MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100628_017JNK3_MAPK10.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100628_017JNK3_MAPK10.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q13409-6|DC1I2_HUMAN	Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	52.0	null	86-UNIMOD:510,89-UNIMOD:21	0.04	52.0	1	1	0
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	49.0	null	92-UNIMOD:510,94-UNIMOD:21	0.03	49.0	1	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	203-UNIMOD:510,205-UNIMOD:21,221-UNIMOD:510,257-UNIMOD:510,262-UNIMOD:510,263-UNIMOD:21,93-UNIMOD:510,103-UNIMOD:510,270-UNIMOD:510,272-UNIMOD:21,281-UNIMOD:510	0.13	42.0	4	4	4
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	228-UNIMOD:510,29-UNIMOD:510,38-UNIMOD:21,31-UNIMOD:21	0.15	42.0	6	2	0
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	104-UNIMOD:510,105-UNIMOD:4,109-UNIMOD:21,121-UNIMOD:510	0.04	42.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	230-UNIMOD:510,241-UNIMOD:21,232-UNIMOD:21,230-UNIMOD:21	0.04	42.0	5	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	284-UNIMOD:510,287-UNIMOD:21,295-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	52-UNIMOD:510,62-UNIMOD:21	0.03	41.0	2	1	0
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	505-UNIMOD:510,512-UNIMOD:21,513-UNIMOD:21,516-UNIMOD:21,523-UNIMOD:21	0.04	40.0	3	1	0
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	337-UNIMOD:510,346-UNIMOD:21	0.03	40.0	2	1	0
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	333-UNIMOD:510,336-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	709-UNIMOD:510,712-UNIMOD:21,716-UNIMOD:4,726-UNIMOD:510,714-UNIMOD:21,428-UNIMOD:510,435-UNIMOD:21,442-UNIMOD:510,1099-UNIMOD:510,1103-UNIMOD:21,1289-UNIMOD:510,1296-UNIMOD:4,1297-UNIMOD:21,1302-UNIMOD:510,492-UNIMOD:510,494-UNIMOD:21,504-UNIMOD:21	0.05	39.0	6	5	4
PRT	sp|Q96K76-2|UBP47_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	811-UNIMOD:510,822-UNIMOD:21	0.01	39.0	2	1	0
PRT	sp|O00232-2|PSD12_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	311-UNIMOD:510,315-UNIMOD:21,329-UNIMOD:510	0.05	38.0	1	1	0
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	144-UNIMOD:510,147-UNIMOD:21,169-UNIMOD:510	0.10	38.0	1	1	1
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	841-UNIMOD:510,846-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	591-UNIMOD:510,599-UNIMOD:21,606-UNIMOD:510	0.02	37.0	2	1	0
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	153-UNIMOD:510,160-UNIMOD:21,167-UNIMOD:510	0.08	36.0	2	1	0
PRT	sp|Q66K74-2|MAP1S_HUMAN	Isoform 2 of Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	724-UNIMOD:510,733-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	606-UNIMOD:510,612-UNIMOD:21,616-UNIMOD:21	0.03	36.0	4	2	1
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	565-UNIMOD:510,568-UNIMOD:21,569-UNIMOD:21	0.01	36.0	2	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	684-UNIMOD:510,692-UNIMOD:21,178-UNIMOD:510,184-UNIMOD:21	0.06	36.0	2	2	2
PRT	sp|Q7Z5K2|WAPL_HUMAN	Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	380-UNIMOD:510,381-UNIMOD:35,388-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P17544-5|ATF7_HUMAN	Isoform 5 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	42-UNIMOD:510,51-UNIMOD:21,53-UNIMOD:21	0.14	36.0	3	1	0
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	608-UNIMOD:510,621-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|O15027|SC16A_HUMAN	Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	36.0	null	565-UNIMOD:510,569-UNIMOD:21	0.01	36.0	1	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	29-UNIMOD:510,41-UNIMOD:21,208-UNIMOD:510,216-UNIMOD:21	0.01	35.0	2	2	2
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	35.0	1	1	0
PRT	sp|P09496-5|CLCA_HUMAN	Isoform 5 of Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	111-UNIMOD:510,124-UNIMOD:21	0.13	34.0	2	1	0
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	2885-UNIMOD:510,2889-UNIMOD:21	0.00	34.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	228-UNIMOD:510	0.08	34.0	1	1	1
PRT	sp|P52948-4|NUP98_HUMAN	Isoform 4 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	600-UNIMOD:510,606-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	253-UNIMOD:510,265-UNIMOD:510	0.02	34.0	1	1	1
PRT	sp|Q5JSH3|WDR44_HUMAN	WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	88-UNIMOD:510,96-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P00367-2|DHE3_HUMAN	Isoform 2 of Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	233-UNIMOD:510,243-UNIMOD:21,248-UNIMOD:510	0.04	34.0	1	1	1
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	123-UNIMOD:510,130-UNIMOD:21,125-UNIMOD:35	0.05	34.0	2	1	0
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	98-UNIMOD:510,105-UNIMOD:21,108-UNIMOD:4,17-UNIMOD:510,17-UNIMOD:4,26-UNIMOD:21,31-UNIMOD:510	0.25	33.0	2	2	2
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	549-UNIMOD:510,559-UNIMOD:21,563-UNIMOD:510	0.02	33.0	1	1	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	50-UNIMOD:510,58-UNIMOD:21,61-UNIMOD:4,64-UNIMOD:510	0.12	33.0	1	1	1
PRT	sp|Q9UBK8|MTRR_HUMAN	Methionine synthase reductase OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	159-UNIMOD:510,171-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	434-UNIMOD:510,434-UNIMOD:35,443-UNIMOD:21	0.03	33.0	2	1	0
PRT	sp|Q9BTE3-2|MCMBP_HUMAN	Isoform 2 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	102-UNIMOD:510,108-UNIMOD:4,118-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	26-UNIMOD:510,38-UNIMOD:21,40-UNIMOD:21,37-UNIMOD:510,540-UNIMOD:510,549-UNIMOD:35,550-UNIMOD:510,221-UNIMOD:510	0.08	33.0	5	4	3
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	33.0	1	1	0
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	502-UNIMOD:510,507-UNIMOD:21,515-UNIMOD:21,522-UNIMOD:4,355-UNIMOD:510,363-UNIMOD:4	0.08	32.0	5	2	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	447-UNIMOD:510,447-UNIMOD:4,453-UNIMOD:21,462-UNIMOD:510,158-UNIMOD:510,160-UNIMOD:510,163-UNIMOD:21,175-UNIMOD:21,180-UNIMOD:510,159-UNIMOD:21,173-UNIMOD:21,61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510,164-UNIMOD:21	0.09	32.0	7	3	2
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	75-UNIMOD:510,84-UNIMOD:35,26-UNIMOD:510,33-UNIMOD:510	0.20	32.0	2	2	2
PRT	sp|P52701-2|MSH6_HUMAN	Isoform GTBP-alt of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	271-UNIMOD:510,292-UNIMOD:21,295-UNIMOD:510	0.02	32.0	1	1	1
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	165-UNIMOD:510,174-UNIMOD:21,178-UNIMOD:510,171-UNIMOD:21	0.05	32.0	2	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	28-UNIMOD:510,28-UNIMOD:21,30-UNIMOD:21	0.06	32.0	4	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	142-UNIMOD:510,152-UNIMOD:21,153-UNIMOD:4,157-UNIMOD:510,22-UNIMOD:510,31-UNIMOD:21,39-UNIMOD:510,11-UNIMOD:510	0.19	32.0	3	3	3
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	null	184-UNIMOD:510,190-UNIMOD:21,193-UNIMOD:21,197-UNIMOD:510	0.04	32.0	2	1	0
PRT	sp|Q96B36|AKTS1_HUMAN	Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	null	202-UNIMOD:510,212-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	208-UNIMOD:510,210-UNIMOD:21,220-UNIMOD:510	0.05	31.0	1	1	1
PRT	sp|Q99576-3|T22D3_HUMAN	Isoform 2 of TSC22 domain family protein 3 OS=Homo sapiens OX=9606 GN=TSC22D3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	32-UNIMOD:510,42-UNIMOD:21	0.10	31.0	2	1	0
PRT	sp|Q13045-2|FLII_HUMAN	Isoform 2 of Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	794-UNIMOD:510,801-UNIMOD:21,807-UNIMOD:510	0.01	31.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	411-UNIMOD:510,415-UNIMOD:4,417-UNIMOD:4,423-UNIMOD:21,431-UNIMOD:510	0.01	31.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	239-UNIMOD:510,240-UNIMOD:21,239-UNIMOD:21,249-UNIMOD:21,316-UNIMOD:510,318-UNIMOD:21,326-UNIMOD:510,19-UNIMOD:510,324-UNIMOD:21,197-UNIMOD:510	0.14	31.0	8	4	2
PRT	sp|P53779-2|MK10_HUMAN	Isoform Alpha-1 of Mitogen-activated protein kinase 10 OS=Homo sapiens OX=9606 GN=MAPK10	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	213-UNIMOD:510,221-UNIMOD:21,226-UNIMOD:21,219-UNIMOD:35,223-UNIMOD:21,275-UNIMOD:510,281-UNIMOD:21,283-UNIMOD:4,287-UNIMOD:35,288-UNIMOD:510,220-UNIMOD:35,217-UNIMOD:21,304-UNIMOD:510,304-UNIMOD:21,308-UNIMOD:21,311-UNIMOD:510	0.09	31.0	13	3	1
PRT	sp|P49023-2|PAXI_HUMAN	Isoform Alpha of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	94-UNIMOD:510,106-UNIMOD:21,108-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	86-UNIMOD:510,87-UNIMOD:21,94-UNIMOD:21	0.02	31.0	3	1	0
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	null	331-UNIMOD:510,332-UNIMOD:21,349-UNIMOD:510	0.04	31.0	1	1	0
PRT	sp|Q9BX68|HINT2_HUMAN	Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	43-UNIMOD:510,47-UNIMOD:21	0.10	30.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	42-UNIMOD:510,53-UNIMOD:510,379-UNIMOD:510,383-UNIMOD:21,292-UNIMOD:510,306-UNIMOD:510,492-UNIMOD:510,45-UNIMOD:21,527-UNIMOD:510,531-UNIMOD:510,532-UNIMOD:21,535-UNIMOD:21,538-UNIMOD:510,497-UNIMOD:21,83-UNIMOD:510,85-UNIMOD:21,89-UNIMOD:21,95-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510,457-UNIMOD:510,466-UNIMOD:35,468-UNIMOD:21,457-UNIMOD:21	0.16	30.0	14	8	3
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	29-UNIMOD:510,36-UNIMOD:21,42-UNIMOD:510,39-UNIMOD:21	0.04	30.0	3	1	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:510,9-UNIMOD:21	0.13	30.0	1	1	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	99-UNIMOD:510,104-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	139-UNIMOD:510,146-UNIMOD:21	0.10	30.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	300-UNIMOD:510,314-UNIMOD:510,251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,547-UNIMOD:510,558-UNIMOD:510,47-UNIMOD:510,52-UNIMOD:21,58-UNIMOD:510,50-UNIMOD:21,500-UNIMOD:510,192-UNIMOD:510,315-UNIMOD:510,317-UNIMOD:21,327-UNIMOD:510	0.13	30.0	9	7	6
PRT	sp|Q7Z417-2|NUFP2_HUMAN	Isoform 2 of Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	107-UNIMOD:510,115-UNIMOD:35,117-UNIMOD:21	0.13	30.0	2	1	0
PRT	sp|Q9C0F1|CEP44_HUMAN	Centrosomal protein of 44 kDa OS=Homo sapiens OX=9606 GN=CEP44 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	324-UNIMOD:510,346-UNIMOD:21,342-UNIMOD:21	0.07	30.0	2	1	0
PRT	sp|P08651-4|NFIC_HUMAN	Isoform 3 of Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	251-UNIMOD:510,271-UNIMOD:21	0.07	30.0	1	1	1
PRT	sp|O95155-2|UBE4B_HUMAN	Isoform 2 of Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	76-UNIMOD:510,88-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	74-UNIMOD:510,76-UNIMOD:21,80-UNIMOD:4	0.06	30.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	50-UNIMOD:510,62-UNIMOD:21,69-UNIMOD:21,82-UNIMOD:510,86-UNIMOD:21,96-UNIMOD:510,102-UNIMOD:510,113-UNIMOD:510,61-UNIMOD:510,85-UNIMOD:21,91-UNIMOD:21,107-UNIMOD:21,155-UNIMOD:510,163-UNIMOD:510	0.10	30.0	10	6	4
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	250-UNIMOD:510,263-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|P53779|MK10_HUMAN	Mitogen-activated protein kinase 10 OS=Homo sapiens OX=9606 GN=MAPK10 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	null	213-UNIMOD:510,219-UNIMOD:35,221-UNIMOD:21,223-UNIMOD:21,220-UNIMOD:35,217-UNIMOD:21,216-UNIMOD:21	0.03	30.0	5	1	0
PRT	sp|Q9HCD6-3|TANC2_HUMAN	Isoform 3 of Protein TANC2 OS=Homo sapiens OX=9606 GN=TANC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	161-UNIMOD:510,162-UNIMOD:4,169-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	325-UNIMOD:510,336-UNIMOD:510,330-UNIMOD:35,47-UNIMOD:510,58-UNIMOD:510,163-UNIMOD:510,164-UNIMOD:35,166-UNIMOD:21,172-UNIMOD:21,174-UNIMOD:510	0.09	29.0	4	3	2
PRT	sp|P55036-2|PSMD4_HUMAN	Isoform Rpn10E of 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	109-UNIMOD:510,115-UNIMOD:21,122-UNIMOD:510	0.06	29.0	1	1	1
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	15-UNIMOD:510,21-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	94-UNIMOD:510,101-UNIMOD:21,104-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|Q86WB0-2|NIPA_HUMAN	Isoform 2 of Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	308-UNIMOD:510,314-UNIMOD:21,322-UNIMOD:510,333-UNIMOD:510,349-UNIMOD:21	0.08	29.0	2	2	1
PRT	sp|P45983|MK08_HUMAN	Mitogen-activated protein kinase 8 OS=Homo sapiens OX=9606 GN=MAPK8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	null	175-UNIMOD:510,182-UNIMOD:35,183-UNIMOD:21,185-UNIMOD:21	0.04	29.0	1	1	0
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	241-UNIMOD:510,258-UNIMOD:21,273-UNIMOD:510	0.08	29.0	1	1	0
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	1203-UNIMOD:510,1211-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q9NPI6-2|DCP1A_HUMAN	Isoform 2 of mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	483-UNIMOD:510,485-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	3492-UNIMOD:510,3504-UNIMOD:21	0.00	28.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	871-UNIMOD:510,886-UNIMOD:21,734-UNIMOD:510,737-UNIMOD:21,744-UNIMOD:4	0.03	28.0	2	2	2
