MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100607_003EPHA6.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100607_003EPHA6.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	48.0	null	314-UNIMOD:510,324-UNIMOD:21,315-UNIMOD:35,319-UNIMOD:21	0.08	48.0	2	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	45.0	null	207-UNIMOD:510,214-UNIMOD:21,218-UNIMOD:35,210-UNIMOD:21,207-UNIMOD:21,31-UNIMOD:510,38-UNIMOD:21	0.19	45.0	7	2	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	228-UNIMOD:510	0.09	44.0	4	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	198-UNIMOD:510,206-UNIMOD:21,197-UNIMOD:510,217-UNIMOD:21,222-UNIMOD:510,154-UNIMOD:510,47-UNIMOD:510,48-UNIMOD:21	0.13	43.0	5	5	3
PRT	sp|O00410-2|IPO5_HUMAN	Isoform 2 of Importin-5 OS=Homo sapiens OX=9606 GN=IPO5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	755-UNIMOD:510,760-UNIMOD:21,781-UNIMOD:510	0.03	43.0	1	1	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	431-UNIMOD:510,432-UNIMOD:21,439-UNIMOD:21	0.05	43.0	10	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	42.0	null	33-UNIMOD:510,44-UNIMOD:21,203-UNIMOD:510,221-UNIMOD:510,270-UNIMOD:510,270-UNIMOD:21,281-UNIMOD:510,280-UNIMOD:21,272-UNIMOD:21,286-UNIMOD:510,287-UNIMOD:21,306-UNIMOD:510,54-UNIMOD:510,263-UNIMOD:510,268-UNIMOD:21,93-UNIMOD:510,103-UNIMOD:510	0.22	42.0	11	7	6
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	36-UNIMOD:510,45-UNIMOD:21,52-UNIMOD:510,126-UNIMOD:510,128-UNIMOD:21	0.09	42.0	2	2	2
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	1482-UNIMOD:510,1487-UNIMOD:21,368-UNIMOD:510,377-UNIMOD:21,382-UNIMOD:510,882-UNIMOD:510,883-UNIMOD:21	0.03	42.0	3	3	2
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	379-UNIMOD:510,385-UNIMOD:4,390-UNIMOD:21,657-UNIMOD:510,670-UNIMOD:21,665-UNIMOD:21,69-UNIMOD:510,71-UNIMOD:21	0.07	42.0	4	3	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null	223-UNIMOD:510,140-UNIMOD:510,149-UNIMOD:21,157-UNIMOD:510,158-UNIMOD:510,28-UNIMOD:510,194-UNIMOD:510,211-UNIMOD:21,212-UNIMOD:510,145-UNIMOD:21,12-UNIMOD:510,19-UNIMOD:21,22-UNIMOD:35,25-UNIMOD:4,27-UNIMOD:510	0.39	41.0	10	6	3
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	396-UNIMOD:510,397-UNIMOD:21,416-UNIMOD:21,388-UNIMOD:510,395-UNIMOD:510,181-UNIMOD:510,188-UNIMOD:21,277-UNIMOD:510,277-UNIMOD:21,280-UNIMOD:4,281-UNIMOD:4,278-UNIMOD:35,78-UNIMOD:510	0.16	41.0	15	5	3
PRT	sp|O14818-2|PSA7_HUMAN	Isoform 2 of Proteasome subunit alpha type-7 OS=Homo sapiens OX=9606 GN=PSMA7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	105-UNIMOD:510,106-UNIMOD:21,119-UNIMOD:510	0.09	40.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	105-UNIMOD:510,114-UNIMOD:21,122-UNIMOD:510,250-UNIMOD:510,252-UNIMOD:21,262-UNIMOD:510	0.09	40.0	2	2	2
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	431-UNIMOD:510,432-UNIMOD:21,423-UNIMOD:510,430-UNIMOD:510,425-UNIMOD:35	0.06	39.0	4	2	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	140-UNIMOD:510,149-UNIMOD:21,157-UNIMOD:510,28-UNIMOD:510,158-UNIMOD:510,223-UNIMOD:510,237-UNIMOD:4,194-UNIMOD:510,211-UNIMOD:21,212-UNIMOD:510	0.32	39.0	7	5	3
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	142-UNIMOD:510,142-UNIMOD:21,153-UNIMOD:4,157-UNIMOD:510,118-UNIMOD:510,119-UNIMOD:21,134-UNIMOD:21,138-UNIMOD:510,118-UNIMOD:21,91-UNIMOD:510,92-UNIMOD:21,100-UNIMOD:510,133-UNIMOD:21,22-UNIMOD:510,26-UNIMOD:21,39-UNIMOD:510	0.27	39.0	6	4	3
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	383-UNIMOD:510,391-UNIMOD:21,394-UNIMOD:21,398-UNIMOD:510,389-UNIMOD:21,395-UNIMOD:21,728-UNIMOD:510,730-UNIMOD:21,738-UNIMOD:21	0.03	38.0	4	2	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	292-UNIMOD:510,294-UNIMOD:21,305-UNIMOD:35,239-UNIMOD:21,239-UNIMOD:510,360-UNIMOD:510,362-UNIMOD:21,240-UNIMOD:21,19-UNIMOD:510,51-UNIMOD:510,53-UNIMOD:21,61-UNIMOD:510,197-UNIMOD:510,198-UNIMOD:21,297-UNIMOD:21,306-UNIMOD:21	0.23	38.0	14	6	2
