNIMOD:510,63-UNIMOD:510,72-UNIMOD:21,73-UNIMOD:35,330-UNIMOD:35 0.07 31.0 3 2 1 PRT sp|O00264-2|PGRC1_HUMAN Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 null 45-UNIMOD:510,57-UNIMOD:21 0.17 31.0 1 1 1 PRT sp|P07195|LDHB_HUMAN L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 null 8-UNIMOD:510,23-UNIMOD:510 0.05 31.0 1 1 1 PRT sp|P0DMV8-2|HS71A_HUMAN Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 null 57-UNIMOD:510,66-UNIMOD:21,71-UNIMOD:510 0.03 31.0 1 1 1 PRT sp|Q07020-2|RL18_HUMAN Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 null 50-UNIMOD:510,56-UNIMOD:21 0.09 31.0 1 1 1 PRT sp|Q9BXV9|GON7_HUMAN EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 null 60-UNIMOD:510 0.27 31.0 1 1 1 PRT sp|P00338-4|LDHA_HUMAN Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 30.0 null 43-UNIMOD:510,57-UNIMOD:510,261-UNIMOD:510,264-UNIMOD:21,270-UNIMOD:510 0.10 30.0 2 2 2 PRT sp|P11021|BIP_HUMAN Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ] 30.0 null 82-UNIMOD:510,91-UNIMOD:21,96-UNIMOD:510,186-UNIMOD:510,189-UNIMOD:21,102-UNIMOD:510,107-UNIMOD:21,113-UNIMOD:510,50-UNIMOD:510 0.08 30.0 4 4 4 PRT sp|P45974-2|UBP5_HUMAN Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 30.0 null 756-UNIMOD:510,760-UNIMOD:21,770-UNIMOD:510 0.02 30.0 1 1 1 PRT sp|O00469-3|PLOD2_HUMAN Isoform 3 of Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 30.0 null 101-UNIMOD:510 0.03 30.0 1 1 1 PRT sp|O43852-2|CALU_HUMAN Isoform 2 of Calumenin OS=Homo sapiens OX=9606 GN=CALU null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 30.0 null 38-UNIMOD:510,44-UNIMOD:21,59-UNIMOD:510 0.07 30.0 1 1 1 PRT sp|P55060|XPO2_HUMAN Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 30.0 null 332-UNIMOD:510,342-UNIMOD:21,344-UNIMOD:4,346-UNIMOD:510,339-UNIMOD:21 0.02 30.0 2 1 0 PRT sp|Q01082-3|SPTB2_HUMAN Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 null 1369-UNIMOD:510,1375-UNIMOD:21,1376-UNIMOD:4,1381-UNIMOD:510 0.01 29.0 1 1 1 PRT sp|Q9UPN3-4|MACF1_HUMAN Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 null 2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510 0.00 29.0 1 1 1 PRT sp|P47712|PA24A_HUMAN Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 null 414-UNIMOD:510,425-UNIMOD:21,427-UNIMOD:510 0.02 29.0 1 1 1 PRT sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 null 2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510 0.01 29.0 1 1 1 PRT sp|P05386-2|RLA1_HUMAN Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 null 73-UNIMOD:510,83-UNIMOD:35,79-UNIMOD:21 0.20 29.0 3 1 0 PRT sp|P13674-3|P4HA1_HUMAN Isoform 3 of Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 null 137-UNIMOD:510,147-UNIMOD:21,150-UNIMOD:510,140-UNIMOD:21 0.03 29.0 2 1 0 PRT sp|P55060-4|XPO2_HUMAN Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 null 276-UNIMOD:510,285-UNIMOD:21,288-UNIMOD:4,290-UNIMOD:510 0.02 29.0 2 1 0 PRT sp|P60174-3|TPIS_HUMAN Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 null 57-UNIMOD:510,65-UNIMOD:21,70-UNIMOD:510 0.05 29.0 1 1 1 PRT sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 29.0 null 195-UNIMOD:510,205-UNIMOD:21,208-UNIMOD:510 0.03 29.0 1 1 1 PRT sp|P27348|1433T_HUMAN 14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 null 28-UNIMOD:510 0.06 28.0 1 1 1 PRT sp|P30041|PRDX6_HUMAN Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 null 85-UNIMOD:510,91-UNIMOD:4,97-UNIMOD:510,42-UNIMOD:510,47-UNIMOD:4,48-UNIMOD:21 0.12 28.0 2 2 2 PRT sp|P60660-2|MYL6_HUMAN Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 null 82-UNIMOD:510 0.09 28.0 1 1 1 PRT sp|P11766|ADHX_HUMAN Alcohol dehydrogenase class-3 OS=Homo sapiens OX=9606 GN=ADH5 PE=1 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 null 234-UNIMOD:510,238-UNIMOD:21,240-UNIMOD:4,248-UNIMOD:510 0.04 28.0 1 1 1 PRT sp|P62241|RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 null 158-UNIMOD:510,160-UNIMOD:21,170-UNIMOD:510 0.07 28.0 1 1 1 PRT sp|O15371-2|EIF3D_HUMAN Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 null 42-UNIMOD:510,49-UNIMOD:21,53-UNIMOD:510 0.03 28.0 1 1 1 PRT sp|Q58FG1|HS904_HUMAN Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 28.0 null 28-UNIMOD:510,34-UNIMOD:21,38-UNIMOD:35,40-UNIMOD:510,30-UNIMOD:21 0.03 28.0 2 1 0 PRT sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ] 28.0 null 387-UNIMOD:510,391-UNIMOD:21,47-UNIMOD:510,52-UNIMOD:21,58-UNIMOD:510,251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,270-UNIMOD:510 0.07 28.0 3 3 2 PRT sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 28.0 null 2207-UNIMOD:510,2215-UNIMOD:21 0.01 28.0 1 1 1 PRT sp|Q8IWX8|CHERP_HUMAN Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ] 28.0 null 815-UNIMOD:510,817-UNIMOD:21,819-UNIMOD:21 0.03 28.0 2 1 0 PRT sp|Q13263-2|TIF1B_HUMAN Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 null 698-UNIMOD:510,702-UNIMOD:21 0.02 27.0 1 1 1 PRT sp|P40925-2|MDHC_HUMAN Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 null 230-UNIMOD:510,235-UNIMOD:510,237-UNIMOD:21,243-UNIMOD:21 0.07 27.0 1 1 0 PRT sp|P13489|RINI_HUMAN Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 null 174-UNIMOD:510,176-UNIMOD:21 0.03 27.0 1 1 1 PRT sp|Q15056-2|IF4H_HUMAN Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 null 83-UNIMOD:510,85-UNIMOD:4,94-UNIMOD:21,96-UNIMOD:510,97-UNIMOD:510 0.12 27.0 2 2 2 PRT sp|Q08J23-3|NSUN2_HUMAN Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 null 355-UNIMOD:510,363-UNIMOD:4 0.02 27.0 1 1 1 PRT sp|O95757|HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 null 591-UNIMOD:510,599-UNIMOD:21,606-UNIMOD:510,74-UNIMOD:510,82-UNIMOD:21 0.03 27.0 2 2 2 PRT sp|P29401|TKT_HUMAN Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 27.0 null 439-UNIMOD:510,454-UNIMOD:21,456-UNIMOD:510,449-UNIMOD:21 0.03 27.0 2 1 0 PRT sp|P61247|RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 null 250-UNIMOD:510,263-UNIMOD:21 0.06 27.0 1 1 1 PRT sp|P40925|MDHC_HUMAN Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 27.0 null 319-UNIMOD:510,324-UNIMOD:510,326-UNIMOD:21,333-UNIMOD:21 0.05 27.0 1 1 0 PRT sp|P18858-2|DNLI1_HUMAN Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 null 174-UNIMOD:510,183-UNIMOD:21,186-UNIMOD:510,189-UNIMOD:510 0.02 26.0 1 1 1 PRT sp|P15374|UCHL3_HUMAN Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens OX=9606 GN=UCHL3 PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 null 