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	90-UNIMOD:510,97-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|P43121|MUC18_HUMAN	Cell surface glycoprotein MUC18 OS=Homo sapiens OX=9606 GN=MCAM PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	98-UNIMOD:510,107-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	8-UNIMOD:510,23-UNIMOD:510,320-UNIMOD:510,323-UNIMOD:21,329-UNIMOD:510,320-UNIMOD:21,300-UNIMOD:510,303-UNIMOD:21,308-UNIMOD:510	0.11	28.0	5	3	2
PRT	sp|Q8N1F7-2|NUP93_HUMAN	Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	295-UNIMOD:510,299-UNIMOD:4,307-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	296-UNIMOD:510,313-UNIMOD:21,316-UNIMOD:35,107-UNIMOD:510,119-UNIMOD:21	0.10	28.0	2	2	2
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	207-UNIMOD:510,223-UNIMOD:21	0.14	28.0	1	1	1
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	null	68-UNIMOD:510,76-UNIMOD:21	0.08	28.0	1	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	null	20-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	0.03	28.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	65-UNIMOD:510,75-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|O75674-2|TM1L1_HUMAN	Isoform 2 of TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	302-UNIMOD:510,321-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|Q99873-5|ANM1_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	271-UNIMOD:510,274-UNIMOD:4,277-UNIMOD:21,278-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	374-UNIMOD:510,383-UNIMOD:21,2261-UNIMOD:510,2272-UNIMOD:21,384-UNIMOD:21,1101-UNIMOD:510,1103-UNIMOD:21	0.02	27.0	4	3	2
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	27.0	1	1	1
PRT	sp|Q9HDC9-2|APMAP_HUMAN	Isoform 2 of Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	184-UNIMOD:510,190-UNIMOD:21,195-UNIMOD:510	0.04	27.0	2	1	0
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	209-UNIMOD:510,218-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q8NC51-2|PAIRB_HUMAN	Isoform 2 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	235-UNIMOD:510,249-UNIMOD:21,267-UNIMOD:510	0.08	27.0	1	1	0
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	340-UNIMOD:510,344-UNIMOD:21,353-UNIMOD:510	0.04	27.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	689-UNIMOD:510,697-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	70-UNIMOD:510,77-UNIMOD:21	0.04	27.0	1	1	0
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	70-UNIMOD:510,81-UNIMOD:21	0.04	27.0	1	1	0
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	158-UNIMOD:510,166-UNIMOD:4,178-UNIMOD:21,137-UNIMOD:510,143-UNIMOD:21,150-UNIMOD:510,173-UNIMOD:21	0.10	27.0	3	2	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	1072-UNIMOD:510,1084-UNIMOD:21,2360-UNIMOD:510,2362-UNIMOD:21,2370-UNIMOD:4,2379-UNIMOD:510	0.01	26.0	2	2	2
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	187-UNIMOD:510,193-UNIMOD:21,194-UNIMOD:4	0.01	26.0	2	1	0
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	194-UNIMOD:510,205-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|Q5T4S7-5|UBR4_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	175-UNIMOD:510,178-UNIMOD:21,181-UNIMOD:21	0.00	26.0	2	1	0
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	158-UNIMOD:510,178-UNIMOD:21,177-UNIMOD:21	0.20	26.0	2	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	12-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	0.06	26.0	1	1	1
PRT	sp|P26373-2|RL13_HUMAN	Isoform 2 of 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	99-UNIMOD:510,101-UNIMOD:21,104-UNIMOD:21,108-UNIMOD:35	0.09	26.0	3	1	0
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	359-UNIMOD:510,367-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	62-UNIMOD:510,74-UNIMOD:21,63-UNIMOD:510,76-UNIMOD:21	0.07	26.0	4	2	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	372-UNIMOD:510,380-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|O43852-2|CALU_HUMAN	Isoform 2 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	60-UNIMOD:510,65-UNIMOD:21,70-UNIMOD:510	0.04	26.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	82-UNIMOD:510,92-UNIMOD:510,153-UNIMOD:510,156-UNIMOD:21,160-UNIMOD:21,164-UNIMOD:510,54-UNIMOD:510,63-UNIMOD:21,70-UNIMOD:21,73-UNIMOD:510	0.29	26.0	3	3	3
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	462-UNIMOD:510,466-UNIMOD:21,468-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q8IZP2|ST134_HUMAN	Putative protein FAM10A4 OS=Homo sapiens OX=9606 GN=ST13P4 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	170-UNIMOD:510,177-UNIMOD:21,182-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	1232-UNIMOD:510,1237-UNIMOD:21,1244-UNIMOD:510,1138-UNIMOD:510,1141-UNIMOD:21,1144-UNIMOD:4,1151-UNIMOD:4,1153-UNIMOD:4	0.02	25.0	2	2	2
PRT	sp|Q96D15|RCN3_HUMAN	Reticulocalbin-3 OS=Homo sapiens OX=9606 GN=RCN3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	67-UNIMOD:510,72-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	227-UNIMOD:510,247-UNIMOD:21,192-UNIMOD:510	0.12	25.0	2	2	2
PRT	sp|Q14847-3|LASP1_HUMAN	Isoform 3 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	41-UNIMOD:510,48-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	237-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|Q8NEY1-6|NAV1_HUMAN	Isoform 6 of Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	993-UNIMOD:510,1000-UNIMOD:21,1005-UNIMOD:21	0.01	25.0	1	1	0
PRT	sp|Q9H910-2|JUPI2_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	52-UNIMOD:510,59-UNIMOD:21,75-UNIMOD:510,81-UNIMOD:21	0.17	25.0	2	2	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	14-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|Q9H0L4|CSTFT_HUMAN	Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens OX=9606 GN=CSTF2T PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	554-UNIMOD:510,570-UNIMOD:21,576-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|Q9H2U2-4|IPYR2_HUMAN	Isoform 4 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	143-UNIMOD:510,151-UNIMOD:21,154-UNIMOD:510	0.08	25.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	25.0	1	1	1
PRT	sp|O14672-2|ADA10_HUMAN	Isoform 2 of Disintegrin and metalloproteinase domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ADAM10	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	322-UNIMOD:510,329-UNIMOD:21,331-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	33-UNIMOD:510,35-UNIMOD:21,87-UNIMOD:510	0.06	25.0	2	2	2
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	30-UNIMOD:510,38-UNIMOD:21,41-UNIMOD:510,44-UNIMOD:510,52-UNIMOD:510	0.15	25.0	3	2	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	42-UNIMOD:510,44-UNIMOD:21,47-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	204-UNIMOD:510,222-UNIMOD:510,121-UNIMOD:510,131-UNIMOD:510,223-UNIMOD:510	0.18	24.0	3	3	3
PRT	sp|P61916-2|NPC2_HUMAN	Isoform 2 of NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	36-UNIMOD:510,40-UNIMOD:21,42-UNIMOD:4,47-UNIMOD:4,51-UNIMOD:510	0.14	24.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	330-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	107-UNIMOD:510,111-UNIMOD:21,421-UNIMOD:510,424-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	27-UNIMOD:510,30-UNIMOD:21,32-UNIMOD:4,36-UNIMOD:35	0.08	24.0	2	1	0
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	235-UNIMOD:510,244-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|O60701-3|UGDH_HUMAN	Isoform 3 of UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	81-UNIMOD:510,88-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	411-UNIMOD:510,578-UNIMOD:510,589-UNIMOD:510,334-UNIMOD:510	0.05	24.0	3	3	3
PRT	sp|O00115-2|DNS2A_HUMAN	Isoform 2 of Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	66-UNIMOD:510,70-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	77-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	448-UNIMOD:510,454-UNIMOD:510,455-UNIMOD:21,58-UNIMOD:510,65-UNIMOD:35	0.04	23.0	2	2	2
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	115-UNIMOD:510,118-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	11-UNIMOD:510,21-UNIMOD:510,492-UNIMOD:510,506-UNIMOD:21	0.06	23.0	2	2	2
PRT	sp|O95359-2|TACC2_HUMAN	Isoform 2 of Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	210-UNIMOD:510,212-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	324-UNIMOD:510,332-UNIMOD:21,340-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P20618|PSB1_HUMAN	Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	147-UNIMOD:510,151-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	81-UNIMOD:510,89-UNIMOD:21	0.14	23.0	1	1	1
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	239-UNIMOD:510,245-UNIMOD:21,247-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	826-UNIMOD:510,827-UNIMOD:21,831-UNIMOD:21,835-UNIMOD:510	0.00	23.0	1	1	1
PRT	sp|Q6XQN6-3|PNCB_HUMAN	Isoform 3 of Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	498-UNIMOD:510,500-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	119-UNIMOD:510,121-UNIMOD:4,127-UNIMOD:21,131-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	63-UNIMOD:510,65-UNIMOD:21,69-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|Q8NBJ7-2|SUMF2_HUMAN	Isoform 2 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	187-UNIMOD:510,187-UNIMOD:35,190-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	656-UNIMOD:510,658-UNIMOD:21,669-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	161-UNIMOD:510,171-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|O75391|SPAG7_HUMAN	Sperm-associated antigen 7 OS=Homo sapiens OX=9606 GN=SPAG7 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	145-UNIMOD:510,158-UNIMOD:21,164-UNIMOD:510,163-UNIMOD:21	0.09	23.0	2	1	0
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	40-UNIMOD:510,50-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|Q96G03-2|PGM2_HUMAN	Isoform 2 of Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	37-UNIMOD:510,47-UNIMOD:21,51-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	96-UNIMOD:510,106-UNIMOD:21,113-UNIMOD:510,316-UNIMOD:510,318-UNIMOD:21,323-UNIMOD:21,326-UNIMOD:510	0.08	23.0	2	2	1
PRT	sp|P49321-4|NASP_HUMAN	Isoform 4 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	313-UNIMOD:510,326-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	96-UNIMOD:510	0.09	22.0	1	1	1
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	505-UNIMOD:510,507-UNIMOD:21,514-UNIMOD:35,518-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	8-UNIMOD:510,44-UNIMOD:510,48-UNIMOD:21	0.17	22.0	2	2	2
PRT	sp|Q8N556|AFAP1_HUMAN	Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	246-UNIMOD:510,251-UNIMOD:4,259-UNIMOD:4,264-UNIMOD:21,269-UNIMOD:510,265-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	78-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|O60333-3|KIF1B_HUMAN	Isoform 3 of Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	599-UNIMOD:510,600-UNIMOD:510,601-UNIMOD:21,606-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q12931-2|TRAP1_HUMAN	Isoform 2 of Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	511-UNIMOD:510,515-UNIMOD:21,520-UNIMOD:4,524-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|A0MZ66-7|SHOT1_HUMAN	Isoform 7 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	29-UNIMOD:510,30-UNIMOD:4,32-UNIMOD:21,38-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P30043|BLVRB_HUMAN	Flavin reductase (NADPH) OS=Homo sapiens OX=9606 GN=BLVRB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	79-UNIMOD:510,82-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|P15336-3|ATF2_HUMAN	Isoform 3 of Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	60-UNIMOD:510,69-UNIMOD:21,71-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|Q8TB72-2|PUM2_HUMAN	Isoform 2 of Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	67-UNIMOD:510,82-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	764-UNIMOD:510,775-UNIMOD:21,852-UNIMOD:510,858-UNIMOD:21,860-UNIMOD:21	0.03	22.0	3	2	1
PRT	sp|P78347-5|GTF2I_HUMAN	Isoform 5 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	207-UNIMOD:510,210-UNIMOD:21,215-UNIMOD:4,219-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	919-UNIMOD:510,935-UNIMOD:4,937-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P55809-2|SCOT1_HUMAN	Isoform 2 of Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	104-UNIMOD:510,107-UNIMOD:4,112-UNIMOD:21,114-UNIMOD:510	0.10	22.0	1	1	1
PRT	sp|P62910|RL32_HUMAN	60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	94-UNIMOD:510,96-UNIMOD:4,106-UNIMOD:510	0.10	22.0	1	1	1
PRT	sp|O00161|SNP23_HUMAN	Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	101-UNIMOD:510,110-UNIMOD:21,112-UNIMOD:4,117-UNIMOD:510	0.09	22.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	100-UNIMOD:510,105-UNIMOD:4,103-UNIMOD:21	0.05	22.0	2	1	0