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	2027-UNIMOD:510,2034-UNIMOD:21,2041-UNIMOD:35,2450-UNIMOD:510,2462-UNIMOD:21,2468-UNIMOD:4,2471-UNIMOD:510,275-UNIMOD:510,275-UNIMOD:21,289-UNIMOD:21,298-UNIMOD:510,277-UNIMOD:21,2032-UNIMOD:21,2454-UNIMOD:21,2450-UNIMOD:21,42-UNIMOD:510,45-UNIMOD:21	0.03	38.0	11	4	1
PRT	sp|P29353-5|SHC1_HUMAN	Isoform 5 of SHC-transforming protein 1 OS=Homo sapiens OX=9606 GN=SHC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	206-UNIMOD:510,213-UNIMOD:21,221-UNIMOD:510	0.05	37.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	472-UNIMOD:510,481-UNIMOD:21,493-UNIMOD:510	0.04	37.0	1	1	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	18-UNIMOD:510,22-UNIMOD:21,28-UNIMOD:4,33-UNIMOD:4,34-UNIMOD:510,29-UNIMOD:35,18-UNIMOD:21,19-UNIMOD:21	0.17	37.0	5	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	82-UNIMOD:510,94-UNIMOD:21,469-UNIMOD:510,502-UNIMOD:510	0.10	37.0	3	2	1
PRT	sp|O75208-2|COQ9_HUMAN	Isoform 2 of Ubiquinone biosynthesis protein COQ9, mitochondrial OS=Homo sapiens OX=9606 GN=COQ9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	82-UNIMOD:510,93-UNIMOD:21	0.16	37.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	292-UNIMOD:510,301-UNIMOD:21,306-UNIMOD:510,305-UNIMOD:21,42-UNIMOD:510,53-UNIMOD:510,492-UNIMOD:510,457-UNIMOD:510,472-UNIMOD:21,482-UNIMOD:510,491-UNIMOD:510,484-UNIMOD:21,485-UNIMOD:21,459-UNIMOD:21,457-UNIMOD:21	0.10	37.0	13	5	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	127-UNIMOD:510,133-UNIMOD:21,135-UNIMOD:21,129-UNIMOD:21,90-UNIMOD:510,91-UNIMOD:21,94-UNIMOD:21,97-UNIMOD:510	0.11	37.0	4	2	1
PRT	sp|Q9UF33|EPHA6_HUMAN	Ephrin type-A receptor 6 OS=Homo sapiens OX=9606 GN=EPHA6 PE=2 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	605-UNIMOD:510,605-UNIMOD:21,611-UNIMOD:21,624-UNIMOD:510,612-UNIMOD:21,606-UNIMOD:21,616-UNIMOD:21,822-UNIMOD:510,831-UNIMOD:21,837-UNIMOD:510,834-UNIMOD:21,788-UNIMOD:510,788-UNIMOD:21,790-UNIMOD:21,794-UNIMOD:21	0.05	37.0	15	4	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	223-UNIMOD:510,139-UNIMOD:510,149-UNIMOD:21,157-UNIMOD:510,194-UNIMOD:510,211-UNIMOD:21,212-UNIMOD:510,12-UNIMOD:510,19-UNIMOD:21,27-UNIMOD:510	0.33	36.0	6	4	2
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	446-UNIMOD:510,456-UNIMOD:21,454-UNIMOD:21	0.03	36.0	2	1	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	120-UNIMOD:510,123-UNIMOD:21,145-UNIMOD:510,25-UNIMOD:510,26-UNIMOD:21,29-UNIMOD:35	0.16	36.0	3	2	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	108-UNIMOD:510,125-UNIMOD:21,33-UNIMOD:510,39-UNIMOD:21	0.09	36.0	3	2	1
PRT	sp|O94906-2|PRP6_HUMAN	Isoform 2 of Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	97-UNIMOD:510,105-UNIMOD:21,110-UNIMOD:510	0.02	35.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	444-UNIMOD:510,458-UNIMOD:21,463-UNIMOD:510,448-UNIMOD:21,449-UNIMOD:21,560-UNIMOD:510,565-UNIMOD:21,570-UNIMOD:510,567-UNIMOD:21	0.05	35.0	8	2	0
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	14-UNIMOD:510,19-UNIMOD:21,32-UNIMOD:21,35-UNIMOD:510,34-UNIMOD:21,446-UNIMOD:510,446-UNIMOD:4,456-UNIMOD:21	0.05	35.0	4	2	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	54-UNIMOD:510,68-UNIMOD:21,73-UNIMOD:510,70-UNIMOD:21,133-UNIMOD:510,139-UNIMOD:4,140-UNIMOD:21,144-UNIMOD:510,82-UNIMOD:510,82-UNIMOD:21,85-UNIMOD:21,92-UNIMOD:510,89-UNIMOD:21	0.28	35.0	8	3	0
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	94-UNIMOD:510,106-UNIMOD:21,113-UNIMOD:510,63-UNIMOD:510,64-UNIMOD:21	0.19	35.0	3	2	1