122-UNIMOD:510,126-UNIMOD:21,129-UNIMOD:35 0.06 26.0 2 1 0 PRT sp|P23528|COF1_HUMAN Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 null 133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510,82-UNIMOD:510,92-UNIMOD:510 0.15 26.0 2 2 2 PRT sp|Q14157-4|UBP2L_HUMAN Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 null 232-UNIMOD:510,234-UNIMOD:21,247-UNIMOD:21,250-UNIMOD:510,232-UNIMOD:21,249-UNIMOD:21 0.02 26.0 2 1 0 PRT sp|P14314-2|GLU2B_HUMAN Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 null 462-UNIMOD:510,466-UNIMOD:21,468-UNIMOD:4,92-UNIMOD:510,97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,112-UNIMOD:4,116-UNIMOD:4,117-UNIMOD:510 0.08 26.0 2 2 2 PRT sp|Q14157|UBP2L_HUMAN Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 26.0 null 239-UNIMOD:510,239-UNIMOD:21,254-UNIMOD:21,257-UNIMOD:510 0.02 26.0 1 1 0 PRT sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 26.0 null 846-UNIMOD:510,854-UNIMOD:21 0.01 26.0 1 1 0 PRT sp|P35606-2|COPB2_HUMAN Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 null 125-UNIMOD:510 0.01 25.0 1 1 1 PRT sp|Q15084-3|PDIA6_HUMAN Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 null 158-UNIMOD:510,169-UNIMOD:510 0.03 25.0 1 1 1 PRT sp|P62937-2|PPIA_HUMAN Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 null 74-UNIMOD:510 0.11 25.0 1 1 1 PRT sp|P50990-3|TCPQ_HUMAN Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 null 306-UNIMOD:510,295-UNIMOD:510,300-UNIMOD:21 0.05 25.0 2 2 2 PRT sp|P29692-4|EF1D_HUMAN Isoform 4 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 null 224-UNIMOD:510,228-UNIMOD:4,234-UNIMOD:510,125-UNIMOD:510,128-UNIMOD:21,150-UNIMOD:510 0.15 25.0 2 2 2 PRT sp|Q9UQ35-2|SRRM2_HUMAN Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 null 846-UNIMOD:510,848-UNIMOD:21 0.01 25.0 1 1 0 PRT sp|P60484|PTEN_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 null 379-UNIMOD:510,382-UNIMOD:21,383-UNIMOD:21,402-UNIMOD:510 0.06 25.0 1 1 1 PRT sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 25.0 null 57-UNIMOD:510,61-UNIMOD:35,66-UNIMOD:21,71-UNIMOD:510 0.02 25.0 1 1 0 PRT sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 25.0 null 411-UNIMOD:510 0.02 25.0 1 1 1 PRT sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 null 20-UNIMOD:510 0.02 24.0 1 1 1 PRT sp|P21333-2|FLNA_HUMAN Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 null 1453-UNIMOD:510,1453-UNIMOD:4,1459-UNIMOD:21 0.00 24.0 1 1 1 PRT sp|P46108-2|CRK_HUMAN Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 null 39-UNIMOD:510,43-UNIMOD:21 0.09 24.0 1 1 0 PRT sp|P78371-2|TCPB_HUMAN Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 null 330-UNIMOD:510 0.03 24.0 1 1 1 PRT sp|P62942|FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 null 2-UNIMOD:510,7-UNIMOD:21 0.13 24.0 1 1 1 PRT sp|P18206-2|VINC_HUMAN Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 null 282-UNIMOD:510,290-UNIMOD:21 0.02 24.0 1 1 1 PRT sp|O15042-3|SR140_HUMAN Isoform 3 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 null 68-UNIMOD:510,76-UNIMOD:21,79-UNIMOD:510 0.02 24.0 1 1 1 PRT sp|Q7Z417|NUFP2_HUMAN Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 null 650-UNIMOD:510,652-UNIMOD:21 0.02 24.0 1 1 1 PRT sp|P10809|CH60_HUMAN 60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ] 24.0 null 61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510,67-UNIMOD:21 0.02 24.0 2 1 0 PRT sp|Q14677|EPN4_HUMAN Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 null 159-UNIMOD:510,166-UNIMOD:21 0.02 24.0 1 1 1 PRT sp|P46108|CRK_HUMAN Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 24.0 null 39-UNIMOD:510,40-UNIMOD:21 0.06 24.0 1 1 0 PRT sp|P13674|P4HA1_HUMAN Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 24.0 null 137-UNIMOD:510,149-UNIMOD:21,150-UNIMOD:510 0.03 24.0 1 1 0 PRT sp|Q9H3K6-2|BOLA2_HUMAN Isoform 2 of BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 15-UNIMOD:510 0.29 23.0 1 1 1 PRT sp|P50395-2|GDIB_HUMAN Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 346-UNIMOD:510,351-UNIMOD:21,358-UNIMOD:510,368-UNIMOD:21,369-UNIMOD:4,373-UNIMOD:510 0.07 23.0 2 2 2 PRT sp|P62826|RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 61-UNIMOD:510,66-UNIMOD:21,71-UNIMOD:510 0.06 23.0 1 1 1 PRT sp|P21291|CSRP1_HUMAN Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 179-UNIMOD:510,192-UNIMOD:21 0.08 23.0 1 1 1 PRT sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 438-UNIMOD:510,443-UNIMOD:21,450-UNIMOD:510 0.02 23.0 1 1 1 PRT sp|P10696|PPBN_HUMAN Alkaline phosphatase, germ cell type OS=Homo sapiens OX=9606 GN=ALPG PE=2 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510 0.03 23.0 1 1 1 PRT sp|P02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 345-UNIMOD:510,353-UNIMOD:4,358-UNIMOD:510,361-UNIMOD:21,363-UNIMOD:4 0.03 23.0 1 1 1 PRT sp|Q13185|CBX3_HUMAN Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 172-UNIMOD:510,177-UNIMOD:4 0.07 23.0 1 1 1 PRT sp|P31327-2|CPSM_HUMAN Isoform 2 of Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|P24752|THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 209-UNIMOD:510,218-UNIMOD:21 0.03 23.0 1 1 1 PRT sp|P37802|TAGL2_HUMAN Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 172-UNIMOD:510,180-UNIMOD:21 0.06 23.0 1 1 1 PRT sp|P26639|SYTC_HUMAN Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 518-UNIMOD:510,522-UNIMOD:21,529-UNIMOD:510 0.02 23.0 1 1 1 PRT sp|Q9UJ70|NAGK_HUMAN N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 70-UNIMOD:510,76-UNIMOD:21 0.05 23.0 1 1 1 PRT sp|Q9BRS2|RIOK1_HUMAN Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 494-UNIMOD:510,495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21,521-UNIMOD:510 0.05 23.0 1 1 1 PRT sp|P43487-2|RANG_HUMAN Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 null 40-UNIMOD:510,50-UNIMOD:510 0.06 23.0 1 1 1 PRT sp|Q9UNZ2-4|NSF1C_HUMAN Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 null 77-UNIMOD:510 0.05 22.0 1 1 1 PRT sp|P53999|TCP4_HUMAN Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 null 115-UNIMOD:510 0.09 22.0 1 1 1 PRT sp|P16949|STMN1_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 null 30-UNIMOD:510,38-UNIMOD:21,41-UNIMOD:510,44-UNIMOD:510,52-UNIMOD:510 0.15 22.0 2 2 2 PRT sp|P25705-2|ATPA_HUMAN Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 null 0.05 22.0 1 1 1 PRT sp|P04083|ANXA1_HUMAN Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 