PRT	sp|O43598|DNPH1_HUMAN	2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	157-UNIMOD:510,169-UNIMOD:21	0.11	22.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	621-UNIMOD:510,630-UNIMOD:21,634-UNIMOD:35,134-UNIMOD:510,140-UNIMOD:21	0.06	22.0	3	2	1
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	156-UNIMOD:510,166-UNIMOD:4,167-UNIMOD:21	0.06	22.0	1	1	0
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	184-UNIMOD:510,194-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q15545|TAF7_HUMAN	Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	191-UNIMOD:510,201-UNIMOD:21,204-UNIMOD:35,200-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	6-UNIMOD:510,14-UNIMOD:35,28-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	74-UNIMOD:510,76-UNIMOD:35,95-UNIMOD:510,101-UNIMOD:4	0.23	21.0	3	2	1
PRT	sp|Q9BTY7|HGH1_HUMAN	Protein HGH1 homolog OS=Homo sapiens OX=9606 GN=HGH1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	377-UNIMOD:510,388-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P15374|UCHL3_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens OX=9606 GN=UCHL3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	122-UNIMOD:510,130-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	2400-UNIMOD:510,2401-UNIMOD:510,2410-UNIMOD:21,2412-UNIMOD:35,3077-UNIMOD:510,3082-UNIMOD:21	0.01	21.0	3	2	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	402-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	129-UNIMOD:510,133-UNIMOD:21	0.04	21.0	2	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	376-UNIMOD:510,385-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|Q9NUQ3|TXLNG_HUMAN	Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	94-UNIMOD:510,97-UNIMOD:21,101-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P0CL80-2|GG12F_HUMAN	Isoform 2 of G antigen 12F OS=Homo sapiens OX=9606 GN=GAGE12F	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	16-UNIMOD:510,40-UNIMOD:21	0.48	21.0	1	1	1
PRT	sp|Q08AD1-2|CAMP2_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1284-UNIMOD:510,1294-UNIMOD:21,643-UNIMOD:510,646-UNIMOD:21,648-UNIMOD:4,655-UNIMOD:510	0.02	21.0	2	2	1
PRT	sp|Q07866-8|KLC1_HUMAN	Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	458-UNIMOD:510,460-UNIMOD:21,468-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	399-UNIMOD:510,405-UNIMOD:21,418-UNIMOD:21,428-UNIMOD:510	0.06	21.0	1	1	0
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	58-UNIMOD:510,65-UNIMOD:21,63-UNIMOD:21	0.09	21.0	4	1	0
PRT	sp|Q8NEY1|NAV1_HUMAN	Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	993-UNIMOD:510,1002-UNIMOD:21,1006-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	1311-UNIMOD:510,1319-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	408-UNIMOD:510,416-UNIMOD:21,420-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	175-UNIMOD:510,181-UNIMOD:21	0.00	21.0	1	1	0
PRT	sp|Q86WB0|NIPA_HUMAN	Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	354-UNIMOD:510,373-UNIMOD:21	0.04	21.0	1	1	0
PRT	sp|O14545|TRAD1_HUMAN	TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	317-UNIMOD:510,327-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	104-UNIMOD:510,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:510	0.12	20.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	1556-UNIMOD:510,1563-UNIMOD:21,1567-UNIMOD:510	0.00	20.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	223-UNIMOD:510	0.09	20.0	2	1	0
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	194-UNIMOD:510,202-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	97-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	117-UNIMOD:510,120-UNIMOD:21,135-UNIMOD:21,122-UNIMOD:21	0.04	20.0	2	1	0
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	359-UNIMOD:510,362-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9H078-5|CLPB_HUMAN	Isoform 5 of Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	462-UNIMOD:510,467-UNIMOD:21,472-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	257-UNIMOD:510,270-UNIMOD:4,272-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	68-UNIMOD:510,76-UNIMOD:21,78-UNIMOD:4	0.09	20.0	1	1	0
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	71-UNIMOD:510,76-UNIMOD:21,81-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	67-UNIMOD:510,80-UNIMOD:21,92-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q16719-2|KYNU_HUMAN	Isoform 2 of Kynureninase OS=Homo sapiens OX=9606 GN=KYNU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	85-UNIMOD:510,93-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|O75822-2|EIF3J_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	107-UNIMOD:510,109-UNIMOD:21,117-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	235-UNIMOD:510,246-UNIMOD:21,247-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	114-UNIMOD:510	0.13	20.0	1	1	1
PRT	sp|Q08380|LG3BP_HUMAN	Galectin-3-binding protein OS=Homo sapiens OX=9606 GN=LGALS3BP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	400-UNIMOD:21,405-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	47-UNIMOD:510,50-UNIMOD:21,58-UNIMOD:510	0.04	20.0	1	1	0
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	166-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	81-UNIMOD:510,81-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	200-UNIMOD:510,206-UNIMOD:4,207-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|O75179-4|ANR17_HUMAN	Isoform 4 of Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	1443-UNIMOD:510,1445-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	175-UNIMOD:510,180-UNIMOD:21,184-UNIMOD:510	0.06	19.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	189-UNIMOD:510,202-UNIMOD:21,206-UNIMOD:510,368-UNIMOD:510	0.05	19.0	2	2	2
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	91-UNIMOD:510,94-UNIMOD:4,129-UNIMOD:510,130-UNIMOD:4,136-UNIMOD:21	0.15	19.0	2	2	2
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	306-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	7-UNIMOD:510	0.04	19.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	554-UNIMOD:510,567-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q9BUW7|BBLN_HUMAN	Bublin coiled-coil protein OS=Homo sapiens OX=9606 GN=BBLN PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	68-UNIMOD:510,82-UNIMOD:21	0.20	19.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	72-UNIMOD:510,80-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|Q9ULD2-4|MTUS1_HUMAN	Isoform 4 of Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	330-UNIMOD:510,336-UNIMOD:21,340-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	227-UNIMOD:510,235-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	80-UNIMOD:510,82-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	2146-UNIMOD:510,2155-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	362-UNIMOD:510,368-UNIMOD:21,384-UNIMOD:21,391-UNIMOD:510	0.06	19.0	1	1	0
PRT	sp|P16278-2|BGAL_HUMAN	Isoform 2 of Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	289-UNIMOD:510,295-UNIMOD:4,302-UNIMOD:21	0.04	19.0	1	1	0
PRT	sp|Q9NSK0-5|KLC4_HUMAN	Isoform 5 of Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	381-UNIMOD:510,383-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	738-UNIMOD:510,743-UNIMOD:21,751-UNIMOD:21,758-UNIMOD:4	0.04	19.0	1	1	0
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	null	407-UNIMOD:510,415-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P16278|BGAL_HUMAN	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	420-UNIMOD:510,426-UNIMOD:4,434-UNIMOD:21	0.04	19.0	1	1	0
PRT	sp|Q8N2K0-3|ABD12_HUMAN	Isoform 3 of Lysophosphatidylserine lipase ABHD12 OS=Homo sapiens OX=9606 GN=ABHD12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	5-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:35,21-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	694-UNIMOD:510,705-UNIMOD:21,710-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	19-UNIMOD:510	0.04	18.0	1	1	1
PRT	sp|Q7L1Q6-2|BZW1_HUMAN	Isoform 2 of Basic leucine zipper and W2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BZW1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	303-UNIMOD:510,313-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	151-UNIMOD:510,160-UNIMOD:510	0.05	18.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	78-UNIMOD:510,88-UNIMOD:510	0.05	18.0	1	1	1
PRT	sp|P31327-3|CPSM_HUMAN	Isoform 3 of Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	926-UNIMOD:510,926-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|P10696|PPBN_HUMAN	Alkaline phosphatase, germ cell type OS=Homo sapiens OX=9606 GN=ALPG PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	422-UNIMOD:510,435-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	55-UNIMOD:510,60-UNIMOD:21,65-UNIMOD:21,70-UNIMOD:510,27-UNIMOD:510,30-UNIMOD:21,38-UNIMOD:510,57-UNIMOD:21	0.21	18.0	3	2	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	5-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:510	0.13	18.0	1	1	1
PRT	sp|P32004-3|L1CAM_HUMAN	Isoform 3 of Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1227-UNIMOD:510,1239-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q9UHB6-3|LIMA1_HUMAN	Isoform 3 of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	184-UNIMOD:510,188-UNIMOD:21,198-UNIMOD:510	0.04	18.0	1	1	1
PRT	sp|Q9Y6M1-5|IF2B2_HUMAN	Isoform 5 of Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens OX=9606 GN=IGF2BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	89-UNIMOD:510,99-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	352-UNIMOD:510,360-UNIMOD:21,369-UNIMOD:4,371-UNIMOD:510	0.04	18.0	1	1	1
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	230-UNIMOD:510,238-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q13459-2|MYO9B_HUMAN	Isoform Short of Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1306-UNIMOD:510,1308-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|O43242-2|PSMD3_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	288-UNIMOD:510,292-UNIMOD:21,302-UNIMOD:510	0.04	18.0	1	1	1
PRT	sp|Q14203-3|DCTN1_HUMAN	Isoform 3 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	74-UNIMOD:510,91-UNIMOD:21,98-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	229-UNIMOD:510,237-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	322-UNIMOD:510,334-UNIMOD:4,335-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|P45985|MP2K4_HUMAN	Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	55-UNIMOD:510,60-UNIMOD:21,66-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1140-UNIMOD:510,1144-UNIMOD:21,1152-UNIMOD:510	0.00	18.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	154-UNIMOD:510,163-UNIMOD:510	0.01	18.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	95-UNIMOD:510	0.08	18.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	240-UNIMOD:510,250-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	98-UNIMOD:510,107-UNIMOD:510	0.04	18.0	1	1	1
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	277-UNIMOD:510,279-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	87-UNIMOD:510,94-UNIMOD:21,96-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|Q9Y2L1|RRP44_HUMAN	Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	628-UNIMOD:510,634-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q7Z7L1|SLN11_HUMAN	Schlafen family member 11 OS=Homo sapiens OX=9606 GN=SLFN11 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	49-UNIMOD:510,51-UNIMOD:4,56-UNIMOD:21,63-UNIMOD:35	0.02	18.0	1	1	1
PRT	sp|Q8WXX0|DYH7_HUMAN	Dynein axonemal heavy chain 7 OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	1575-UNIMOD:510,1577-UNIMOD:4,1579-UNIMOD:21,1589-UNIMOD:21,1591-UNIMOD:510	0.00	18.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	SVSTPSEAGSQDSGDGAVGSR	1	sp|Q13409-6|DC1I2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	52.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=670	12.413	2	2063.8857	2063.8857	K	R	86	107
PSM	SVSTPSEAGSQDSGDGAVGSR	2	sp|Q13409|DC1I2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	49.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=670	12.412633333333332	2	2063.880589	2063.885704	K	T	92	113
PSM	DATNVGDEGGFAPNILENK	3	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,3-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=4703	50.217	2	2108.01	2108.0100	K	E	203	222
PSM	DNLTLWTSDQQDDDGGEGNN	4	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510	ms_run[2]:scan=4576	48.983	2	2226.9361	2226.9361	R	-	228	248
PSM	SCGSSTPDEFPTDIPGTK	5	sp|P41091|IF2G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,2-UNIMOD:4,6-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3713	40.914	2	2042.918	2042.9180	R	G	104	122
PSM	SSSPAPADIAQTVQEDLR	6	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4059	43.989	2	1997.9519	1997.9519	K	T	230	248