PRT	sp|Q9Y262-2|EIF3L_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	195-UNIMOD:510,199-UNIMOD:21,356-UNIMOD:510,361-UNIMOD:21,369-UNIMOD:4,371-UNIMOD:510,88-UNIMOD:510,89-UNIMOD:21,95-UNIMOD:21,101-UNIMOD:510,39-UNIMOD:510,45-UNIMOD:21,53-UNIMOD:510	0.13	35.0	4	4	4
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	70-UNIMOD:510,72-UNIMOD:21,255-UNIMOD:510,256-UNIMOD:21,67-UNIMOD:510	0.07	35.0	4	3	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	92-UNIMOD:510,97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,106-UNIMOD:21,112-UNIMOD:4,116-UNIMOD:4,117-UNIMOD:510,462-UNIMOD:510,462-UNIMOD:21,468-UNIMOD:4	0.08	35.0	2	2	2
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	549-UNIMOD:510,556-UNIMOD:21,563-UNIMOD:510,559-UNIMOD:21,553-UNIMOD:21,555-UNIMOD:21	0.02	35.0	3	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	20-UNIMOD:510,31-UNIMOD:21,30-UNIMOD:21,592-UNIMOD:510,593-UNIMOD:35,597-UNIMOD:21,603-UNIMOD:510,333-UNIMOD:510,336-UNIMOD:21,652-UNIMOD:510,660-UNIMOD:21,668-UNIMOD:510	0.07	34.0	5	4	3
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	228-UNIMOD:510,143-UNIMOD:510,154-UNIMOD:21,155-UNIMOD:510,144-UNIMOD:510	0.14	34.0	3	3	3
PRT	sp|Q8WVJ2|NUDC2_HUMAN	NudC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NUDCD2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	130-UNIMOD:510,146-UNIMOD:21,147-UNIMOD:510,145-UNIMOD:21	0.12	34.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510,728-UNIMOD:510,728-UNIMOD:4,730-UNIMOD:21,367-UNIMOD:510,369-UNIMOD:4,373-UNIMOD:21,386-UNIMOD:510,383-UNIMOD:35,689-UNIMOD:510,693-UNIMOD:4,697-UNIMOD:35	0.07	34.0	6	4	2
PRT	sp|Q15427|SF3B4_HUMAN	Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	10-UNIMOD:510,16-UNIMOD:21,23-UNIMOD:510	0.04	34.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	4-UNIMOD:510,6-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q96FW1|OTUB1_HUMAN	Ubiquitin thioesterase OTUB1 OS=Homo sapiens OX=9606 GN=OTUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	11-UNIMOD:510,23-UNIMOD:4,26-UNIMOD:21	0.10	34.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	385-UNIMOD:510,391-UNIMOD:21,402-UNIMOD:510	0.03	34.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	20-UNIMOD:510,30-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	232-UNIMOD:510,236-UNIMOD:21,242-UNIMOD:21,245-UNIMOD:510	0.06	34.0	3	2	1
PRT	sp|P54646|AAPK2_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens OX=9606 GN=PRKAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	172-UNIMOD:510,174-UNIMOD:4,179-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	268-UNIMOD:510,270-UNIMOD:21,275-UNIMOD:21,283-UNIMOD:510,269-UNIMOD:21,276-UNIMOD:21	0.02	34.0	3	1	0
PRT	sp|P20618|PSB1_HUMAN	Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	147-UNIMOD:510,150-UNIMOD:21,158-UNIMOD:21	0.06	34.0	2	1	0
PRT	sp|P36871-2|PGM1_HUMAN	Isoform 2 of Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	489-UNIMOD:510,494-UNIMOD:21,441-UNIMOD:510,448-UNIMOD:21,458-UNIMOD:510	0.06	33.0	2	2	2
PRT	sp|P35080-2|PROF2_HUMAN	Isoform IIb of Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	76-UNIMOD:510,79-UNIMOD:21,84-UNIMOD:4,86-UNIMOD:35	0.11	33.0	2	1	0
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	75-UNIMOD:510,84-UNIMOD:35	0.13	33.0	1	1	1
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	256-UNIMOD:510,263-UNIMOD:21,38-UNIMOD:510,47-UNIMOD:21,59-UNIMOD:510,272-UNIMOD:510,275-UNIMOD:21,281-UNIMOD:510,103-UNIMOD:510,106-UNIMOD:21	0.19	33.0	5	4	3
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	323-UNIMOD:510,40-UNIMOD:510,44-UNIMOD:21,47-UNIMOD:510	0.08	33.0	2	2	2
PRT	sp|Q9NYU2|UGGG1_HUMAN	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	null	440-UNIMOD:510,449-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|P62191-2|PRS4_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	106-UNIMOD:510,111-UNIMOD:21,125-UNIMOD:510,110-UNIMOD:21	0.06	32.0	2	1	0