null 186-UNIMOD:510 0.06 22.0 1 1 1 PRT sp|P62244|RS15A_HUMAN 40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 null 44-UNIMOD:510 0.12 22.0 1 1 1 PRT sp|Q12904|AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 null 270-UNIMOD:510,284-UNIMOD:4,287-UNIMOD:21,289-UNIMOD:510 0.07 22.0 1 1 1 PRT sp|Q9H2U2-4|IPYR2_HUMAN Isoform 4 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 null 143-UNIMOD:510,147-UNIMOD:21,154-UNIMOD:510 0.08 22.0 1 1 1 PRT sp|Q01105-3|SET_HUMAN Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 null 98-UNIMOD:510,107-UNIMOD:510 0.04 22.0 1 1 1 PRT sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 22.0 null 221-UNIMOD:510,37-UNIMOD:510,47-UNIMOD:21 0.05 22.0 2 2 1 PRT sp|P20042|IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 null 173-UNIMOD:510 0.03 21.0 1 1 1 PRT sp|P27797|CALR_HUMAN Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 null 25-UNIMOD:510 0.03 21.0 1 1 1 PRT sp|P48643-2|TCPE_HUMAN Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 null 58-UNIMOD:510,61-UNIMOD:21,67-UNIMOD:510 0.02 21.0 1 1 1 PRT sp|Q9H7D7-3|WDR26_HUMAN Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 null 119-UNIMOD:510,121-UNIMOD:21 0.06 21.0 1 1 1 PRT sp|P18615|NELFE_HUMAN Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 null 131-UNIMOD:510,135-UNIMOD:21 0.03 21.0 1 1 1 PRT sp|Q86TC9-2|MYPN_HUMAN Isoform 2 of Myopalladin OS=Homo sapiens OX=9606 GN=MYPN null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 null 648-UNIMOD:510,653-UNIMOD:21,666-UNIMOD:510 0.02 21.0 1 1 1 PRT sp|P14618|KPYM_HUMAN Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 21.0 null 44-UNIMOD:510,49-UNIMOD:4,50-UNIMOD:21 0.03 21.0 1 1 1 PRT sp|Q96T58|MINT_HUMAN Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1 null null userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 21.0 null 1657-UNIMOD:21,1661-UNIMOD:510,1662-UNIMOD:21,1669-UNIMOD:21 0.00 21.0 1 1 1 PSH sequence PSM_ID accession unique database database_version search_engine search_engine_score[1] modifications spectra_ref retention_time charge exp_mass_to_charge calc_mass_to_charge pre post start end PSM DNLTLWTSDQQDDDGGEGNN 1 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 46.0 1-UNIMOD:510 ms_run[2]:scan=4623 47.64 2 2226.9361 2226.9361 R - 228 248 PSM DNLTLWTSDQQDDDGGEGNN 2 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 45.0 1-UNIMOD:510 ms_run[2]:scan=4743 48.658 2 2226.9361 2226.9361 R - 228 248 PSM RSLAALDALNTDDENDEEEYEAWK 3 sp|P55081|MFAP1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 44.0 1-UNIMOD:510,11-UNIMOD:21,24-UNIMOD:510 ms_run[2]:scan=4788 49.113 3 2944.3288 2944.3288 K V 257 281 PSM RDSSDDWEIPDGQITVGQR 4 sp|P15056|BRAF_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 43.0 1-UNIMOD:510,3-UNIMOD:21 ms_run[2]:scan=4157 43.429 2 2287.033 2287.0330 R I 444 463 PSM SSSPAPADIAQTVQEDLR 5 sp|Q13283|G3BP1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 43.0 1-UNIMOD:510,12-UNIMOD:21 ms_run[2]:scan=3990 41.997 2 1997.9519 1997.9519 K T 230 248 PSM VWLDPNETNEIANANSR 6 sp|P84098|RL19_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 43.0 1-UNIMOD:510,8-UNIMOD:21 ms_run[2]:scan=3983 41.945 2 2055.9475 2055.9475 K Q 22 39 PSM RDSSDDWEIPDGQITVGQR 7 sp|P15056|BRAF_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 42.0 1-UNIMOD:510,4-UNIMOD:21 ms_run[1]:scan=4157 43.429046666666665 2 2287.026976 2287.033037 R I 444 463 PSM DWEDDSDEDMSNFDR 8 sp|Q15185-2|TEBP_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 40.0 1-UNIMOD:510 ms_run[2]:scan=3938 41.612 2 1908.7168 1908.7168 K F 75 90 PSM KLSSNCSGVEGDVTDEDEGAEMSQR 9 sp|Q9UPR0-2|PLCL2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 40.0 1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21 ms_run[2]:scan=2228 28.36 3 2847.2212 2847.2212 K M 445 470 PSM DNLTLWTSDMQGDGEEQNK 10 sp|P62258-2|1433E_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 39.0 1-UNIMOD:510,19-UNIMOD:510 ms_run[2]:scan=4514 46.599 2 2248.059 2248.0590 R E 204 223 PSM DNLTLWTSDQQDDDGGEGNN 11 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 39.0 1-UNIMOD:510 ms_run[2]:scan=4843 49.664 2 2226.9361 2226.9361 R - 228 248 PSM DATNVGDEGGFAPNILENK 12 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 38.0 1-UNIMOD:510,19-UNIMOD:510 ms_run[2]:scan=4353 45.177 2 2028.0436 2028.0436 K E 203 222 PSM DATNVGDEGGFAPNILENK 13 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 38.0 1-UNIMOD:510,3-UNIMOD:21,19-UNIMOD:510 ms_run[2]:scan=4757 48.779 2 2108.01 2108.0100 K E 203 222 PSM TPEELDDSDFETEDFDVR 14 sp|P35221-3|CTNA1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 38.0 1-UNIMOD:510,8-UNIMOD:21 ms_run[2]:scan=4819 49.368 2 2271.9157 2271.9157 R S 264 282 PSM DNLTLWTSDMQGDGEEQNK 15 sp|P62258-2|1433E_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 37.0 1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510 ms_run[2]:scan=3804 40.5 2 2264.0539 2264.0539 R E 204 223 PSM DWEDDSDEDMSNFDR 16 sp|Q15185-2|TEBP_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 37.0 1-UNIMOD:510,10-UNIMOD:35 ms_run[2]:scan=2939 33.693 2 1924.7117 1924.7117 K F 75 90 PSM DWEDDSDEDMSNFDR 17 sp|Q15185-2|TEBP_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 37.0 1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:35 ms_run[2]:scan=3307 36.524 2 2004.6781 2004.6781 K F 75 90 PSM ETWDTAEEDSGTDSEYDESGK 18 sp|Q96K76-2|UBP47_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 37.0 1-UNIMOD:510,12-UNIMOD:21,21-UNIMOD:510 ms_run[2]:scan=2812 32.731 2 2497.9806 2497.9806 K S 916 937 PSM FEEESKEPVADEEEEDSDDDVEPITEFR 19 sp|P54105|ICLN_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 36.0 1-UNIMOD:510,6-UNIMOD:510,17-UNIMOD:21 ms_run[2]:scan=4184 43.682 3 3461.4719 3461.4719 K F 86 114 PSM NPDDITQEEYGEFYK 20 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 36.0 1-UNIMOD:510,15-UNIMOD:510 ms_run[2]:scan=3800 40.469 2 1914.916 1914.9160 R S 292 307 PSM DNLTLWTSDQQDEEAGEGN 21 sp|Q04917|1433F_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 35.0 1-UNIMOD:510 ms_run[2]:scan=4706 48.32 2 2154.9402 2154.9402 R - 228 247 PSM QVPDSAATATAYLCGVK 22 sp|P09923|PPBI_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 35.0 1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510 ms_run[2]:scan=4243 44.19 2 1898.9485 1898.9486 R A 107 124 PSM AVFVDLEPTVIDEVR 23 sp|Q9BQE3|TBA1C_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 