PSM	ILATPPQEDAPSVDIANIR	7	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=4864	52.277	2	2213.0594	2213.0594	K	M	284	303
PSM	NVSSFPDDATSPLQENR	8	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3377	38.178	2	1989.8893	1989.8893	R	N	52	69
PSM	SSSPAPADIAQTVQEDLR	9	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4994	53.838	2	1997.9519	1997.9519	K	T	230	248
PSM	KPVTVSPTTPTSPTEGEAS	10	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=1998	27.802	2	2112.9905	2112.9905	R	-	505	524
PSM	SPSDSSTASTPVAEQIER	11	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2093	28.495	2	1974.8996	1974.8996	R	A	337	355
PSM	SSGSPYGGGYGSGGGSGGYGSR	12	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1593	24.824	2	2023.8121	2023.8121	R	R	333	355
PSM	DTQSPSTCSEGLLGWSQK	13	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:4,18-UNIMOD:510	ms_run[2]:scan=4634	49.534	2	2127.982	2127.9820	K	D	709	727
PSM	STETSDFENIESPLNER	14	sp|Q96K76-2|UBP47_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4043	43.869	2	2080.905	2080.9050	K	D	811	828
PSM	GSLESPATDVFGSTEEGEK	15	sp|O00232-2|PSD12_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,5-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=4251	45.802	2	2086.962	2086.9620	K	R	311	330
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	16	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4031	43.765	3	3090.3451	3090.3451	K	E	144	170
PSM	DFAARSPSASITDEDSNV	17	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3609	39.991	2	1994.8683	1994.8683	K	-	841	859
PSM	QLGQDLLNSYIENEGK	18	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,9-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=5000	53.885	2	1967.9878	1967.9878	R	M	591	607
PSM	DTQSPSTCSEGLLGWSQK	19	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:4,18-UNIMOD:510	ms_run[1]:scan=4634	49.534261666666666	2	2127.978721	2127.982036	K	D	709	727
PSM	AEEYEFLTPVEEAPK	20	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4385	47.073	2	1898.9227	1898.9227	R	G	153	168
PSM	AVPMAPAPASPGSSNDSSAR	21	sp|Q66K74-2|MAP1S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2106	28.589	2	1982.8981	1982.8981	K	S	724	744
PSM	NSDVLQSPLDSAARDEL	22	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4651	49.691	2	1942.9097	1942.9097	K	-	606	623
PSM	QIDSSPVGGETDETTVSQNYR	23	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2689	32.903	3	2396.0593	2396.0593	K	G	565	586
PSM	QQAAYYGQTPGPGGPQPPPTQQGQQQAQ	24	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2664	32.721	3	3021.383	3021.3830	R	-	684	712
PSM	SMDEFTASTPADLGEAGR	25	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,2-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=3215	36.914	2	1983.8345	1983.8345	R	L	380	398
PSM	TDSVIIADQTPTPTR	26	sp|P17544-5|ATF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3133	36.295	2	1807.8218	1807.8218	R	F	42	57
PSM	TQPDGTSVPGEPASPISQR	27	sp|Q14980-5|NUMA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2391	30.739	2	2036.9628	2036.9628	R	L	608	627
PSM	QIDSSPVGGETDETTVSQNYR	28	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=2689	32.90316666666667	3	2396.0556	2396.0588	K	G	565	586
PSM	SSSPAPADIAQTVQEDLR	29	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=4994	53.83815666666666	2	1997.950538	1997.951933	K	T	230	248
PSM	DDGVFVQEVTQNSPAAR	30	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4009	43.585	2	1945.8995	1945.8995	R	T	29	46
PSM	DSSTSPGDYVLSVSENSR	31	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4419	47.426	2	2012.8788	2012.8788	R	V	39	57
PSM	AAEEAFVNDIDESSPGTEWER	32	sp|P09496-5|CLCA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=4648	49.668	2	2465.0484	2465.0484	R	V	111	132
PSM	AGSSTPGDAPPAVAEVQGR	33	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2408	30.86	2	1879.8889	1879.8889	R	S	2885	2904
PSM	DNLTLWTSDQQDEEAGEGN	34	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4643	49.602	2	2154.9402	2154.9402	R	-	228	247
PSM	DSENLASPSEYPENGER	35	sp|P52948-4|NUP98_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2539	31.808	2	2006.8319	2006.8319	R	F	600	617
PSM	EEASDYLELDTIK	36	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4234	45.605	2	1592.8458	1592.8458	K	N	253	266
PSM	ELSDQATASPIVAR	37	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2309	30.142	2	1570.7816	1570.7816	K	T	88	102
PSM	IIAEGANGPTTPEADK	38	sp|P00367-2|DHE3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1456	23.817	2	1730.8764	1730.8764	K	I	233	249
PSM	NVSSFPDDATSPLQENR	39	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3501	39.156	2	1989.8893	1989.8893	R	N	52	69
PSM	SAMPFTASPASSTTAR	40	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3006	35.343	2	1695.7752	1695.7752	R	V	123	139
PSM	EILGTAQSVGCNVDGR	41	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=2943	34.863	2	1788.829	1788.8290	K	H	98	114
PSM	EQGPYETYEGSPVSK	42	sp|P23921|RIR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2183	29.178	2	1817.8397	1817.8397	K	G	549	564
PSM	FNAHGDANTIVCNSK	43	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:4,15-UNIMOD:510	ms_run[2]:scan=1566	24.624	2	1794.8397	1794.8397	R	D	50	65
PSM	GQEEISGALPVASPASSR	44	sp|Q9UBK8|MTRR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3100	36.054	2	1868.9093	1868.9093	R	T	159	177
PSM	MDATANDVPSPYEVR	45	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,1-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=2646	32.587	2	1793.7755	1793.7755	K	G	434	449
PSM	YRDVAECGPQQELDLNSPR	46	sp|Q9BTE3-2|MCMBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,7-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=3011	35.38	3	2360.068	2360.0680	K	N	102	121
PSM	VEIIANDQGNRTTPSYVAFTDTER	47	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=4321	46.466253333333334	3	2890.2975	2890.2994	K	L	26	50
PSM	DSSTSPGDYVLSVSENSR	48	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4419	47.425718333333336	2	2012.876795	2012.878828	R	V	39	57
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	49	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=2857	34.202	3	3207.3066	3207.3066	R	-	502	532
PSM	CIPALDSLTPANEDQK	50	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4057	43.973	2	1918.9384	1918.9384	R	I	447	463
PSM	DWEDDSDEDMSNFDR	51	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=2972	35.093	2	1924.7117	1924.7117	K	F	75	90
PSM	EEGSSDEISSGVGDSESEGLNSPVK	52	sp|P52701-2|MSH6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,22-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=2926	34.736	3	2642.1756	2642.1756	K	V	271	296
PSM	FSEGVLQSPSQDQEK	53	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2658	32.678	2	1825.8772	1825.8772	R	L	428	443
PSM	IFVGGLSPDTPEEK	54	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3787	41.532	2	1635.8433	1635.8433	K	I	165	179
PSM	QIDSSPVGGETDETTVSQNYR	55	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2694	32.94	2	2396.0593	2396.0593	K	G	565	586
PSM	SVTEQGAELSNEER	56	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1756	26.039	2	1661.7358	1661.7358	K	N	28	42
PSM	YADLTEDQLPSCESLK	57	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=3959	43.187	2	2015.9435	2015.9435	R	D	142	158
PSM	IFVGGLSPDTPEEK	58	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=4326	46.503945	2	1715.8086	1715.8091	K	I	184	198
PSM	SSDEENGPPSSPDLDR	59	sp|Q96B36|AKTS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=1441	23.70609	2	1814.7389	1814.7415	R	I	202	218
PSM	EAAFSPGQQDWSR	60	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3325	37.739	2	1591.6881	1591.6881	R	D	1099	1112
PSM	EVSFQSTGESEWK	61	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3546	39.495	2	1660.7658	1660.7658	R	D	208	221
PSM	GSSGENNNPGSPTVSNFR	62	sp|Q99576-3|T22D3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1850	26.727	2	1933.838	1933.8380	R	Q	32	50
PSM	NAEAVLQSPGLSGK	63	sp|Q13045-2|FLII_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2801	33.761	2	1517.8127	1517.8127	R	V	794	808
PSM	NSDVLQSPLDSAAR	64	sp|Q8NBJ5|GT251_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3257	37.23	2	1585.7561	1585.7561	K	D	606	620
PSM	RSEACPCQPDSGSPLPAEEEK	65	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=1378	23.224	3	2491.1033	2491.1033	R	R	411	432
PSM	SVTEQGAELSNEER	66	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=1254	22.134	2	1581.7695	1581.7695	K	N	28	42
PSM	SYELPDGQVITIGNER	67	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4483	48.028	2	1903.9141	1903.9141	K	F	239	255
PSM	TAGTSFMMTPYVVTR	68	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=4935	53.104	2	1854.7911	1854.7911	R	Y	213	228
PSM	TDSVIIADQTPTPTR	69	sp|P17544-5|ATF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2997	35.277	2	1807.8218	1807.8218	R	F	42	57
PSM	TSSVSNPQDSVGSPCSR	70	sp|P49023-2|PAXI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=689	12.549	2	1877.8039	1877.8039	K	V	94	111
PSM	TTPSVVAFTADGER	71	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=3869	42.318	2	1643.7058	1643.7058	R	L	86	100
PSM	GSLESPATDVFGSTEEGEK	72	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:510,2-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=4251	45.802054999999996	2	2086.959634	2086.962011	K	R	331	350
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	73	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=2711	33.062	3	3127.3403	3127.3403	R	-	502	532
PSM	AQQATPGGAAPTIFSR	74	sp|Q9BX68|HINT2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3269	37.321	2	1685.8351	1685.8351	K	I	43	59
PSM	CTGGEVGATSALAPK	75	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,1-UNIMOD:4,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2095	28.51	2	1565.7797	1565.7797	R	I	17	32
PSM	ELISNASDALDK	76	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2701	32.991	2	1342.7616	1342.7616	R	I	42	54
PSM	GILAADESTGSIAK	77	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2908	34.59	2	1479.7858	1479.7858	K	R	29	43
PSM	GVQVETISPGDGR	78	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2127	28.745	2	1427.687	1427.6870	M	T	2	15
PSM	HTGPNSPDTANDGFVR	79	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1292	22.475	2	1797.7896	1797.7896	K	L	99	115
PSM	IFVGGLSPDTPEEK	80	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3898	42.541	2	1635.8433	1635.8433	K	I	165	179
PSM	KAEAGAGSATEFQFR	81	sp|P46783|RS10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2512	31.607	2	1716.8509	1716.8509	K	G	139	154
PSM	MDATANDVPSPYEVR	82	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3145	36.383	2	1777.7806	1777.7806	K	G	434	449
PSM	NPDDITNEEYGEFYK	83	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3796	41.615	2	1900.9003	1900.9003	R	S	300	315
PSM	RIITYNEAMDSPDQ	84	sp|Q7Z417-2|NUFP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,9-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=2201	29.308	2	1781.7755	1781.7755	K	-	107	121
PSM	SEVERPASIPLSSGYSTASSDSTPR	85	sp|Q9C0F1|CEP44_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,23-UNIMOD:21	ms_run[2]:scan=3010	35.373	3	2694.2598	2694.2598	K	A	324	349
PSM	SGSMEEDVDTSPGGDYYTSPSSPTSSSR	86	sp|P08651-4|NFIC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=3182	36.654	3	2996.1967	2996.1967	K	N	251	279
PSM	SQSSEGVSSLSSSPSNSLETQSQSLSR	87	sp|O95155-2|UBE4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3433	38.604	3	2869.3039	2869.3039	R	S	76	103
PSM	SYELPDGQVITIGNER	88	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=5061	54.743	2	1903.9141	1903.9141	K	F	239	255
PSM	TQSPGGCSAEAVLAR	89	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2479	31.366	2	1616.7442	1616.7442	R	K	74	89
PSM	VEIIANDQGNRITPSYVAFTPEGER	90	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=4624	49.419	3	2969.3785	2969.3786	R	L	50	75
PSM	VERADGYEPPVQESV	91	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2769	33.494	2	1787.8191	1787.8191	K	-	250	265
PSM	GVVDSEDLPLNISR	92	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=4516	48.334028333333336	2	1626.8066	1626.8073	R	E	379	393
PSM	TAGTSFMMTPYVVTR	93	sp|P53779|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,7-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=4213	45.42287666666667	2	1870.7840	1870.7855	R	Y	213	228
PSM	NSDVLQSPLDSAARDEL	94	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=4651	49.69127833333333	2	1942.908438	1942.909734	K	-	606	623
PSM	DCSYGAVTSPTSTLESR	95	sp|Q9HCD6-3|TANC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=3398	38.332	2	1943.8396	1943.8396	K	D	161	178
PSM	DNLTLWTSDQQDDDGGEGNN	96	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=4682	50.017	2	2226.9361	2226.9361	R	-	228	248
PSM	ESEDKPEIEDVGSDEEEEK	97	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=1908	27.149	3	2294.1022	2294.1022	K	K	251	270
PSM	EVDEQMLNVQNK	98	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2603	32.272	2	1513.8083	1513.8083	K	N	325	337
PSM	IIAFVGSPVEDNEK	99	sp|P55036-2|PSMD4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4017	43.659	2	1664.8699	1664.8699	R	D	109	123