PRT	sp|P04818|TYSY_HUMAN	Thymidylate synthase OS=Homo sapiens OX=9606 GN=TYMS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	148-UNIMOD:510,153-UNIMOD:21,151-UNIMOD:21	0.05	32.0	2	1	0
PRT	sp|Q9UKV3-3|ACINU_HUMAN	Isoform 3 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	323-UNIMOD:510,325-UNIMOD:4,328-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	112-UNIMOD:510,121-UNIMOD:21,125-UNIMOD:510,98-UNIMOD:510,107-UNIMOD:510,130-UNIMOD:510,142-UNIMOD:510	0.15	32.0	3	3	3
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	32.0	2	1	0
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	138-UNIMOD:510,141-UNIMOD:21,148-UNIMOD:4,185-UNIMOD:510,195-UNIMOD:21,196-UNIMOD:510,194-UNIMOD:21	0.09	32.0	3	2	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	85-UNIMOD:510,89-UNIMOD:21,93-UNIMOD:4,90-UNIMOD:21	0.04	32.0	2	1	0
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	156-UNIMOD:510,169-UNIMOD:21,176-UNIMOD:510	0.08	32.0	2	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	234-UNIMOD:510,243-UNIMOD:21,246-UNIMOD:21,263-UNIMOD:510,266-UNIMOD:21,267-UNIMOD:4,271-UNIMOD:35	0.09	32.0	4	2	0
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	null	268-UNIMOD:510,268-UNIMOD:21,277-UNIMOD:21,283-UNIMOD:510	0.02	32.0	1	1	0
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	540-UNIMOD:510,547-UNIMOD:21,551-UNIMOD:4,556-UNIMOD:35	0.03	31.0	3	1	0
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	309-UNIMOD:510,316-UNIMOD:21,4-UNIMOD:510,4-UNIMOD:21,14-UNIMOD:510,466-UNIMOD:510,474-UNIMOD:21,476-UNIMOD:510	0.08	31.0	3	3	3
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	158-UNIMOD:510,166-UNIMOD:4,178-UNIMOD:21,120-UNIMOD:510,121-UNIMOD:21,131-UNIMOD:4,120-UNIMOD:21	0.10	31.0	3	2	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	231-UNIMOD:510,239-UNIMOD:21,247-UNIMOD:21,250-UNIMOD:35,256-UNIMOD:510	0.09	31.0	2	1	0
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	328-UNIMOD:510,330-UNIMOD:21,340-UNIMOD:510	0.03	31.0	1	1	1
PRT	sp|Q9NZ63|TLS1_HUMAN	Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	141-UNIMOD:510,145-UNIMOD:4,147-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|P21980|TGM2_HUMAN	Protein-glutamine gamma-glutamyltransferase 2 OS=Homo sapiens OX=9606 GN=TGM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	365-UNIMOD:510,369-UNIMOD:21,370-UNIMOD:4,371-UNIMOD:4,368-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|P19387|RPB3_HUMAN	DNA-directed RNA polymerase II subunit RPB3 OS=Homo sapiens OX=9606 GN=POLR2C PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	206-UNIMOD:510,206-UNIMOD:21,225-UNIMOD:510,208-UNIMOD:21	0.09	31.0	2	1	0
PRT	sp|Q04837|SSBP_HUMAN	Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	67-UNIMOD:510,73-UNIMOD:21,81-UNIMOD:510	0.11	31.0	1	1	1
PRT	sp|P67775-2|PP2AA_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	75-UNIMOD:510,80-UNIMOD:21,83-UNIMOD:35	0.06	31.0	2	1	0
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	31.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	228-UNIMOD:510,239-UNIMOD:21,242-UNIMOD:35	0.04	31.0	3	1	0
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	31.0	2	1	0
PRT	sp|P62847-2|RS24_HUMAN	Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	69-UNIMOD:510,76-UNIMOD:21,81-UNIMOD:21,83-UNIMOD:510,74-UNIMOD:35	0.12	31.0	2	1	0
PRT	sp|Q9GZT8-3|NIF3L_HUMAN	Isoform 3 of NIF3-like protein 1 OS=Homo sapiens OX=9606 GN=NIF3L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	169-UNIMOD:510,175-UNIMOD:21,181-UNIMOD:510	0.05	31.0	1	1	1