1-UNIMOD:510,9-UNIMOD:21 ms_run[2]:scan=5543 57.894 2 1814.9279 1814.9279 R T 65 80 PSM DKDDDGGEDDDANCNLICGDEYGPETR 24 sp|Q08211|DHX9_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4 ms_run[2]:scan=3164 35.396 3 3112.2782 3112.2782 K L 595 622 PSM ETVSEESNVLCLSK 25 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 1-UNIMOD:510,11-UNIMOD:4,13-UNIMOD:21,14-UNIMOD:510 ms_run[2]:scan=3499 37.988 2 1741.8482 1741.8482 R S 581 595 PSM IQALQQQADEAEDR 26 sp|P67936|TPM4_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 1-UNIMOD:510 ms_run[2]:scan=1804 25.236 2 1647.8276 1647.8276 K A 14 28 PSM LSSNCSGVEGDVTDEDEGAEMSQR 27 sp|Q9UPR0-2|PLCL2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21 ms_run[2]:scan=2698 31.878 3 2685.0632 2685.0632 K M 446 470 PSM STAGDTHLGGEDFDNR 28 sp|P11142-2|HSP7C_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 1-UNIMOD:510 ms_run[2]:scan=1580 23.592 2 1724.7814 1724.7814 K M 221 237 PSM SYELPDGQVITIGNER 29 sp|P63261|ACTG_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 1-UNIMOD:510,11-UNIMOD:21 ms_run[2]:scan=5310 54.782 2 1903.9141 1903.9141 K F 239 255 PSM TAENATSGETLEENEAGD 30 sp|Q9UQ80-2|PA2G4_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 34.0 1-UNIMOD:510 ms_run[2]:scan=1763 24.932 2 1870.8128 1870.8128 K - 323 341 PSM ETVSEESNVLCLSK 31 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 33.0 1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510 ms_run[2]:scan=3168 35.426 2 1661.8818 1661.8818 R S 581 595 PSM RVSVCAETYNPDEEEEDTDPR 32 sp|P13861-2|KAP2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 33.0 1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4 ms_run[2]:scan=2513 30.492 3 2624.0798 2624.0798 R V 97 118 PSM TDYNASVSVPDSSGPER 33 sp|P61978-3|HNRPK_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 33.0 1-UNIMOD:510 ms_run[2]:scan=2257 28.576 2 1813.8543 1813.8543 R I 70 87 PSM DNLTLWTSDQQDDDGGEGNN 34 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 33.0 1-UNIMOD:510 ms_run[1]:scan=7032 81.86433833333334 2 2226.9336 2226.9356 R - 228 248 PSM DSGSDEDFLMEDDDDSDYGSSK 35 sp|Q9H1E3-2|NUCKS_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 1-UNIMOD:510,10-UNIMOD:35,22-UNIMOD:510 ms_run[2]:scan=3609 38.841 2 2511.9868 2511.9868 K K 89 111 PSM GILAADESTGSIAK 36 sp|P04075|ALDOA_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510 ms_run[2]:scan=2671 31.672 2 1479.7858 1479.7858 K R 29 43 PSM GLMAGGRPEGQYSEDEDTDTDEYK 37 sp|Q9NPQ8-2|RIC8A_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510 ms_run[2]:scan=2040 26.982 3 2826.1852 2826.1852 R E 418 442 PSM GVVDSDDLPLNVSR 38 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 1-UNIMOD:510 ms_run[2]:scan=3578 38.607 2 1518.8102 1518.8102 K E 435 449 PSM SVTEQGAELSNEER 39 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 1-UNIMOD:510 ms_run[2]:scan=1450 22.616 2 1581.7695 1581.7695 K N 28 42 PSM TAFQEALDAAGDK 40 sp|P10599-2|THIO_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 32.0 1-UNIMOD:510,13-UNIMOD:510 ms_run[2]:scan=3140 35.201 2 1403.7569 1403.7569 K L 9 22 PSM DSSDDWEIPDGQITVGQR 41 sp|P15056|BRAF_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 1-UNIMOD:510,3-UNIMOD:21 ms_run[2]:scan=5029 51.607 2 2130.9319 2130.9319 R I 445 463 PSM EVDEQMLNVQNK 42 sp|P07437|TBB5_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 1-UNIMOD:510,12-UNIMOD:510 ms_run[2]:scan=2553 30.788 2 1513.8083 1513.8083 K N 325 337 PSM IVRGDQPAASGDSDDDEPPPLPR 43 sp|O00264-2|PGRC1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 1-UNIMOD:510,13-UNIMOD:21 ms_run[2]:scan=2350 29.293 3 2517.1597 2517.1597 K L 45 68 PSM LIAPVAEEEATVPNNK 44 sp|P07195|LDHB_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 1-UNIMOD:510,16-UNIMOD:510 ms_run[2]:scan=2781 32.499 2 1762.0149 1762.0149 K I 8 24 PSM NQVALNPQNTVFDAK 45 sp|P0DMV8-2|HS71A_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510 ms_run[2]:scan=3344 36.817 2 1805.9349 1805.9349 K R 57 72 PSM TAVVVGTITDDVR 46 sp|Q07020-2|RL18_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 1-UNIMOD:510,7-UNIMOD:21 ms_run[2]:scan=3559 38.468 2 1458.7543 1458.7543 K V 50 63 PSM VAAAPDEDLDGDDEDDAEDENNIDNR 47 sp|Q9BXV9|GON7_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 31.0 1-UNIMOD:510 ms_run[2]:scan=2663 31.613 3 2865.1757 2865.1757 R T 60 86 PSM DLADELALVDVIEDK 48 sp|P00338-4|LDHA_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 30.0 1-UNIMOD:510,15-UNIMOD:510 ms_run[2]:scan=6262 67.947 2 1724.972 1724.9720 K L 43 58 PSM ELISNASDALDK 49 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 30.0 1-UNIMOD:510,12-UNIMOD:510 ms_run[2]:scan=2622 31.299 2 1342.7616 1342.7616 R I 42 54 PSM NQLTSNPENTVFDAK 50 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 30.0 1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510 ms_run[2]:scan=2949 33.767 2 1824.8931 1824.8931 K R 82 97 PSM SAADSISESVPVGPK 51 sp|P45974-2|UBP5_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 30.0 1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510 ms_run[2]:scan=2845 32.994 2 1590.8179 1590.8179 R V 756 771 PSM SEDYVDIVQGNR 52 sp|O00469-3|PLOD2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 30.0 1-UNIMOD:510 ms_run[2]:scan=3037 34.419 2 1427.7105 1427.7105 R V 101 113 PSM VHNDAQSFDYDHDAFLGAEEAK 53 sp|O43852-2|CALU_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 30.0 1-UNIMOD:510,7-UNIMOD:21,22-UNIMOD:510 ms_run[2]:scan=3576 38.593 3 2626.165 2626.1650 K T 38 60 PSM NLFEDQNTLTSICEK 54 sp|P55060|XPO2_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 30.0 1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:510 ms_run[1]:scan=4474 46.225595 2 1958.9303 1958.9328 K V 332 347 PSM AELFTQSCADLDK 55 sp|Q01082-3|SPTB2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:4,13-UNIMOD:510 ms_run[2]:scan=3684 39.497 2 1644.7743 1644.7743 K W 1369 1382 PSM AFLAELEQNSPK 56 sp|Q9UPN3-4|MACF1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510 ms_run[2]:scan=4009 42.155 2 1493.7803 1493.7803 K I 2424 2436 PSM DAGTIAGLNVMR 57 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 1-UNIMOD:510,4-UNIMOD:21 ms_run[2]:scan=4442 45.965 2 1330.6529 1330.6529 K I 186 198 PSM DNLTLWTSDQQDDDGGEGNN 58 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 1-UNIMOD:510 ms_run[2]:scan=5121 52.511 2 2226.9361 2226.9361 R - 228 248 PSM GSTMEEELENITTK 59 sp|P47712|PA24A_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 