PSM	LDGLVETPTGYIESLPR	100	sp|P55209-3|NP1L1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=5412	60.323	2	1972.9971	1972.9971	R	V	15	32
PSM	NIDINDVTPNCR	101	sp|P62195-2|PRS8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=2751	33.36	2	1543.6914	1543.6914	K	V	94	106
PSM	NPDDITQEEYGEFYK	102	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3860	42.237	2	1914.916	1914.9160	R	S	292	307
PSM	RIITYNEAMDSPDQ	103	sp|Q7Z417-2|NUFP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3017	35.425	2	1765.7806	1765.7806	K	-	107	121
PSM	SQDATFSPGSEQAEK	104	sp|Q86WB0-2|NIPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1497	24.116	2	1728.788	1728.7880	R	S	308	323
PSM	SYELPDGQVITIGNER	105	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=5491	61.469	2	1983.8804	1983.8804	K	F	239	255
PSM	TAGTSFMMTPYVVTR	106	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4354	46.744	2	1870.786	1870.7860	R	Y	213	228
PSM	GVVDSEDLPLNISR	107	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510	ms_run[1]:scan=4029	43.74923833333333	2	1546.8410	1546.8410	R	E	379	393
PSM	TAGTSFMMTPYVVTR	108	sp|P45983|MK08_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,8-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=4354	46.743970000000004	2	1870.784641	1870.785993	R	Y	175	190
PSM	TTPSVVAFTADGER	109	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3852	42.12239833333334	2	1563.7381	1563.7389	R	L	86	100
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	110	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,18-UNIMOD:21,33-UNIMOD:510	ms_run[1]:scan=3284	37.430598333333336	4	3922.7254	3922.7326	K	E	241	274
PSM	SATSSSPGSPLHSLETSL	111	sp|P20020|AT2B1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=4825	51.80299333333333	2	1870.8761	1870.8768	K	-	1203	1221
PSM	ASSPSPLTIGTPESQR	112	sp|Q9NPI6-2|DCP1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2994	35.255	2	1740.8508	1740.8508	K	K	483	499
PSM	EVEEELATSGGQSPTGEQIPQFQQR	113	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3969	43.274	3	2858.3184	2858.3184	R	Q	3492	3517
PSM	EYIPGQPPLSQSSDSSPTR	114	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3264	37.283	2	2158.9996	2158.9996	K	N	871	890
PSM	FAAATGATPIAGR	115	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2204	29.329	2	1316.6702	1316.6702	K	F	90	103
PSM	GATLALTQVTPQDER	116	sp|P43121|MUC18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3109	36.121	2	1712.8558	1712.8558	R	I	98	113
PSM	LIAPVAEEEATVPNNK	117	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2870	34.313	2	1762.0149	1762.0149	K	I	8	24
PSM	LNQVCFDDDGTSSPQDR	118	sp|Q8N1F7-2|NUP93_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2901	34.539	2	2066.8465	2066.8465	K	L	295	312
PSM	LPSGSGAASPTGSAVDIR	119	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2444	31.115	2	1755.8617	1755.8617	R	A	208	226
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	120	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,18-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=3734	41.069	3	2885.3326	2885.3326	R	T	296	322
PSM	TAGTSFMMTPYVVTR	121	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4458	47.759	2	1870.786	1870.7860	R	Y	213	228
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	122	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=4752	50.874	3	3570.4718	3570.4718	R	-	207	238
PSM	GSGIFDESTPVQTR	123	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=3107	36.106631666666665	2	1606.7424	1606.7447	K	Q	68	82
PSM	EVYELLDSPGK	124	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=3762	41.33097	2	1396.7157	1396.7158	K	V	20	31
PSM	ALAAAGYDVEK	125	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1945	27.417	2	1174.687	1174.6870	K	N	65	76
PSM	EATNTTSEPSAPSQDLLDLSPSPR	126	sp|O75674-2|TM1L1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=4294	46.185	3	2626.2224	2626.2224	K	M	302	326
PSM	ERPTPSLNNNCTTSEDSLVLYNR	127	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3555	39.562	3	2793.2853	2793.2853	K	V	734	757
PSM	EVDEQMLNVQNK	128	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1461	23.854	2	1529.8032	1529.8032	K	N	325	337
PSM	GQLCELSCSTDYR	129	sp|Q99873-5|ANM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:4,7-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=2774	33.531	2	1701.6952	1701.6952	K	M	271	284
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	130	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3012	35.388	3	2965.4395	2965.4395	R	D	374	402
PSM	KEESEESDDDMGFGLFD	131	sp|P05386-2|RLA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4338	46.607	2	2032.8732	2032.8732	K	-	73	90
PSM	KPVTVSPTTPTSPTEGEAS	132	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=1716	25.747	2	2033.0242	2033.0242	R	-	505	524
PSM	LLLSSETPIEGK	133	sp|Q9HDC9-2|APMAP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3430	38.582	2	1433.8055	1433.8055	K	N	184	196
PSM	NEQDAYAINSYTR	134	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2644	32.572	2	1657.7197	1657.7197	R	S	209	222
PSM	NMAPGAVCSPGESK	135	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:4,9-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1328	22.769	2	1551.7099	1551.7099	R	E	1289	1303
PSM	NQLTSNPENTVFDAK	136	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3722	40.982	2	1824.8931	1824.8931	K	R	82	97
PSM	NVTELNEPLSNEER	137	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2898	34.517	2	1756.8093	1756.8093	K	N	29	43
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	138	sp|Q8NC51-2|PAIRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,15-UNIMOD:21,33-UNIMOD:510	ms_run[2]:scan=3284	37.431	4	3922.7331	3922.7331	K	E	235	268
PSM	SGSSSPDSEITELK	139	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2899	34.524	2	1583.7604	1583.7604	R	F	340	354
PSM	SLPTTVPESPNYR	140	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2964	35.035	2	1573.7602	1573.7602	R	N	689	702
PSM	TDYNASVSVPDSSGPER	141	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2536	31.785	2	1893.8206	1893.8206	R	I	70	87
PSM	TTPSVVAFTADGER	142	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3802	41.687	2	1563.7394	1563.7394	R	L	86	100
PSM	VIEQLGTPCPEFMK	143	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4,13-UNIMOD:35,14-UNIMOD:510	ms_run[2]:scan=3564	39.641	2	1811.8875	1811.8875	K	K	275	289
PSM	VIEQLGTPCPEFMK	144	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=4257	45.848	2	1795.8926	1795.8926	K	K	275	289
PSM	YDLDFKSPDDPSR	145	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3368	38.111	2	1701.7924	1701.7924	K	Y	257	270
PSM	TAGTSFMMTPYVVTR	146	sp|P53779|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,8-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=4105	44.41098833333333	2	1870.7840	1870.7855	R	Y	213	228
PSM	TDYNASVSVPDSSGPER	147	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[1]:scan=2536	31.78466666666667	2	1893.8165	1893.8201	R	I	70	87
PSM	HDDSSDNFCEADDIQSPEAEYVDLLLNPER	148	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,9-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=5797	66.56486833333334	4	3606.5134	3606.5189	K	Y	158	188
PSM	SEVERPASIPLSSGYSTASSDSTPR	149	sp|Q9C0F1|CEP44_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,19-UNIMOD:21	ms_run[1]:scan=3010	35.37260666666666	3	2694.254406	2694.259802	K	A	324	349
PSM	AFGPGLQGGSAGSPAR	150	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2344	30.397	2	1542.7404	1542.7404	K	F	1072	1088
PSM	DNPGVVTCLDEAR	151	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=3974	43.312	2	1558.6911	1558.6911	K	H	187	200
PSM	DSAQNSVIIVDK	152	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2315	30.186	2	1355.7933	1355.7933	K	N	194	206
PSM	ELASPVSPELR	153	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2866	34.284	2	1310.6695	1310.6696	K	Q	175	186
PSM	EQVANSAFVER	154	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1574	24.683	2	1282.673	1282.6730	K	V	492	503
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	155	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=2767	33.479	4	3738.5754	3738.5754	K	-	158	196
PSM	GEAAAERPGEAAVASSPSK	156	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,16-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=618	12.057	3	1931.9626	1931.9626	K	A	12	31
PSM	GILAADESTGSIAK	157	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2730	33.202	2	1479.7858	1479.7858	K	R	29	43
PSM	ISVYYNEATGGK	158	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2335	30.333	2	1368.7562	1368.7562	R	Y	47	59
PSM	LATQLTGPVMPVR	159	sp|P26373-2|RL13_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3449	38.748	2	1591.7658	1591.7659	K	N	99	112
PSM	LVGPEEALSPGEAR	160	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3119	36.194	2	1537.7602	1537.7602	K	D	359	373
PSM	QSKPVTTPEEIAQVATISANGDK	161	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:510,6-UNIMOD:21,18-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=3795	41.607	3	2645.3451	2645.3451	K	E	158	181
PSM	RADLNQGIGEPQSPSR	162	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=1355	23.028	2	1837.8896	1837.8896	R	R	62	78
PSM	SAMPFTASPASSTTAR	163	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=1871	26.88	2	1711.7701	1711.7701	R	V	123	139
PSM	STPFIVPSSPTEQEGR	164	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3666	40.431	2	1844.877	1844.8770	R	Q	372	388
PSM	SYELPDGQVITIGNER	165	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4678	49.988	2	1823.9478	1823.9478	K	F	239	255
PSM	TAGTSFMMTPYVVTR	166	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3287	37.453	2	1886.7809	1886.7809	R	Y	213	228
PSM	TFDQLTPEESK	167	sp|O43852-2|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2399	30.796	2	1441.7014	1441.7014	K	E	60	71
PSM	YALYDATYETK	168	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2989	35.217	2	1404.7449	1404.7449	R	E	82	93
PSM	YEQGTGCWQGPNR	169	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=1897	27.068	2	1665.6819	1665.6819	K	S	462	475
PSM	ADLNQGIGEPQSPSR	170	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2048	28.168	2	1681.7885	1681.7885	R	R	63	78
PSM	AIEINPDSAQPYK	171	sp|Q8IZP2|ST134_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3132	36.288	2	1592.8124	1592.8124	R	R	170	183
PSM	DILAQSPAAEPLK	172	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3632	40.178	2	1499.8273	1499.8273	K	N	1232	1245
PSM	EFDQLTPEESQAR	173	sp|Q96D15|RCN3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2656	32.662	2	1662.7351	1662.7351	K	L	67	80
PSM	EGLELPEDEEEK	174	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2791	33.673	2	1483.7566	1483.7566	K	K	547	559
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	175	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=3924	42.843	3	2608.0617	2608.0617	R	G	227	255
PSM	GFSVVADTPELQR	176	sp|Q14847-3|LASP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3670	40.461	2	1531.7496	1531.7496	K	I	41	54
PSM	GGIVDEGALLR	177	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3434	38.612	2	1132.6664	1132.6664	R	A	237	248
PSM	GILAADESTGSIAK	178	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=2325	30.261	2	1399.8195	1399.8195	K	R	29	43
PSM	GPLQSVQVFGR	179	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3918	42.786	2	1300.6753	1300.6753	K	K	5	16
PSM	GQLTNIVSPTAATTPR	180	sp|Q8NEY1-6|NAV1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=3510	39.224	2	1819.8695	1819.8695	K	I	993	1009
PSM	GSGIFDESTPVQTR	181	sp|Q9H910-2|JUPI2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3107	36.107	2	1606.7452	1606.7452	K	Q	52	66
PSM	IQALQQQADEAEDR	182	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1804	26.389	2	1647.8276	1647.8276	K	A	14	28
PSM	LDSPPPSPITEASEAAEAAEAGNLAVSSR	183	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=5759	65.949	3	3030.3684	3030.3684	R	E	492	521
PSM	LLLSSETPIEGK	184	sp|Q9HDC9-2|APMAP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3421	38.517	2	1433.8055	1433.8055	K	N	184	196
PSM	LMIEMDGTENK	185	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3027	35.5	2	1347.7051	1347.7051	K	S	93	104
PSM	QGGSQPSSFSPGQSQVTPQDQEK	186	sp|Q9H0L4|CSTFT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,17-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=1888	27.003	3	2551.1864	2551.1864	K	A	554	577
PSM	SLVESVSSSPNK	187	sp|Q9H2U2-4|IPYR2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1687	25.536	2	1380.7174	1380.7174	R	E	143	155
PSM	SSSPAPADIAQTVQEDLR	188	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=5005	53.935	3	1997.9519	1997.9519	K	T	230	248
PSM	TAFQEALDAAGDK	189	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3218	36.937	2	1403.7569	1403.7569	K	L	9	22
PSM	TITLQPGSPCNDFR	190	sp|O14672-2|ADA10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=3821	41.855	2	1718.7911	1718.7911	R	G	322	336
PSM	TPAAAAAMNLASPR	191	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2809	33.821	2	1454.7165	1454.7165	R	T	2261	2275