PRT	sp|Q56P03|EAPP_HUMAN	E2F-associated phosphoprotein OS=Homo sapiens OX=9606 GN=EAPP PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	101-UNIMOD:510,106-UNIMOD:21	0.06	31.0	1	1	1
PRT	sp|O15460-2|P4HA2_HUMAN	Isoform IIa of Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens OX=9606 GN=P4HA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	341-UNIMOD:510,342-UNIMOD:21,345-UNIMOD:35	0.02	31.0	2	1	0
PRT	sp|P35080|PROF2_HUMAN	Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	null	76-UNIMOD:510,77-UNIMOD:21,84-UNIMOD:4,86-UNIMOD:35	0.11	31.0	1	1	0
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	153-UNIMOD:510,156-UNIMOD:21,167-UNIMOD:510	0.08	30.0	2	1	0
PRT	sp|O43237-2|DC1L2_HUMAN	Isoform 2 of Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	103-UNIMOD:510,107-UNIMOD:21,114-UNIMOD:4	0.05	30.0	2	1	0
PRT	sp|O43707-2|ACTN4_HUMAN	Isoform ACTN4ISO of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	651-UNIMOD:510,659-UNIMOD:21,660-UNIMOD:4,177-UNIMOD:510,178-UNIMOD:21,664-UNIMOD:510,667-UNIMOD:21,679-UNIMOD:21,680-UNIMOD:510	0.06	30.0	4	3	2
PRT	sp|Q13405|RM49_HUMAN	39S ribosomal protein L49, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL49 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	38-UNIMOD:510,45-UNIMOD:21	0.08	30.0	2	1	0
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	29-UNIMOD:510,42-UNIMOD:510,61-UNIMOD:510	0.07	30.0	2	2	2
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	45-UNIMOD:510,58-UNIMOD:21,64-UNIMOD:510	0.03	30.0	2	1	0
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	244-UNIMOD:510,246-UNIMOD:21,255-UNIMOD:4,256-UNIMOD:510,232-UNIMOD:510,97-UNIMOD:510,104-UNIMOD:4,106-UNIMOD:510	0.13	30.0	3	3	3
PRT	sp|Q9Y2Z0-2|SGT1_HUMAN	Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	280-UNIMOD:510,285-UNIMOD:21,293-UNIMOD:510,94-UNIMOD:510,95-UNIMOD:21,107-UNIMOD:510	0.09	30.0	2	2	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	310-UNIMOD:510,314-UNIMOD:21,320-UNIMOD:21,321-UNIMOD:21	0.04	30.0	3	1	0
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	105-UNIMOD:510,112-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|O14786-3|NRP1_HUMAN	Isoform 3 of Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	539-UNIMOD:510,546-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	194-UNIMOD:510,197-UNIMOD:21,202-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q15369|ELOC_HUMAN	Elongin-C OS=Homo sapiens OX=9606 GN=ELOC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	7-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:21,20-UNIMOD:510	0.13	30.0	2	1	0
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	95-UNIMOD:510,95-UNIMOD:21,106-UNIMOD:510	0.09	30.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	300-UNIMOD:510,309-UNIMOD:21,313-UNIMOD:21,314-UNIMOD:510,547-UNIMOD:510,558-UNIMOD:510,500-UNIMOD:510,251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,490-UNIMOD:510,492-UNIMOD:21,493-UNIMOD:21,499-UNIMOD:510,284-UNIMOD:510,292-UNIMOD:510,284-UNIMOD:21,192-UNIMOD:510,197-UNIMOD:21,47-UNIMOD:510,58-UNIMOD:510,282-UNIMOD:510,283-UNIMOD:510,154-UNIMOD:510,160-UNIMOD:21	0.17	30.0	14	10	7
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	228-UNIMOD:510,234-UNIMOD:21,225-UNIMOD:510,134-UNIMOD:510,137-UNIMOD:21,150-UNIMOD:510	0.04	30.0	3	3	3
PRT	sp|O96019|ACL6A_HUMAN	Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	null	63-UNIMOD:510,69-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	129-UNIMOD:510,135-UNIMOD:21,144-UNIMOD:510,133-UNIMOD:21,130-UNIMOD:21	0.07	30.0	5	1	0
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	665-UNIMOD:510,667-UNIMOD:21,671-UNIMOD:4,677-UNIMOD:510,668-UNIMOD:21,684-UNIMOD:510,690-UNIMOD:21	0.03	29.0	3	2	1