1-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:510 ms_run[2]:scan=4209 43.895 2 1728.8165 1728.8165 R H 414 428 PSM IRAEEEDLAAVPFLASDNEEEEDEK 60 sp|O95714|HERC2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510 ms_run[2]:scan=4900 50.234 3 2995.386 2995.3860 R G 2913 2938 PSM KEESEESDDDMGFGLFD 61 sp|P05386-2|RLA1_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 1-UNIMOD:510,11-UNIMOD:35 ms_run[2]:scan=4283 44.52 2 2032.8732 2032.8732 K - 73 90 PSM LQDTYNLDTDTISK 62 sp|P13674-3|P4HA1_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510 ms_run[2]:scan=3280 36.32 2 1773.871 1773.8710 R G 137 151 PSM NLFEDQNTLTSICEK 63 sp|P55060-4|XPO2_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:510 ms_run[2]:scan=4474 46.226 2 1958.9333 1958.9333 K V 276 291 PSM QSLGELIGTLNAAK 64 sp|P60174-3|TPIS_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 29.0 1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510 ms_run[2]:scan=4609 47.533 2 1561.8753 1561.8753 K V 57 71 PSM DSSDDWEIPDGQITVGQR 65 sp|P15056|BRAF_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 29.0 1-UNIMOD:510,2-UNIMOD:21 ms_run[1]:scan=5029 51.606521666666666 2 2130.9269 2130.9314 R I 445 463 PSM NLEPEWAAAASEVK 66 sp|Q15084|PDIA6_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 29.0 1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510 ms_run[1]:scan=4409 45.672959999999996 2 1662.835053 1661.833838 K E 195 209 PSM AVTEQGAELSNEER 67 sp|P27348|1433T_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 1-UNIMOD:510 ms_run[2]:scan=1337 21.775 2 1565.7745 1565.7745 K N 28 42 PSM DINAYNCEEPTEK 68 sp|P30041|PRDX6_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 1-UNIMOD:510,7-UNIMOD:4,13-UNIMOD:510 ms_run[2]:scan=1989 26.605 2 1649.7879 1649.7879 K L 85 98 PSM DQGTYEDYVEGLR 69 sp|P60660-2|MYL6_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 1-UNIMOD:510 ms_run[2]:scan=4150 43.378 2 1577.7422 1577.7422 K V 82 95 PSM EAAENSLVAYK 70 sp|P62258-2|1433E_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510 ms_run[2]:scan=2212 28.241 2 1341.6854 1341.6854 K A 121 132 PSM EEASDYLELDTIK 71 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 1-UNIMOD:510,13-UNIMOD:510 ms_run[2]:scan=4181 43.661 2 1592.8458 1592.8458 K N 253 266 PSM EFGATECINPQDFSK 72 sp|P11766|ADHX_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4,15-UNIMOD:510 ms_run[2]:scan=4230 44.067 2 1889.8543 1889.8543 K P 234 249 PSM ISSLLEEQFQQGK 73 sp|P62241|RS8_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510 ms_run[2]:scan=4030 42.315 2 1653.8651 1653.8651 K L 158 171 PSM LQDTYNLDTDTISK 74 sp|P13674-3|P4HA1_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 1-UNIMOD:510,4-UNIMOD:21,14-UNIMOD:510 ms_run[2]:scan=3482 37.845 2 1773.871 1773.8710 R G 137 151 PSM VADWTGATYQDK 75 sp|O15371-2|EIF3D_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 28.0 1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:510 ms_run[2]:scan=2638 31.416 2 1501.7127 1501.7127 K R 42 54 PSM TLTIVDTGIGMTK 76 sp|Q58FG1|HS904_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 28.0 1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35,13-UNIMOD:510 ms_run[1]:scan=3712 39.707836666666665 2 1512.812862 1512.814683 R A 28 41 PSM GVVDSEDLPLNISR 77 sp|P07900|HS90A_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 28.0 1-UNIMOD:510,5-UNIMOD:21 ms_run[1]:scan=4496 46.44779166666667 2 1626.806071 1626.807835 R E 387 401 PSM EDGLAQQQTQLNLR 78 sp|P49327|FAS_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 28.0 1-UNIMOD:510,9-UNIMOD:21 ms_run[1]:scan=2868 33.16379833333333 2 1727.8452 1726.8462 K S 2207 2221 PSM SRSPTPPSSAGLGSNSAPPIPDSR 79 sp|Q8IWX8|CHERP_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 28.0 1-UNIMOD:510,3-UNIMOD:21 ms_run[1]:scan=2585 31.022305 3 2448.1801 2448.1853 R L 815 839 PSM ADVQSIIGLQR 80 sp|Q13263-2|TIF1B_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 1-UNIMOD:510,5-UNIMOD:21 ms_run[2]:scan=4553 46.984 2 1312.6964 1312.6964 K F 698 709 PSM ELTEEKESAFEFLSSA 81 sp|P40925-2|MDHC_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 1-UNIMOD:510,6-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:21 ms_run[2]:scan=5499 57.254 2 2043.9003 2043.9003 K - 230 246 PSM ELTVSNNDINEAGVR 82 sp|P13489|RINI_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 1-UNIMOD:510,3-UNIMOD:21 ms_run[2]:scan=2967 33.901 2 1743.8253 1743.8253 K V 174 189 PSM GFCYVEFDEVDSLK 83 sp|Q15056-2|IF4H_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 1-UNIMOD:510,3-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:510 ms_run[2]:scan=5229 53.734 2 1854.8424 1854.8424 K E 83 97 PSM KEESEESDDDMGFGLFD 84 sp|P05386-2|RLA1_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 1-UNIMOD:510 ms_run[2]:scan=5042 51.706 2 2016.8783 2016.8783 K - 73 90 PSM NNSGEEFDCAFR 85 sp|Q08J23-3|NSUN2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 1-UNIMOD:510,9-UNIMOD:4 ms_run[2]:scan=2637 31.409 2 1478.6309 1478.6309 R L 355 367 PSM QLGQDLLNSYIENEGK 86 sp|O95757|HS74L_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 1-UNIMOD:510,9-UNIMOD:21,16-UNIMOD:510 ms_run[2]:scan=5116 52.471 2 1967.9878 1967.9878 R M 591 607 PSM SVPTSTVFYPSDGVATEK 87 sp|P29401|TKT_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 1-UNIMOD:510,16-UNIMOD:21,18-UNIMOD:510 ms_run[2]:scan=3897 41.246 2 2032.0078 2032.0078 R A 439 457 PSM TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH 88 sp|P54105|ICLN_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 1-UNIMOD:510 ms_run[2]:scan=4635 47.73 3 3490.5054 3490.5054 R - 207 238 PSM VERADGYEPPVQESV 89 sp|P61247|RS3A_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 27.0 1-UNIMOD:510,14-UNIMOD:21 ms_run[2]:scan=2720 32.041 2 1787.8191 1787.8191 K - 250 265 PSM ELTEEKESAFEFLSSA 90 sp|P40925|MDHC_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 27.0 1-UNIMOD:510,6-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:21 ms_run[1]:scan=5499 57.253530000000005 2 2043.897255 2043.900337 K - 319 335 PSM EALTYDGALLGDR 91 sp|Q15056-2|IF4H_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 1-UNIMOD:510 ms_run[2]:scan=3705 39.655 2 1426.7516 1426.7516 K S 97 110 PSM EGEDGDQPTTPPKPLK 92 sp|P18858-2|DNLI1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:510,16-UNIMOD:510 ms_run[2]:scan=1455 22.654 3 1889.9872 1889.9872 K T 174 190 PSM ELISNSSDALDK 