PSM	TTPSYVAFTDTER	192	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3200	36.803	2	1520.7571	1520.7571	R	L	37	50
PSM	TWNDPSVQQDIK	193	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2619	32.389	2	1497.81	1497.8100	R	F	102	114
PSM	VLTPELYAELR	194	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4608	49.246	2	1416.7478	1416.7478	K	A	33	44
PSM	ESVPEFPLSPPK	195	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=4440	47.60940333333333	2	1473.7785	1473.7788	K	K	30	42
PSM	SSSPAPADIAQTVQEDLR	196	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=5005	53.93478666666667	3	1997.9511	1997.9514	K	T	230	248
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	197	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=2568	32.018	3	3127.3403	3127.3403	R	-	502	532
PSM	DFTPVCTTELGR	198	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=3822	41.862	2	1508.6795	1508.6795	R	A	42	54
PSM	DNLTLWTSDMQGDGEEQNK	199	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4510	48.275	3	2248.059	2248.0590	R	E	204	223
PSM	ELASPVSPELR	200	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=3333	37.798	2	1390.6359	1390.6359	K	Q	175	186
PSM	ELISNSSDALDK	201	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2595	32.214	2	1438.7229	1438.7229	R	I	47	59
PSM	EVNVSPCPTQPCQLSK	202	sp|P61916-2|NPC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2506	31.564	2	1990.953	1990.9530	K	G	36	52
PSM	GATQQILDEAER	203	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2393	30.753	2	1363.7156	1363.7156	R	S	330	342
PSM	GPPQSPVFEGVYNNSR	204	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3528	39.36	2	1860.862	1860.8620	K	M	107	123
PSM	ILYSQCGDVMR	205	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=3112	36.143	2	1454.6511	1454.6511	K	A	27	38
PSM	LATQLTGPVMPVR	206	sp|P26373-2|RL13_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=4327	46.511	2	1575.7709	1575.7709	K	N	99	112
PSM	LDQPVSAPPSPR	207	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1744	25.954	2	1376.6913	1376.6913	K	D	235	247
PSM	STETSDFENIESPLNER	208	sp|Q96K76-2|UBP47_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4048	43.907	3	2080.905	2080.9050	K	D	811	828
PSM	VLIGGDETPEGQR	209	sp|O60701-3|UGDH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2104	28.575	2	1483.7132	1483.7132	R	A	81	94
PSM	YISPDQLADLYK	210	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4885	52.516	2	1572.8113	1572.8113	R	S	270	282
PSM	QSKPVTTPEEIAQVATISANGDK	211	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,3-UNIMOD:510,18-UNIMOD:21,23-UNIMOD:510	ms_run[1]:scan=3795	41.60714	3	2645.3427	2645.3446	K	E	158	181
PSM	VEIIANDQGNRTTPSYVAFTDTER	212	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=4071	44.10512666666666	3	2810.3301	2810.3331	K	L	26	50
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	213	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=3012	35.387836666666665	3	2965.433810	2965.439498	R	D	374	402
PSM	NVTELNEPLSNEER	214	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3164	36.51996	2	1757.8082	1756.8092	K	N	29	43
PSM	EVFEDAAEIR	215	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510	ms_run[1]:scan=2817	33.88047833333333	2	1211.6306	1211.6241	K	L	411	421
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	216	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[1]:scan=2767	33.479168333333334	4	3738.5684	3738.5749	K	-	158	196
PSM	ALINSPEGAVGR	217	sp|O00115-2|DNS2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2579	32.097	2	1296.6651	1296.6651	R	S	66	78
PSM	DLIHDQDEDEEEEEGQR	218	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1838	26.638	3	2118.9038	2118.9038	R	F	77	94
PSM	ELISNSSDALDK	219	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2812	33.843	2	1438.7229	1438.7229	R	I	47	59
PSM	ELQAAGKSPEDLER	220	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=1746	25.968	2	1689.8611	1689.8611	K	L	448	462
PSM	EQISDIDDAVR	221	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3304	37.579	2	1373.6288	1373.6288	K	K	115	126
PSM	EVELNELEPEK	222	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3228	37.01	2	1395.777	1395.7770	K	Q	11	22
PSM	FSSPTEELDYR	223	sp|O95359-2|TACC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3196	36.76	2	1456.6336	1456.6336	K	N	210	221
PSM	GATVLPANTPGNVGSGK	224	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=2115	28.655	2	1686.8978	1686.8978	R	D	324	341
PSM	GAVYSFDPVGSYQR	225	sp|P20618|PSB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4334	46.578	2	1658.7554	1658.7554	K	D	147	161
PSM	GDNITLLQSVSN	226	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4491	48.09	2	1373.6652	1373.6652	K	-	81	93
PSM	GDTVSASPCSAPLAR	227	sp|Q15477|SKIV2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2051	28.19	2	1601.7333	1601.7333	R	A	239	254
PSM	GTPLISPLIK	228	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4821	51.745	2	1265.7074	1265.7074	R	W	826	836
PSM	ITPSYVAFTPEGER	229	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3810	41.745	2	1679.802	1679.8020	R	L	61	75
PSM	LRSPAQYQVVLSER	230	sp|Q6XQN6-3|PNCB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3137	36.324	3	1758.9242	1758.9242	R	L	498	512
PSM	LSCFAQTVSPAEK	231	sp|Q16658|FSCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:4,9-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2680	32.838	2	1584.7895	1584.7895	R	W	119	132
PSM	LYTLVLTDPDAPSR	232	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4800	51.441	2	1753.8153	1753.8153	K	K	63	77
PSM	MGNTPDSASDNLGFR	233	sp|Q8NBJ7-2|SUMF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=2777	33.553	2	1710.7133	1710.7133	R	C	187	202
PSM	NDSPTQIPVSSDVCR	234	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=2672	32.779	2	1787.7973	1787.7973	R	L	656	671
PSM	NFSDNQLQEGK	235	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1551	24.515	2	1346.7103	1346.7103	R	N	161	172
PSM	QEEEAAQQGPVVVSPASDYK	236	sp|O75391|SPAG7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,14-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2724	33.157	3	2279.0995	2279.0995	R	D	145	165
PSM	SADTLWDIQK	237	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4164	44.977	2	1323.6748	1323.6748	K	D	320	330
PSM	SADTLWDIQK	238	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4317	46.435	2	1323.6748	1323.6748	K	D	320	330
PSM	TLEEDEEELFK	239	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3749	41.193	2	1448.7559	1448.7559	K	M	40	51
PSM	VYWDNGAQIISPHDK	240	sp|Q96G03-2|PGM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3583	39.783	3	1889.9349	1889.9349	K	G	37	52
PSM	VAPEEHPVLLTEAPLNPK	241	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,11-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=3835	41.95588333333333	3	2101.1483	2101.1492	R	A	96	114
PSM	TAGTSFMMTPYVVTR	242	sp|P53779|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=4458	47.75911333333333	2	1870.7838	1870.7855	R	Y	213	228
PSM	ADLNQGIGEPQSPSR	243	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[1]:scan=2048	28.168235	2	1681.786547	1681.788496	R	R	63	78
PSM	AEEYEFLTPVEEAPK	244	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4383	47.058	3	1898.9227	1898.9227	R	G	153	168
PSM	DGAVNGPSVVGDQTPIEPQTSIER	245	sp|P49321-4|NASP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=3741	41.135	3	2579.2329	2579.2329	K	L	313	337
PSM	DGNGYISAAELR	246	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3122	36.216	2	1298.6679	1298.6679	K	H	96	108
PSM	DMSPLSETEMALGK	247	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:35,14-UNIMOD:510	ms_run[2]:scan=5057	54.686	2	1671.7773	1671.7773	K	D	505	519
PSM	DVNQQEFVR	248	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1904	27.118	2	1167.6097	1167.6097	K	A	8	17
PSM	EAAENSLVAYK	249	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1959	27.517	2	1261.7191	1261.7191	K	A	121	132
PSM	EALQDVEDENQ	250	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2065	28.293	2	1322.605	1322.6050	K	-	223	234
PSM	EAYSGCSGPVDSECPPPPSSPVHK	251	sp|Q8N556|AFAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:4,19-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=1906	27.133	3	2688.1874	2688.1874	K	A	246	270
PSM	EIIDLVLDR	252	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4659	49.765	2	1118.6759	1118.6759	K	I	78	87
PSM	EKTPSAETPSEPVDWTFAQR	253	sp|O60333-3|KIF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4471	47.898	3	2503.1346	2503.1346	R	E	599	619
PSM	ELAPYDENWFYTR	254	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4955	53.293	2	1816.7922	1816.7922	K	A	44	57
PSM	FEDRSPAAECLSEK	255	sp|Q12931-2|TRAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=1648	25.23	3	1785.8281	1785.8281	K	E	511	525
PSM	FSGWYDADLSPAGHEEAK	256	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3994	43.474	3	2126.9623	2126.9623	R	R	22	40
PSM	GCESAVDELK	257	sp|A0MZ66-7|SHOT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:4,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2263	29.777	2	1254.584	1254.5840	K	G	29	39
PSM	GGNFGFGDSR	258	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2034	28.069	2	1046.4994	1046.4994	R	G	192	202
PSM	GLSEDTTEETLK	259	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1792	26.305	2	1389.7511	1389.7511	K	E	578	590
PSM	ILYSQCGDVMR	260	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=2138	28.823	2	1470.6461	1470.6461	K	A	27	38
PSM	LGAVDESLSEETQK	261	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2712	33.07	2	1652.8182	1652.8182	R	A	137	151
PSM	NDLSPTTVMSEGAR	262	sp|P30043|BLVRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3604	39.955	2	1590.7173	1590.7173	R	N	79	93
PSM	NDSVIVADQTPTPTR	263	sp|P15336-3|ATF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2402	30.817	2	1806.8014	1806.8014	R	F	60	75
PSM	QSKPVTTPEEIAQVATISANGDK	264	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=3656	40.355	3	2645.3451	2645.3451	K	E	158	181
PSM	SGQGFHGNSEVNAILSPR	265	sp|Q8TB72-2|PUM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3351	37.929	3	1982.9424	1982.9424	R	S	67	85
PSM	SGYIPSGHSLGTPEPAPR	266	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2477	31.351	3	1935.9304	1935.9304	R	A	764	782
PSM	SILSPGGSCGPIK	267	sp|P78347-5|GTF2I_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=3311	37.631	2	1419.7469	1419.7469	R	V	207	220
PSM	SSSSESEDEDVIPATQCLTPGIR	268	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,17-UNIMOD:4,19-UNIMOD:21	ms_run[2]:scan=4098	44.346	3	2591.1522	2591.1522	R	T	919	942
PSM	STGCDFAVSPK	269	sp|P55809-2|SCOT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:4,9-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2013	27.914	2	1315.6156	1315.6156	K	L	104	115
PSM	SYCAEIAHNVSSK	270	sp|P62910|RL32_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1713	25.724	3	1532.793	1532.7930	K	N	94	107
PSM	TAGTSFMMTPYVVTR	271	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=4652	49.699	2	1870.786	1870.7860	R	Y	213	228
PSM	TAGTSFMMTPYVVTR	272	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4750	50.859	2	1854.7911	1854.7911	R	Y	213	228
PSM	TTWGDGGENSPCNVVSK	273	sp|O00161|SNP23_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=2854	34.179	2	1954.8768	1954.8768	K	Q	101	118
PSM	TVIIEQSWGSPK	274	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3825	41.884	2	1491.8011	1491.8011	R	V	61	73
PSM	VIGSGCNLDSAR	275	sp|P00338-4|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1080	20.079	2	1281.656	1281.6560	R	F	100	112
PSM	YFEADPPGQVAASPDPTT	276	sp|O43598|DNPH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3576	39.729	2	1975.8665	1975.8665	R	-	157	175
PSM	QSKPVTTPEEIAQVATISANGDK	277	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:510,7-UNIMOD:21,16-UNIMOD:21,23-UNIMOD:510	ms_run[1]:scan=3656	40.35544	3	2645.3413	2645.3446	K	E	158	181
PSM	QQAAYYAQTSPQGMPQHPPAPQGQ	278	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=2821	33.90898333333333	3	2694.2059	2694.2105	R	-	621	645
PSM	EAYSGCSGPVDSECPPPPSSPVHK	279	sp|Q8N556|AFAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:4,20-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=1906	27.133448333333334	3	2688.1805	2688.1868	K	A	246	270
PSM	TDIQIALPSGCYGR	280	sp|P33316|DUT_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=4160	44.94768	2	1663.7843	1663.7848	K	V	156	170
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	281	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=2700	32.984	4	3127.3403	3127.3403	R	-	502	532
PSM	DSSDSADGRATPSENLVPSSAR	282	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2257	29.735	3	2332.0392	2332.0392	R	V	184	206
PSM	EAENQGLDISSPGMSGHR	283	sp|Q15545|TAF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=1556	24.552	3	2013.8676	2013.8676	K	Q	191	209
PSM	EATSDPSRTPEEEPLNLEGLVAHR	284	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4309	46.35	4	2760.318	2760.3180	K	V	852	876
PSM	EGHALGGGMEADGPASLQELPPSPR	285	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:35,23-UNIMOD:21	ms_run[2]:scan=3044	35.627	3	2602.1947	2602.1947	R	S	6	31