PRT	sp|Q16881-7|TRXR1_HUMAN	Isoform 7 of Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	327-UNIMOD:510,327-UNIMOD:4,329-UNIMOD:21,345-UNIMOD:4,351-UNIMOD:510,342-UNIMOD:21	0.06	29.0	2	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	237-UNIMOD:510,237-UNIMOD:4,243-UNIMOD:21,249-UNIMOD:510,219-UNIMOD:510,223-UNIMOD:21,227-UNIMOD:21,233-UNIMOD:510	0.05	29.0	2	2	2
PRT	sp|Q9H1E3-2|NUCKS_HUMAN	Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	89-UNIMOD:510,98-UNIMOD:35,106-UNIMOD:21,110-UNIMOD:510	0.11	29.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	253-UNIMOD:510,265-UNIMOD:510,725-UNIMOD:510,733-UNIMOD:510,672-UNIMOD:510,677-UNIMOD:21,682-UNIMOD:510,396-UNIMOD:510,404-UNIMOD:510	0.06	29.0	4	4	4
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	44-UNIMOD:510,48-UNIMOD:21,54-UNIMOD:21,55-UNIMOD:21,8-UNIMOD:510	0.17	29.0	5	2	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	528-UNIMOD:510,538-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P50897-2|PPT1_HUMAN	Isoform 2 of Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	151-UNIMOD:510,161-UNIMOD:21	0.08	29.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510,47-UNIMOD:510,51-UNIMOD:21,58-UNIMOD:510,50-UNIMOD:21	0.06	29.0	5	2	0
PRT	sp|P00505|AATM_HUMAN	Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	95-UNIMOD:510,96-UNIMOD:21,106-UNIMOD:4,107-UNIMOD:510	0.03	29.0	2	1	0
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	400-UNIMOD:510,401-UNIMOD:21,411-UNIMOD:510,120-UNIMOD:510,127-UNIMOD:21,132-UNIMOD:510	0.06	29.0	2	2	2
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	701-UNIMOD:510,707-UNIMOD:21,703-UNIMOD:35	0.02	29.0	2	1	0
PRT	sp|Q96AY3|FKB10_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens OX=9606 GN=FKBP10 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	198-UNIMOD:510,200-UNIMOD:21,204-UNIMOD:21,212-UNIMOD:510,201-UNIMOD:21,203-UNIMOD:21	0.03	29.0	2	1	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	4-UNIMOD:510,15-UNIMOD:21,830-UNIMOD:510,833-UNIMOD:21	0.03	29.0	2	2	2
PRT	sp|P16989-3|YBOX3_HUMAN	Isoform 3 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	191-UNIMOD:510,192-UNIMOD:21	0.07	29.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	825-UNIMOD:510,827-UNIMOD:21,839-UNIMOD:510,734-UNIMOD:510,744-UNIMOD:4,754-UNIMOD:21	0.03	29.0	4	3	2
PRT	sp|Q16762|THTR_HUMAN	Thiosulfate sulfurtransferase OS=Homo sapiens OX=9606 GN=TST PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	164-UNIMOD:510,165-UNIMOD:21,175-UNIMOD:510	0.04	29.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	null	140-UNIMOD:510,144-UNIMOD:21,152-UNIMOD:510	0.09	29.0	1	1	1
PRT	sp|O00469|PLOD2_HUMAN	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	441-UNIMOD:510,444-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q9BRT2|UQCC2_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 2 OS=Homo sapiens OX=9606 GN=UQCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	41-UNIMOD:510,53-UNIMOD:4,57-UNIMOD:21	0.18	29.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	28.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	85-UNIMOD:510,89-UNIMOD:21,91-UNIMOD:4,97-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	97-UNIMOD:510,101-UNIMOD:21,83-UNIMOD:510,85-UNIMOD:4,86-UNIMOD:21,96-UNIMOD:510	0.12	28.0	2	2	2
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	506-UNIMOD:510,511-UNIMOD:21,788-UNIMOD:510,788-UNIMOD:21,795-UNIMOD:510	0.03	28.0	2	2	2
PRT	sp|Q13630|FCL_HUMAN	GDP-L-fucose synthase OS=Homo sapiens OX=9606 GN=GFUS PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	307-UNIMOD:510,309-UNIMOD:4,316-UNIMOD:21,321-UNIMOD:510	0.05	28.0	2	2	2