93 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510 ms_run[2]:scan=2568 30.898 2 1438.7229 1438.7229 R I 47 59 PSM ETVSEESNVLCLSK 94 sp|P13639|EF2_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:4,14-UNIMOD:510 ms_run[2]:scan=3636 39.068 2 1741.8482 1741.8482 R S 581 595 PSM ETVSEESNVLCLSKSPNK 95 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510,15-UNIMOD:21,18-UNIMOD:510 ms_run[2]:scan=3026 34.339 3 2202.134 2202.1340 R H 581 599 PSM FLEESVSMSPEER 96 sp|P15374|UCHL3_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 1-UNIMOD:510,5-UNIMOD:21 ms_run[2]:scan=3518 38.131 2 1652.7217 1652.7217 K A 122 135 PSM GLMAGGRPEGQYSEDEDTDTDEYK 97 sp|Q9NPQ8-2|RIC8A_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510 ms_run[2]:scan=2490 30.321 3 2810.1902 2810.1902 R E 418 442 PSM HELQANCYEEVK 98 sp|P23528|COF1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510 ms_run[2]:scan=1319 21.641 2 1586.8035 1586.8035 K D 133 145 PSM SVTEQGAELSNEER 99 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 1-UNIMOD:510,1-UNIMOD:21 ms_run[2]:scan=1826 25.395 2 1661.7358 1661.7358 K N 28 42 PSM TATEEWGTEDWNEDLSETK 100 sp|Q14157-4|UBP2L_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:21,19-UNIMOD:510 ms_run[2]:scan=5142 52.741 2 2467.9982 2467.9982 R I 232 251 PSM YEQGTGCWQGPNR 101 sp|P14314-2|GLU2B_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 26.0 1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4 ms_run[2]:scan=1954 26.354 2 1665.6819 1665.6819 K S 462 475 PSM TLTIVDTGIGMTK 102 sp|Q58FG1|HS904_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 26.0 1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:510 ms_run[1]:scan=4704 48.30412166666667 2 1576.784836 1576.786099 R A 28 41 PSM TATEEWGTEDWNEDLSETK 103 sp|Q14157|UBP2L_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 26.0 1-UNIMOD:510,1-UNIMOD:21,16-UNIMOD:21,19-UNIMOD:510 ms_run[1]:scan=5142 52.74133833333333 2 2467.9946 2467.9977 R I 239 258 PSM SGTPPRQGSITSPQANEQSVTPQR 104 sp|Q9UQ35|SRRM2_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 26.0 1-UNIMOD:510,9-UNIMOD:21 ms_run[1]:scan=1692 24.412306666666666 3 2636.2699 2636.2763 K R 846 870 PSM AILVDLEPGTMDSVR 105 sp|P07437|TBB5_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:35 ms_run[2]:scan=4511 46.576 2 1744.8531 1744.8531 R S 63 78 PSM DNNQFASASLDR 106 sp|P35606-2|COPB2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510 ms_run[2]:scan=2213 28.248 2 1370.6639 1370.6639 K T 125 137 PSM DVIELTDDSFDK 107 sp|Q15084-3|PDIA6_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510,12-UNIMOD:510 ms_run[2]:scan=4390 45.517 2 1463.7668 1463.7668 K N 158 170 PSM EGMNIVEAMER 108 sp|P62937-2|PPIA_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510 ms_run[2]:scan=3885 41.155 2 1311.6375 1311.6375 K F 74 85 PSM EQVANSAFVER 109 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510 ms_run[2]:scan=1647 24.083 2 1282.673 1282.6730 K V 492 503 PSM FLEESVSMSPEER 110 sp|P15374|UCHL3_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:35 ms_run[2]:scan=2604 31.166 2 1668.7166 1668.7166 K A 122 135 PSM GSTDNLMDDIER 111 sp|P50990-3|TCPQ_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510 ms_run[2]:scan=3434 37.483 2 1398.6509 1398.6509 R A 306 318 PSM LQIQCVVEDDK 112 sp|P29692-4|EF1D_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510,5-UNIMOD:4,11-UNIMOD:510 ms_run[2]:scan=3083 34.766 2 1413.781 1413.7810 K V 224 235 PSM RDSSDDWEIPDGQITVGQR 113 sp|P15056|BRAF_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510,3-UNIMOD:21 ms_run[2]:scan=4197 43.778 3 2287.033 2287.0330 R I 444 463 PSM SGTPPRQGSITSPQANEQSVTPQR 114 sp|Q9UQ35-2|SRRM2_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510,3-UNIMOD:21 ms_run[2]:scan=1692 24.412 3 2636.2768 2636.2768 K R 846 870 PSM YALYDATYETK 115 sp|P23528|COF1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510,11-UNIMOD:510 ms_run[2]:scan=2905 33.439 2 1404.7449 1404.7449 R E 82 93 PSM YSDTTDSDPENEPFDEDQHTQITKV 116 sp|P60484|PTEN_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 25.0 1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:21,24-UNIMOD:510 ms_run[2]:scan=3929 41.528 3 3138.2904 3138.2904 R - 379 404 PSM GVVDSEDLPLNISR 117 sp|P08238|HS90B_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 25.0 1-UNIMOD:510 ms_run[1]:scan=3974 41.8782 2 1546.8392 1546.8410 R E 379 393 PSM NQVAMNPTNTVFDAK 118 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 25.0 1-UNIMOD:510,5-UNIMOD:35,10-UNIMOD:21,15-UNIMOD:510 ms_run[1]:scan=2416 29.773201666666665 2 1812.871422 1812.875386 K R 57 72 PSM EVFEDAAEIR 119 sp|P19338|NUCL_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 25.0 1-UNIMOD:510 ms_run[1]:scan=2735 32.15530833333333 2 1212.6262 1211.6242 K L 411 421 PSM AGFAGDDAPR 120 sp|P63261|ACTG_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510 ms_run[2]:scan=1108 20.017 2 1009.5041 1009.5041 K A 19 29 PSM AGGIETIANEYSDR 121 sp|P34932|HSP74_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510 ms_run[2]:scan=3199 35.687 2 1528.7582 1528.7582 R C 20 34 PSM CSGPGLSPGMVR 122 sp|P21333-2|FLNA_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:21 ms_run[2]:scan=2712 31.982 2 1330.5987 1330.5987 K A 1453 1465 PSM DAGTIAGLNVLR 123 sp|P11142-2|HSP7C_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,4-UNIMOD:21 ms_run[2]:scan=4877 50.001 2 1312.6964 1312.6964 K I 160 172 PSM DSSTSPGDYVLSVSENSR 124 sp|P46108-2|CRK_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,5-UNIMOD:21 ms_run[2]:scan=4434 45.906 2 2012.8788 2012.8788 R V 39 57 PSM EFDGKSLVSVTK 125 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,5-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:21,12-UNIMOD:510 ms_run[2]:scan=3545 38.363 2 1570.8145 1570.8145 K E 527 539 PSM ESEDKPEIEDVGSDEEEEKK 126 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510,20-UNIMOD:510 ms_run[2]:scan=1579 23.585 4 2456.2603 2456.2603 K D 251 271 PSM EVDEQMLNVQNK 127 sp|P07437|TBB5_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510 ms_run[2]:scan=1592 23.679 2 1529.8032 1529.8032 K N 325 337 PSM GATQQILDEAER 128 sp|P78371-2|TCPB_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510 ms_run[2]:scan=2318 29.056 2 1363.7156 1363.7156 R S 330 342 PSM GVQVETISPGDGR 129 sp|P62942|FKB1A_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,6-UNIMOD:21 ms_run[2]:scan=2117 27.541 2 1427.687 