PSM	EGMNIVEAMER	286	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3972	43.297	2	1311.6375	1311.6375	K	F	74	85
PSM	ELAPEPWVERATPT	287	sp|Q9BTY7|HGH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4038	43.831	2	1708.8286	1708.8286	R	-	377	391
PSM	ELISNASDALDK	288	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3639	40.23	2	1422.728	1422.7280	R	I	42	54
PSM	ELISNSSDALDK	289	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2122	28.708	2	1358.7566	1358.7566	R	I	47	59
PSM	FLEESVSMSPEER	290	sp|P15374|UCHL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3518	39.284	2	1652.7217	1652.7217	K	A	122	135
PSM	GEPNVSYICSR	291	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2249	29.676	2	1394.6114	1394.6114	R	Y	210	221
PSM	GIETPQCDQSTGQCVCVEGVEGPR	292	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,14-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=3294	37.505	3	2776.1716	2776.1716	R	C	1138	1162
PSM	GKEDEGEEAASPMLQIQR	293	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2779	33.568	3	2135.0242	2135.0242	K	D	2400	2418
PSM	IMNTFSVVPSPK	294	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:35,4-UNIMOD:21,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3879	42.392	2	1562.7493	1562.7493	R	V	163	175
PSM	LDPGSEETQTLVR	295	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2521	31.675	2	1477.7837	1477.7837	K	E	402	415
PSM	LGDVYVNDAFGTAHR	296	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3605	39.962	3	1747.8143	1747.8143	K	A	129	144
PSM	LGGSAVISLEGKPL	297	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5169	56.387	2	1567.83	1567.8300	K	-	153	167
PSM	NDLAVVDVR	298	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2584	32.134	2	1033.598	1033.5980	K	I	334	343
PSM	NFEDVAFDEK	299	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3424	38.538	2	1280.6561	1280.6561	K	K	376	386
PSM	NLVSPAYCTQESR	300	sp|Q9NUQ3|TXLNG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=2553	31.909	2	1637.7333	1637.7333	R	E	94	107
PSM	NQLTSNPENTVFDAK	301	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3018	35.433	2	1744.9268	1744.9268	K	R	82	97
PSM	NQLTSNPENTVFDAK	302	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3704	40.847	2	1904.8595	1904.8595	K	R	82	97
PSM	RLSQSDEDVIR	303	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1607	24.928	2	1430.6979	1430.6979	K	L	119	130
PSM	RYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQR	304	sp|P0CL80-2|GG12F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,25-UNIMOD:21	ms_run[2]:scan=4348	46.697	4	4110.8917	4110.8917	R	Q	16	51
PSM	SESVEGFLSPSR	305	sp|Q08AD1-2|CAMP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3783	41.501	2	1407.6495	1407.6495	R	C	1284	1296
PSM	SSSPVTELASR	306	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2143	28.859	2	1246.6019	1246.6019	R	S	1101	1112
PSM	TAGTSFMMTPYVVTR	307	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=3525	39.337	2	1886.7809	1886.7809	R	Y	213	228
PSM	TWNDPSVQQDIK	308	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2934	34.797	2	1577.7763	1577.7763	R	F	102	114
PSM	VDSPTVTTTLK	309	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2054	28.213	2	1308.7214	1308.7214	K	N	458	469
PSM	VHSPSGALEECYVTEIDQDK	310	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:4,20-UNIMOD:510	ms_run[2]:scan=4027	43.734	3	2424.1193	2424.1193	K	Y	2360	2380
PSM	TAGTSFMMTPYVVTR	311	sp|P53779|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=3525	39.336805	2	1886.7784	1886.7804	R	Y	213	228
PSM	EATSDPSRTPEEEPLNLEGLVAHR	312	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=4309	46.349709999999995	4	2760.3158	2760.3175	K	V	852	876
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	313	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,20-UNIMOD:21,30-UNIMOD:510	ms_run[1]:scan=4366	46.861515	3	3453.6359	3453.6414	K	A	399	429
PSM	HDDSSDNFCEADDIQSPEAEYVDLLLNPER	314	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,9-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=5792	66.48448	3	3606.5082	3606.5192	K	Y	158	188
PSM	INPDGSQSVVEVPYAR	315	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=3644	40.26477666666667	2	1843.8941	1843.8924	R	S	58	74
PSM	GQLTNIVSPTAATTPR	316	sp|Q8NEY1|NAV1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=3510	39.223915000000005	2	1819.8677	1819.8689	K	I	993	1009
PSM	SESVEGFLSPSR	317	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=3783	41.50145166666667	2	1407.6488	1407.6490	R	C	1311	1323
PSM	NPSDSAVHSPFTK	318	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=1260	22.179331666666666	2	1533.7485	1533.7496	K	R	408	421
PSM	ELASPVSPELR	319	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=2866	34.283676666666665	2	1310.668477	1310.669550	K	Q	175	186
PSM	KPVTVSPTTPTSPTEGEAS	320	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,19-UNIMOD:21	ms_run[1]:scan=1716	25.747035	2	2033.019291	2033.024218	R	-	505	524
PSM	SWDSSSPVDRPEPEAASPTTR	321	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[1]:scan=2394	30.75994166666667	3	2385.065717	2385.069816	R	T	354	375
PSM	ALPSLNTGSSSPR	322	sp|O14545|TRAD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2773	33.524	2	1399.6921	1399.6921	R	G	317	330
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	323	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=3548	39.51	4	3527.556	3527.5560	K	L	104	135
PSM	DINTFVGTPVEK	324	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3847	42.086	2	1466.7694	1466.7694	K	L	1556	1568
PSM	DNLTLWTSENQGDEGDAGEGEN	325	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4567	48.889	3	2384.01	2384.0100	R	-	223	245
PSM	DQIYDIFQK	326	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=4622	49.403	2	1236.7027	1236.7027	K	L	194	203
PSM	DQVANSAFVER	327	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1922	27.252	2	1268.6573	1268.6573	K	L	500	511
PSM	EALSPCPSTVSTK	328	sp|Q08AD1-2|CAMP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1678	25.468	2	1523.7579	1523.7579	R	S	643	656
PSM	EALTYDGALLGDR	329	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3789	41.548	2	1426.7516	1426.7516	K	S	97	110
PSM	EDQTEYLEER	330	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1760	26.069	2	1344.6258	1344.6258	K	R	192	202
PSM	EFDGKSLVSVTK	331	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3603	39.948	2	1570.8145	1570.8145	K	E	527	539
PSM	EITALAPSTMK	332	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3141	36.354	2	1308.7037	1308.7037	K	I	316	327
PSM	EQVANSAFVER	333	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2081	28.406	2	1362.6393	1362.6393	K	V	492	503
PSM	GLTSVINQK	334	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3357	37.976	2	1106.6373	1106.6373	R	L	300	309
PSM	GRLTPSPDIIVLSDNEASSPR	335	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=4540	48.606	3	2417.1453	2417.1453	R	S	117	138
PSM	GSSGENNNPGSPTVSNFR	336	sp|Q99576-3|T22D3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1851	26.734	3	1933.838	1933.8380	R	Q	32	50
PSM	INPDGSQSVVEVPYAR	337	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3644	40.265	2	1843.893	1843.8930	R	S	58	74
PSM	LGDVYVNDAFGTAHR	338	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3400	38.348	3	1667.848	1667.8480	K	A	129	144
PSM	NLVTEDVMR	339	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:35	ms_run[2]:scan=1555	24.545	2	1125.5912	1125.5912	K	M	58	67
PSM	NPDDITQEEYGEFYK	340	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3863	42.259	3	1914.916	1914.9160	R	S	292	307
PSM	NVTELNEPLSNEER	341	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2591	32.185	2	1676.843	1676.8430	K	N	29	43
PSM	QASTDAGTAGALTPQHVR	342	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=671	12.42	3	1893.9158	1893.9158	R	A	107	125
PSM	RADLNQGIGEPQSPSR	343	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=1347	22.925	3	1837.8896	1837.8896	R	R	62	78
PSM	SLSSPTDNLELSLR	344	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4523	48.4	2	1644.8184	1644.8184	K	S	359	373
PSM	SPELPSPQAEK	345	sp|Q9H078-5|CLPB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1775	26.18	2	1329.6854	1329.6854	K	R	462	473
PSM	SVTSNQSDGTQESCESPDVLDR	346	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,14-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=2336	30.34	3	2524.0485	2524.0485	R	H	257	279
PSM	SWDSSSPVDRPEPEAASPTTR	347	sp|Q86WB0-2|NIPA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=2394	30.76	3	2385.0698	2385.0698	R	T	333	354
PSM	TDIQIALPSGCYGR	348	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=4160	44.948	2	1663.7853	1663.7853	K	V	68	82
PSM	TDSVIIADQTPTPTR	349	sp|P17544-5|ATF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3035	35.558	3	1807.8218	1807.8218	R	F	42	57
PSM	TFDQLTPDESK	350	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2330	30.296	2	1427.6858	1427.6858	K	E	71	82
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	351	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,14-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3589	39.829	3	2913.407	2913.4070	R	R	67	93
PSM	TLSSPSNRPSGETSVPPPPAVGR	352	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2282	29.914	3	2403.2008	2403.2008	K	M	421	444
PSM	TYLEEELDK	353	sp|Q16719-2|KYNU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=2890	34.459	2	1206.6656	1206.6656	K	W	85	94
PSM	VIEQLGTPCPEFMK	354	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=4256	45.841	3	1795.8926	1795.8926	K	K	275	289
PSM	VLTPEEQLADK	355	sp|O75822-2|EIF3J_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2501	31.528	2	1389.7429	1389.7429	K	L	107	118
PSM	VPTANVSVVDLTCR	356	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3725	41.004	3	1643.8166	1643.8166	R	L	235	249
PSM	YFQINQDEEEEEDED	357	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3181	36.646	2	1964.786	1964.7860	R	-	114	129
PSM	TLTLVDTGIGMTK	358	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4674	49.956604999999996	2	1576.7849	1576.7856	R	A	83	96
PSM	VEIIANDQGNR	359	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510	ms_run[1]:scan=1311	22.64418	2	1261.6826	1261.6834	R	I	50	61
PSM	QSKPVTTPEEIAQVATISANGDK	360	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:510,7-UNIMOD:21,23-UNIMOD:510	ms_run[1]:scan=3928	42.874320000000004	3	2566.3632	2565.3782	K	E	158	181
PSM	GKEDEGEEAASPMLQIQR	361	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,2-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1938	27.366823333333333	3	2152.0212	2151.0182	K	D	2400	2418
PSM	IFVGGLSPDTPEEK	362	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=4436	47.57995666666667	2	1715.8086	1715.8091	K	I	184	198
PSM	INPDGSQSVVEVPYAR	363	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=3666	40.43069833333333	2	1843.8941	1843.8924	R	S	58	74
PSM	YKGLNLTEDTYK	364	sp|Q08380|LG3BP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	7-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=3079	35.88340833333333	2	1557.7533	1557.7535	R	P	394	406
PSM	ELISNSSDALDK	365	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2595	32.21396166666666	2	1438.721607	1438.722891	R	I	47	59
PSM	NQLTSNPENTVFDAK	366	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3722	40.981723333333335	2	1824.891535	1824.893144	K	R	82	97
PSM	QEEEAAQQGPVVVSPASDYK	367	sp|O75391|SPAG7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,19-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=2724	33.15659333333333	3	2279.097246	2279.099508	R	D	145	165
PSM	ATAGDTHLGGEDFDNR	368	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1582	24.74	3	1708.7865	1708.7865	K	L	166	182
PSM	CAGNEDIITLR	369	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=2852	34.165	2	1294.6764	1294.6764	K	A	81	92
PSM	DETVSDCSPHIANIGR	370	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=2702	32.998	3	1883.8297	1883.8297	K	L	200	216
PSM	DLFDPIIEDR	371	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=4931	53.064	2	1265.6716	1265.6716	K	H	87	97
PSM	DLSLEEIQK	372	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=3405	38.385	2	1141.6867	1141.6867	K	K	44	53
PSM	DNLTLWTSENQGDEGDAGEGEN	373	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=4562	48.852	2	2384.01	2384.0100	R	-	223	245
PSM	DNPGVVTCLDEAR	374	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:4	ms_run[2]:scan=2908	34.59	2	1478.7248	1478.7248	K	H	187	200
PSM	DVNVNFEK	375	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:510	ms_run[2]:scan=2326	30.268	2	1031.5924	1031.5924	K	S	26	34
PSM	EGMNIVEAMER	376	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:35	ms_run[2]:scan=2920	34.678	2	1327.6324	1327.6324	K	F	74	85
PSM	EHYPVSSPSSPSPPAQPGGVSR	377	sp|O75179-4|ANR17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1951	27.46	3	2333.0902	2333.0902	K	N	1443	1465
PSM	FLDGIYVSEK	378	sp|P32969|RL9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4086	44.218	2	1317.6894	1317.6894	K	G	175	185