PRT	sp|P84095|RHOG_HUMAN	Rho-related GTP-binding protein RhoG OS=Homo sapiens OX=9606 GN=RHOG PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	31-UNIMOD:510,40-UNIMOD:21	0.10	28.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	99-UNIMOD:510,105-UNIMOD:4,109-UNIMOD:21,111-UNIMOD:510	0.03	28.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	220-UNIMOD:510,227-UNIMOD:21	0.06	28.0	2	1	0
PRT	sp|Q12792-3|TWF1_HUMAN	Isoform 3 of Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	302-UNIMOD:510,316-UNIMOD:21,322-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	373-UNIMOD:510,381-UNIMOD:21,373-UNIMOD:35,174-UNIMOD:510,185-UNIMOD:21,193-UNIMOD:510,156-UNIMOD:510,157-UNIMOD:21,175-UNIMOD:35,186-UNIMOD:21,168-UNIMOD:21	0.12	28.0	7	3	0
PRT	sp|Q9H3G5|CPVL_HUMAN	Probable serine carboxypeptidase CPVL OS=Homo sapiens OX=9606 GN=CPVL PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	195-UNIMOD:510,199-UNIMOD:21,208-UNIMOD:510	0.03	28.0	1	1	1
PRT	sp|Q8NI22-2|MCFD2_HUMAN	Isoform 2 of Multiple coagulation factor deficiency protein 2 OS=Homo sapiens OX=9606 GN=MCFD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	79-UNIMOD:510,83-UNIMOD:21,91-UNIMOD:510,86-UNIMOD:21	0.15	28.0	2	1	0
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	455-UNIMOD:510,459-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	500-UNIMOD:510,507-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P18615-3|NELFE_HUMAN	Isoform 2 of Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	138-UNIMOD:510,140-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	342-UNIMOD:510,348-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	247-UNIMOD:510,248-UNIMOD:21,250-UNIMOD:21,257-UNIMOD:510,247-UNIMOD:21	0.04	28.0	3	1	0
PRT	sp|Q9NNW7-2|TRXR2_HUMAN	Isoform 2 of Thioredoxin reductase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TXNRD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	39-UNIMOD:510,44-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	179-UNIMOD:510,188-UNIMOD:21,177-UNIMOD:510,184-UNIMOD:21,180-UNIMOD:510,11-UNIMOD:510,24-UNIMOD:21,28-UNIMOD:510	0.12	28.0	5	4	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	26-UNIMOD:510,424-UNIMOD:510,427-UNIMOD:21,443-UNIMOD:21,429-UNIMOD:21,540-UNIMOD:510,545-UNIMOD:21,549-UNIMOD:35,550-UNIMOD:510,37-UNIMOD:510,41-UNIMOD:21,221-UNIMOD:510,431-UNIMOD:21	0.12	28.0	11	5	2
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	null	143-UNIMOD:510,152-UNIMOD:21,153-UNIMOD:510,245-UNIMOD:510	0.09	28.0	2	2	1
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	47-UNIMOD:510,50-UNIMOD:21,51-UNIMOD:21,58-UNIMOD:510,59-UNIMOD:21	0.04	28.0	4	2	1
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	82-UNIMOD:510,89-UNIMOD:21,86-UNIMOD:21,27-UNIMOD:510,29-UNIMOD:21,32-UNIMOD:4,36-UNIMOD:35,80-UNIMOD:510,81-UNIMOD:510,85-UNIMOD:21,98-UNIMOD:510	0.21	28.0	11	4	1
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	null	459-UNIMOD:510,463-UNIMOD:4,465-UNIMOD:21,471-UNIMOD:510,101-UNIMOD:510,104-UNIMOD:4,122-UNIMOD:21,126-UNIMOD:510	0.07	28.0	2	2	1
PRT	sp|Q9BS40|LXN_HUMAN	Latexin OS=Homo sapiens OX=9606 GN=LXN PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	null	13-UNIMOD:510,20-UNIMOD:21	0.09	28.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	null	241-UNIMOD:510,241-UNIMOD:21	0.05	28.0	1	1	0
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	62-UNIMOD:510,70-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	193-UNIMOD:510,12-UNIMOD:510,19-UNIMOD:21,26-UNIMOD:35,27-UNIMOD:510,117-UNIMOD:510,119-UNIMOD:21,127-UNIMOD:510,128-UNIMOD:510	0.25	27.0	5	4	3
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	239-UNIMOD:510,244-UNIMOD:21,249-UNIMOD:510	0.05	27.0	1	1	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	204-UNIMOD:510,213-UNIMOD:21,215-UNIMOD:35,211-UNIMOD:21,182-UNIMOD:510,192-UNIMOD:510,210-UNIMOD:35	0.12	27.0	4	2	1