1427.6870 M T 2 15 PSM GWLRDPSASPGDAGEQAIR 130 sp|P18206-2|VINC_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,9-UNIMOD:21 ms_run[2]:scan=3184 35.577 3 2095.99 2095.9900 K Q 282 301 PSM KEESEESDDDMGFGLFD 131 sp|P05386-2|RLA1_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,7-UNIMOD:21 ms_run[2]:scan=5541 57.878 2 2096.8446 2096.8446 K - 73 90 PSM LYSILQGDSPTK 132 sp|O15042-3|SR140_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510 ms_run[2]:scan=3717 39.744 2 1468.7851 1468.7851 K W 68 80 PSM NDSWGSFDLR 133 sp|Q7Z417|NUFP2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,3-UNIMOD:21 ms_run[2]:scan=4604 47.496 2 1309.5552 1309.5552 R A 650 660 PSM NQVAMNPTNTVFDAK 134 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:21,15-UNIMOD:510 ms_run[2]:scan=2416 29.773 2 1812.8754 1812.8754 K R 57 72 PSM SADTLWGIQK 135 sp|P00338-4|LDHA_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510 ms_run[2]:scan=4158 43.436 2 1265.6693 1265.6693 K E 261 271 PSM TVIIEQSWGSPK 136 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510 ms_run[2]:scan=3780 40.318 2 1491.8011 1491.8011 R V 61 73 PSM YVGVSSDSVGGFR 137 sp|Q14677|EPN4_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 24.0 1-UNIMOD:510,8-UNIMOD:21 ms_run[2]:scan=3141 35.208 2 1442.6655 1442.6655 K Y 159 172 PSM DSSTSPGDYVLSVSENSR 138 sp|P46108|CRK_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 24.0 1-UNIMOD:510,2-UNIMOD:21 ms_run[1]:scan=4434 45.90559 2 2012.8761 2012.8783 R V 39 57 PSM LQDTYNLDTDTISK 139 sp|P13674|P4HA1_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 24.0 1-UNIMOD:510,13-UNIMOD:21,14-UNIMOD:510 ms_run[1]:scan=3280 36.31974 2 1773.866354 1773.871012 R G 137 151 PSM DLEAEHVEVEDTTLNR 140 sp|Q9H3K6-2|BOLA2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510 ms_run[2]:scan=2980 33.997 3 1902.9383 1902.9383 R C 15 31 PSM DLGTESQIFISR 141 sp|P50395-2|GDIB_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,6-UNIMOD:21 ms_run[2]:scan=4517 46.623 2 1478.723 1478.7230 K T 346 358 PSM DVNAAIATIK 142 sp|Q9BQE3|TBA1C_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510 ms_run[2]:scan=2808 32.699 2 1162.6635 1162.6635 K T 327 337 PSM DYEEVGADSADGEDEGEEY 143 sp|Q9BQE3|TBA1C_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,9-UNIMOD:21 ms_run[2]:scan=3853 40.887 2 2191.7691 2191.7691 K - 431 450 PSM FNVWDTAGQEK 144 sp|P62826|RAN_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510 ms_run[2]:scan=3731 39.86 2 1441.6915 1441.6915 K F 61 72 PSM GFGFGQGAGALVHSE 145 sp|P21291|CSRP1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,14-UNIMOD:21 ms_run[2]:scan=4294 44.605 2 1546.703 1546.7030 K - 179 194 PSM HRDYETATLSDIK 146 sp|O43707|ACTN4_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,6-UNIMOD:21,13-UNIMOD:510 ms_run[2]:scan=1965 26.433 2 1695.8505 1695.8506 K A 438 451 PSM HVPDSGATATAYLCGVK 147 sp|P10696|PPBN_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510 ms_run[2]:scan=3290 36.395 2 1893.9332 1893.9332 K G 107 124 PSM LFGNMEGDCPSDWKTDSTCR 148 sp|P02786|TFR1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,9-UNIMOD:4,14-UNIMOD:510,17-UNIMOD:21,19-UNIMOD:4 ms_run[2]:scan=3612 38.864 3 2523.0542 2523.0542 K M 345 365 PSM LTWHSCPEDEAQ 149 sp|Q13185|CBX3_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,6-UNIMOD:4 ms_run[2]:scan=2246 28.493 2 1505.6669 1505.6669 R - 172 184 PSM LYFEELSLER 150 sp|P31327-2|CPSM_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 ms_run[2]:scan=4554 46.991 2 1297.6554 1297.6554 K I 579 589 PSM NEQDAYAINSYTR 151 sp|P24752|THIL_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,10-UNIMOD:21 ms_run[2]:scan=2623 31.307 2 1657.7197 1657.7197 R S 209 222 PSM NVIGLQMGTNR 152 sp|P37802|TAGL2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,9-UNIMOD:21 ms_run[2]:scan=3314 36.591 2 1315.6532 1315.6532 K G 172 183 PSM QEYDESGPSIVHR 153 sp|P63261|ACTG_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510 ms_run[2]:scan=1481 22.845 3 1549.7585 1549.7585 K K 360 373 PSM QLENSLNEFGEK 154 sp|P26639|SYTC_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510 ms_run[2]:scan=3032 34.384 2 1554.7603 1554.7603 K W 518 530 PSM RALANSLACQGK 155 sp|P04075|ALDOA_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4,12-UNIMOD:510 ms_run[2]:scan=1149 20.334 2 1435.7643 1435.7643 K Y 331 343 PSM SFDDPIVQTER 156 sp|O95757|HS74L_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,9-UNIMOD:21 ms_run[2]:scan=3197 35.673 2 1419.6495 1419.6495 R I 74 85 PSM SLGLSLSGGDQEDAGR 157 sp|Q9UJ70|NAGK_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,7-UNIMOD:21 ms_run[2]:scan=3720 39.765 2 1674.7674 1674.7674 R I 70 86 PSM SRSPTPPSSAGLGSNSAPPIPDSR 158 sp|Q8IWX8|CHERP_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,5-UNIMOD:21 ms_run[2]:scan=2585 31.022 3 2448.1858 2448.1858 R L 815 839 PSM STLTDSLVCK 159 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4,10-UNIMOD:510 ms_run[2]:scan=2704 31.923 2 1270.6516 1270.6516 K A 33 43 PSM TATEEWGTEDWNEDLSETK 160 sp|Q14157-4|UBP2L_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,1-UNIMOD:21,18-UNIMOD:21,19-UNIMOD:510 ms_run[2]:scan=5140 52.725 3 2467.9982 2467.9982 R I 232 251 PSM TCSDSEDIGSSECSDTDSEEQGDHARPK 161 sp|Q9BRS2|RIOK1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510 ms_run[2]:scan=1095 19.915 4 3246.2875 3246.2875 R K 494 522 PSM TLEEDEEELFK 162 sp|P43487-2|RANG_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,11-UNIMOD:510 ms_run[2]:scan=3644 39.166 2 1448.7559 1448.7559 K M 40 51 PSM TLGRRDSSDDWEIPDGQITVGQR 163 sp|P15056|BRAF_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,7-UNIMOD:21 ms_run[2]:scan=3820 40.619 3 2714.2874 2714.2874 K I 440 463 PSM TTPSYVAFTDTER 164 sp|P11142-2|HSP7C_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,9-UNIMOD:21 ms_run[2]:scan=3355 36.897 2 1600.7234 1600.7234 R L 37 50 PSM TWNDPSVQQDIK 165 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510 ms_run[2]:scan=2890 33.329 2 1577.7763 1577.7763 R F 102 114 PSM TYDATTHFETTCDDIK 166 sp|P50395-2|GDIB_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 23.0 1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510 ms_run[2]:scan=2616 31.255 3 2064.9024 2064.9024 R N 358 374 PSM VEIIANDQGNR 167 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 23.0 1-UNIMOD:510 ms_run[1]:scan=1480 22.838541666666664 2 1262.6832 1261.6832 R I 50 61 PSM TVIIEQSWGSPK 168 