PSM	GADFLVTEVENGGSLGSK	379	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,14-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4788	51.281	3	1926.9612	1926.9612	K	K	189	207
PSM	GDFCIQVGR	380	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=2851	34.158	2	1084.5548	1084.5548	R	N	91	100
PSM	GDYPLEAVR	381	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2451	31.164	2	1052.5715	1052.5715	K	M	368	377
PSM	GSTDNLMDDIER	382	sp|P50990-3|TCPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=3531	39.381	2	1398.6509	1398.6509	R	A	306	318
PSM	GTVTDFPGFDER	383	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=3763	41.338	2	1373.6676	1373.6676	R	A	7	19
PSM	HGESAWNLENR	384	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1694	25.588	2	1345.6587	1345.6587	R	F	11	22
PSM	HGGPGPGGPEPELSPITEGSEAR	385	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2947	34.893	3	2341.08	2341.0800	R	A	554	577
PSM	KITIADCGQLE	386	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2624	32.425	2	1314.749	1314.7490	K	-	95	106
PSM	LEFQQQLGEAPSDASP	387	sp|Q9BUW7|BBLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=4457	47.752	2	1829.8297	1829.8297	R	-	68	84
PSM	LQQGAGLESPQGQPEPGAASPQR	388	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2057	28.234	3	2416.1596	2416.1596	R	Q	72	95
PSM	NNSGEEFDCAFR	389	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2741	33.286	2	1478.6309	1478.6309	R	L	355	367
PSM	NSDVLQSPLDSAARDEL	390	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4649	49.676	3	1942.9097	1942.9097	K	-	606	623
PSM	NSGSFPSPSISPR	391	sp|Q9ULD2-4|MTUS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3230	37.025	2	1525.6428	1525.6428	R	-	330	343
PSM	NSLESYAFNMK	392	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2968	35.064	2	1386.7126	1386.7126	K	A	540	551
PSM	QFAEMYVAK	393	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=2714	33.086	2	1153.6478	1153.6478	K	F	227	236
PSM	QLGQDLLNSYIENEGK	394	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4998	53.87	3	1967.9878	1967.9878	R	M	591	607
PSM	QLSSGVSEIR	395	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2103	28.568	2	1188.5964	1188.5964	R	H	80	90
PSM	QQAAYYAQTSPQGMPQHPPAPQGQ	396	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=2084	28.428	3	2710.2059	2710.2059	R	-	621	645
PSM	SADTLWDIQK	397	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4816	51.693	2	1403.6411	1403.6411	K	D	320	330
PSM	SCAHDWVYE	398	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=2439	31.078	2	1279.4793	1279.4793	K	-	129	138
PSM	SLTNDWEDHLAVK	399	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4161	44.955	3	1674.8291	1674.8291	K	H	315	328
PSM	STAGDTHLGGEDFDNR	400	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1523	24.313	3	1724.7814	1724.7814	K	M	221	237
PSM	SVTEQGAELSNEER	401	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1761	26.076	3	1661.7358	1661.7358	K	N	28	42
PSM	TDGFAEAIHSPQVAGVPR	402	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3596	39.882	3	1964.957	1964.9570	R	F	2146	2164
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	403	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,23-UNIMOD:21,30-UNIMOD:510	ms_run[2]:scan=4366	46.862	3	3453.6419	3453.6419	K	A	362	392
PSM	TSDIFGSPVTATSR	404	sp|Q9H910-2|JUPI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3599	39.919	2	1551.7394	1551.7394	K	L	75	89
PSM	TTLPQDCSNPAPLSSPLNGVHDR	405	sp|P16278-2|BGAL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=3388	38.258	3	2589.2107	2589.2107	R	A	289	312
PSM	VSSPTVNTTLR	406	sp|Q9NSK0-5|KLC4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1738	25.91	2	1287.6648	1287.6648	K	N	381	392
PSM	DNLTLWTSDQQDDDGGEGNN	407	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510	ms_run[1]:scan=4681	50.00987833333333	3	2226.9351	2226.9356	R	-	228	248
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	408	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=2858	34.20970666666666	4	3207.3020	3207.3061	R	-	738	768
PSM	SVTEQGAELSNEER	409	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=1761	26.076485	3	1661.7340	1661.7353	K	N	28	42
PSM	VLPGVDALSNI	410	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=5390	60.002858333333336	2	1210.642136	1210.642273	K	-	407	418
PSM	TTLPQDCSNPAPLSSPLNGVHDR	411	sp|P16278|BGAL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,7-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=3388	38.258015	3	2589.2059	2589.2102	R	A	420	443
PSM	GRLTPSPDIIVLSDNEASSPR	412	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=4540	48.60646166666666	3	2417.1436	2417.1448	R	S	117	138
PSM	TEPVALEPRCAADAGMKR	413	sp|Q8N2K0-3|ABD12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:4,16-UNIMOD:35,17-UNIMOD:510	ms_run[1]:scan=4434	47.565353333333334	2	2137.0502	2135.0532	R	A	5	23
PSM	ISLEQPPNGSDTPNPEK	414	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,12-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=2762	33.441226666666665	3	1970.9692	1969.9662	R	Y	694	711
PSM	AAEEAFVNDIDESSPGTEWER	415	sp|P09496-5|CLCA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=4639	49.572	3	2465.0484	2465.0484	R	V	111	132
PSM	ADLLLSTQPGREEGSPLELER	416	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=4343	46.645	3	2423.2158	2423.2158	K	L	492	513
PSM	AELNEFLTR	417	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=3530	39.374	2	1125.6242	1125.6242	K	E	19	28
PSM	AEVLSEEPILK	418	sp|Q7L1Q6-2|BZW1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3267	37.306	2	1294.8021	1294.8021	K	W	303	314
PSM	AGDLLEDSPK	419	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=1818	26.492	2	1111.6397	1111.6397	R	R	151	161
PSM	AGFAGDDAPR	420	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=663	12.364	2	1009.5041	1009.5041	K	A	19	29
PSM	AGNFYVPAEPK	421	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2633	32.491	2	1259.7187	1259.7187	K	L	78	89
PSM	CLGLTEAQTR	422	sp|P31327-3|CPSM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:4	ms_run[2]:scan=1702	25.646	2	1181.6287	1181.6287	K	E	926	936
PSM	DGARPDVTESESGSPEYR	423	sp|P10696|PPBN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=1447	23.749	3	2064.885	2064.8850	K	Q	422	440
PSM	DRSSFYVNGLTLGGQK	424	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4461	47.781	3	1968.9384	1968.9384	K	C	55	71
PSM	DSPSVWAAVPGK	425	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4061	44.004	2	1360.7065	1360.7065	K	T	27	39
PSM	DTGKTPVEPEVAIHR	426	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,4-UNIMOD:510	ms_run[2]:scan=1917	27.214	3	1795.9506	1795.9506	K	I	5	20
PSM	EAAGGNDSSGATSPINPAVALE	427	sp|P32004-3|L1CAM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4468	47.875	2	2140.9738	2140.9738	K	-	1227	1249
PSM	EITALAPSTMK	428	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3735	41.077	2	1388.67	1388.6700	K	I	316	327
PSM	ETAEAYLGK	429	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=1708	25.688	2	1048.6077	1048.6077	K	K	155	164
PSM	ETPHSPGVEDAPIAK	430	sp|Q9UHB6-3|LIMA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1573	24.676	3	1694.8553	1694.8553	R	V	184	199
PSM	GYSFTTTAER	431	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=1847	26.705	2	1165.5828	1165.5828	R	E	197	207
PSM	INPDGSQSVVEVPYAR	432	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3645	40.272	3	1843.893	1843.8930	R	S	58	74
PSM	IQIAPDSGGLPER	433	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3288	37.461	2	1465.739	1465.7390	K	S	134	147
PSM	ISYIPDEEVSSPSPPQR	434	sp|Q9Y6M1-5|IF2B2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3594	39.867	3	2013.9509	2013.9509	K	A	89	106
PSM	KSEAGHASSPDSEVTSLCQK	435	sp|Q6NZY4-2|ZCHC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:21,18-UNIMOD:4,20-UNIMOD:510	ms_run[2]:scan=1597	24.853	3	2299.1252	2299.1252	K	E	352	372
PSM	LAIQGPEDSPSR	436	sp|Q15773|MLF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2268	29.813	2	1382.6655	1382.6655	R	Q	230	242
PSM	LASAVELWR	437	sp|Q13459-2|MYO9B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4557	48.774	2	1157.6058	1157.6058	R	G	1306	1315
PSM	LATQLTGPVMPVR	438	sp|P26373-2|RL13_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=4331	46.542	3	1575.7709	1575.7709	K	N	99	112
PSM	LQLDSPEDAEFIVAK	439	sp|O43242-2|PSMD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4973	53.5	2	1821.9438	1821.9438	K	A	288	303
PSM	QSQIQVFEDGADTTSPETPDSSASK	440	sp|Q14203-3|DCTN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,18-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3687	40.64	3	2772.2651	2772.2651	R	V	74	99
PSM	RRDEDMLYSPELAQR	441	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2836	34.019	3	1991.9348	1991.9348	R	G	229	244
PSM	SIYYITGESK	442	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2685	32.875	2	1227.7023	1227.7023	K	E	482	492
PSM	SPSDSSTASTPVAEQIER	443	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2102	28.56	3	1974.8996	1974.8996	R	A	337	355
PSM	SSSSVTTSETQPCTPSSSDYSDLQR	444	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,13-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2558	31.945	3	2820.1857	2820.1857	K	V	322	347
PSM	STARFTLNPNPTGVQNPHIER	445	sp|P45985|MP2K4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3318	37.685	4	2542.1943	2542.1943	K	L	55	76
PSM	SVFGTPTLETANK	446	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3539	39.442	2	1511.7909	1511.7909	K	N	1140	1153
PSM	TAGTSFMMTPYVVTR	447	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3095	36.017	3	1886.7809	1886.7809	R	Y	213	228
PSM	TAGTSFMMTPYVVTR	448	sp|P53779-2|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3002	35.314	2	1886.7809	1886.7809	R	Y	213	228
PSM	TDLLLEPYNK	449	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3798	41.63	2	1272.7602	1272.7602	K	Y	154	164
PSM	TGAAPIIDVVR	450	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=3238	37.088	2	1144.7028	1144.7028	K	S	95	106
PSM	TGLYNYYDDEK	451	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2871	34.321	2	1447.7144	1447.7144	R	E	240	251
PSM	TQPDGTSVPGEPASPISQR	452	sp|Q14980-5|NUMA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2405	30.839	3	2036.9628	2036.9628	R	L	608	627
PSM	VEVTEFEDIK	453	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3688	40.647	2	1275.7235	1275.7235	R	S	98	108
PSM	VIGSGCNLDSAR	454	sp|P00338-4|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=1821	26.514	2	1361.6223	1361.6223	R	F	100	112
PSM	VVTDTDETELAR	455	sp|P05198|IF2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1931	27.317	2	1461.6812	1461.6812	K	Q	277	289
PSM	YAGLTFPK	456	sp|P53779-2|MK10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=3960	43.194	2	1123.5392	1123.5392	K	L	304	312
PSM	YHTSQSGDEMTSLSEYVSR	457	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=2786	33.636	3	2305.9622	2305.9622	R	M	457	476
PSM	YHTSQSGDEMTSLSEYVSR	458	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3730	41.041	3	2289.9673	2289.9673	R	M	457	476
PSM	YHTSQSGDEMTSLSEYVSR	459	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3921	42.808	3	2289.9673	2289.9673	R	M	457	476
PSM	EITALAPSTMK	460	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=3735	41.07705	2	1388.6691	1388.6695	K	I	316	327
PSM	TAGTSFMMTPYVVTR	461	sp|P53779|MK10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,8-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=4132	44.657555	3	1870.7845	1870.7855	R	Y	213	228
PSM	ESVPEFPLSPPK	462	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=4337	46.60023833333333	2	1473.7785	1473.7788	K	K	30	42
PSM	EILVGDVGQTVDDPYATFVK	463	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,10-UNIMOD:21,17-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=5433	60.58170333333333	3	2393.1459	2393.1476	K	M	54	74
PSM	DRSSFYVNGLTLGGQK	464	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=4461	47.780964999999995	3	1968.9376	1968.9379	K	C	55	71
PSM	DRAATSPALFNR	465	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=2199	29.292938333333332	3	1431.7072	1431.7079	K	C	3077	3089
PSM	SGLTVPTSPK	466	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=2047	28.161451666666665	2	1133.6360	1133.6365	R	G	87	97
PSM	GALTLSSPEVR	467	sp|Q9Y2L1|RRP44_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=2823	33.923590000000004	2	1242.6420	1242.6428	K	F	628	639
PSM	AACALLNSGGGVIRMAK	468	sp|Q7Z7L1|SLN11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:4,8-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=4696	50.137548333333335	2	1817.9139	1817.9100	R	K	49	66
PSM	DNCASMNLQMTAFFSEK	469	sp|Q8WXX0|DYH7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:4,5-UNIMOD:21,15-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=4685	50.03989	2	2220.9006	2220.8963	K	I	1575	1592
PSM	VQISPDSGGLPER	470	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=2740	33.27871833333334	2	1467.717426	1467.718292	K	S	178	191
PSM	EAENQGLDISSPGMSGHR	471	sp|Q15545|TAF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1556	24.55167833333333	3	2013.865764	2013.867552	K	Q	191	209