sp|P10809|CH60_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 23.0 1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510 ms_run[1]:scan=3780 40.318108333333335 2 1491.799345 1491.801081 R V 61 73 PSM DFTPVCTTELGR 169 sp|P30041|PRDX6_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510,6-UNIMOD:4,7-UNIMOD:21 ms_run[2]:scan=3766 40.169 2 1508.6795 1508.6795 R A 42 54 PSM DLIHDQDEDEEEEEGQR 170 sp|Q9UNZ2-4|NSF1C_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510 ms_run[2]:scan=1872 25.735 3 2118.9038 2118.9038 R F 77 94 PSM EDGAISTIVLR 171 sp|P50990-3|TCPQ_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510,6-UNIMOD:21 ms_run[2]:scan=3751 40.026 2 1286.6695 1286.6696 K G 295 306 PSM EQISDIDDAVR 172 sp|P53999|TCP4_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510 ms_run[2]:scan=2557 30.818 2 1293.6625 1293.6625 K K 115 126 PSM ESVPEFPLSPPK 173 sp|P16949|STMN1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510 ms_run[2]:scan=4386 45.485 2 1473.7793 1473.7793 K K 30 42 PSM EVAAFAQFGSDLDAATQQLLSR 174 sp|P25705-2|ATPA_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 ms_run[2]:scan=6334 68.979 3 2337.1601 2337.1601 R G 392 414 PSM GDRSEDFGVNEDLADSDAR 175 sp|P04083|ANXA1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510 ms_run[2]:scan=2734 32.148 3 2100.9408 2100.9408 K A 186 205 PSM HGYIGEFEIIDDHR 176 sp|P62244|RS15A_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510 ms_run[2]:scan=3456 37.647 3 1733.8586 1733.8586 K A 44 58 PSM IGSGSFGTVYK 177 sp|P15056|BRAF_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21,11-UNIMOD:510 ms_run[2]:scan=3574 38.578 2 1342.6248 1342.6248 R G 463 474 PSM IWEQIQPDLHTNDECVATYK 178 sp|Q12904|AIMP1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510,15-UNIMOD:4,18-UNIMOD:21,20-UNIMOD:510 ms_run[2]:scan=3884 41.148 3 2607.2353 2607.2353 K G 270 290 PSM KPATPAEDDEDDDIDLFGSDNEEEDK 179 sp|P29692-4|EF1D_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510 ms_run[2]:scan=4040 42.393 3 3090.3451 3090.3451 K E 125 151 PSM NLFEDQNTLTSICEK 180 sp|P55060-4|XPO2_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:510 ms_run[2]:scan=4610 47.54 2 1958.9333 1958.9333 K V 276 291 PSM SGETEDTFIADLVVGLCTGQIK 181 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 17-UNIMOD:4 ms_run[2]:scan=6485 71.57 3 2352.1519 2352.1519 R T 373 395 PSM SIYYITGESK 182 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510,10-UNIMOD:510 ms_run[2]:scan=2602 31.152 2 1227.7023 1227.7023 K E 482 492 PSM SLVESVSSSPNK 183 sp|Q9H2U2-4|IPYR2_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510 ms_run[2]:scan=1794 25.162 2 1380.7174 1380.7174 R E 143 155 PSM VEVTEFEDIK 184 sp|Q01105-3|SET_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510,10-UNIMOD:510 ms_run[2]:scan=3593 38.722 2 1275.7235 1275.7235 R S 98 108 PSM VNDGVCDCCDGTDEYNSGVICENTCK 185 sp|P14314-2|GLU2B_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 22.0 1-UNIMOD:510,6-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4,21-UNIMOD:4,25-UNIMOD:4,26-UNIMOD:510 ms_run[2]:scan=2815 32.754 3 3108.2512 3108.2512 R E 92 118 PSM ATAGDTHLGGEDFDNR 186 sp|P0DMV8|HS71A_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 22.0 1-UNIMOD:510 ms_run[1]:scan=1612 23.826173333333333 3 1708.7836 1708.7860 K L 221 237 PSM NLFEDQNTLTSICEK 187 sp|P55060|XPO2_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 22.0 1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:510 ms_run[1]:scan=4610 47.5404 2 1958.9294 1958.9328 K V 332 347 PSM TTPSYVAFTDTER 188 sp|P0DMV8|HS71A_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 22.0 1-UNIMOD:510,11-UNIMOD:21 ms_run[1]:scan=3355 36.89716833333333 2 1600.720594 1600.723437 R L 37 50 PSM DLSLEEIQK 189 sp|P16949|STMN1_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510,9-UNIMOD:510 ms_run[2]:scan=3347 36.84 2 1141.6867 1141.6867 K K 44 53 PSM DLTDYLMK 190 sp|P63261|ACTG_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510,7-UNIMOD:35,8-UNIMOD:510 ms_run[2]:scan=3940 41.627 2 1081.6002 1081.6002 R I 184 192 PSM DYTYEELLNR 191 sp|P20042|IF2B_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510 ms_run[2]:scan=4280 44.484 2 1348.6723 1348.6723 R V 173 183 PSM EGLELPEDEEEK 192 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510,12-UNIMOD:510 ms_run[2]:scan=2711 31.975 2 1483.7566 1483.7566 K K 539 551 PSM EITALAPSTMK 193 sp|P63261|ACTG_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:35,11-UNIMOD:510 ms_run[2]:scan=2184 28.033 2 1324.6986 1324.6986 K I 316 327 PSM EQFLDGDGWTSR 194 sp|P27797|CALR_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510 ms_run[2]:scan=3646 39.18 2 1443.6843 1443.6843 K W 25 37 PSM IGSGSFGTVYK 195 sp|P15056|BRAF_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21,11-UNIMOD:510 ms_run[2]:scan=3747 39.996 2 1342.6248 1342.6248 R G 463 474 PSM ISDSVLVDIK 196 sp|P48643-2|TCPE_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510 ms_run[2]:scan=4402 45.62 2 1235.7051 1235.7051 K D 58 68 PSM LMIEMDGTENK 197 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510 ms_run[2]:scan=3447 37.578 2 1427.6714 1427.6714 K S 93 104 PSM RLSQSDEDVIR 198 sp|Q9H7D7-3|WDR26_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510,3-UNIMOD:21 ms_run[2]:scan=1657 24.156 2 1430.6979 1430.6979 K L 119 130 PSM SLYESFVSSSDR 199 sp|P18615|NELFE_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510,5-UNIMOD:21 ms_run[2]:scan=3806 40.515 2 1489.655 1489.6550 K L 131 143 PSM TPVDESDDEIQHDEIPTGK 200 sp|Q86TC9-2|MYPN_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001583, MaxQuant, ] 21.0 1-UNIMOD:510,6-UNIMOD:21,19-UNIMOD:510 ms_run[2]:scan=2581 30.993 3 2272.0421 2272.0421 R C 648 667 PSM NTGIICTIGPASR 201 sp|P14618|KPYM_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 21.0 1-UNIMOD:510,6-UNIMOD:4,7-UNIMOD:21 ms_run[1]:scan=2957 33.828965000000004 2 1472.7250 1472.7266 R S 44 57 PSM TTGDKTVEAPLVTEEK 202 sp|Q96T58|MINT_HUMAN 1 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1001476, X!Tandem, ] 21.0 1-UNIMOD:21,5-UNIMOD:510,6-UNIMOD:21,13-UNIMOD:21 ms_run[1]:scan=6236 67.64965 2 1991.8632 1990.8402 K T 1657 1673 PSM SVPTSTVFYPSDGVATEK 203 sp|P29401|TKT_HUMAN 0 userFasta.sprot_human_20211018 userFasta.sprot_human_20211018 [MS, MS:1002251, Comet, ] 21.0 1-UNIMOD:510,11-UNIMOD:21,18-UNIMOD:510 ms_run[1]:scan=3897 41.24578833333333 2 2032.004252 2032.007839 R A 439 457