PRT	sp|Q99426-2|TBCB_HUMAN	Isoform 2 of Tubulin-folding cofactor B OS=Homo sapiens OX=9606 GN=TBCB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	44-UNIMOD:510,47-UNIMOD:21,55-UNIMOD:510,56-UNIMOD:510,56-UNIMOD:21	0.12	27.0	2	2	1
PRT	sp|P13674-3|P4HA1_HUMAN	Isoform 3 of Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	137-UNIMOD:510,141-UNIMOD:21,150-UNIMOD:510,277-UNIMOD:510,282-UNIMOD:21	0.05	27.0	2	2	2
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	236-UNIMOD:510,237-UNIMOD:21,242-UNIMOD:21	0.03	27.0	3	1	0
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	341-UNIMOD:510,353-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	432-UNIMOD:510,445-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	930-UNIMOD:510,936-UNIMOD:21,941-UNIMOD:510,721-UNIMOD:510,722-UNIMOD:21,729-UNIMOD:510	0.02	27.0	2	2	2
PRT	sp|Q9UET6-2|TRM7_HUMAN	Isoform 2 of Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	247-UNIMOD:510,258-UNIMOD:21,259-UNIMOD:510	0.04	27.0	1	1	1
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	149-UNIMOD:510,157-UNIMOD:4,158-UNIMOD:21,149-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|Q01433-3|AMPD2_HUMAN	Isoform Ex1A-3 of AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	69-UNIMOD:510,78-UNIMOD:21,79-UNIMOD:510	0.02	27.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	250-UNIMOD:510,256-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|P68400|CSK21_HUMAN	Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	248-UNIMOD:510,255-UNIMOD:21,260-UNIMOD:510	0.04	27.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	95-UNIMOD:510,99-UNIMOD:21,105-UNIMOD:510,95-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	92-UNIMOD:510,92-UNIMOD:21,352-UNIMOD:510,357-UNIMOD:21,361-UNIMOD:510,89-UNIMOD:510,90-UNIMOD:510,91-UNIMOD:510,121-UNIMOD:510,127-UNIMOD:4,135-UNIMOD:510	0.09	27.0	4	4	4
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	326-UNIMOD:510,327-UNIMOD:35,336-UNIMOD:21	0.07	27.0	2	1	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	null	108-UNIMOD:510,110-UNIMOD:21,119-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|Q9Y617-2|SERC_HUMAN	Isoform 2 of Phosphoserine aminotransferase OS=Homo sapiens OX=9606 GN=PSAT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	98-UNIMOD:510,98-UNIMOD:4,101-UNIMOD:21,110-UNIMOD:510	0.04	26.0	1	1	1
PRT	sp|P60900-3|PSA6_HUMAN	Isoform 3 of Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	75-UNIMOD:510,75-UNIMOD:4,81-UNIMOD:21,82-UNIMOD:4,85-UNIMOD:510	0.07	26.0	1	1	1
PRT	sp|P50542-2|PEX5_HUMAN	Isoform 2 of Peroxisomal targeting signal 1 receptor OS=Homo sapiens OX=9606 GN=PEX5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	265-UNIMOD:510,275-UNIMOD:21,285-UNIMOD:510,159-UNIMOD:510,163-UNIMOD:21,170-UNIMOD:510	0.06	26.0	2	2	2
PRT	sp|Q92626|PXDN_HUMAN	Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	901-UNIMOD:510,907-UNIMOD:21,916-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	26.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	129-UNIMOD:510,133-UNIMOD:21,326-UNIMOD:510,333-UNIMOD:510	0.06	26.0	2	2	2
PRT	sp|P17706-3|PTN2_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	61-UNIMOD:510,68-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	188-UNIMOD:510,196-UNIMOD:21,200-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	22-UNIMOD:510,25-UNIMOD:21,38-UNIMOD:510,54-UNIMOD:21	0.11	26.0	2	2	2
PRT	sp|P63092-3|GNAS2_HUMAN	Isoform 3 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens OX=9606 GN=GNAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	172-UNIMOD:510,175-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	70-UNIMOD:510,75-UNIMOD:21,87-UNIMOD:510,94-UNIMOD:21,95-UNIMOD:510	0.20	26.0	2	2	2
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	389-UNIMOD:510,391-UNIMOD:21,400-UNIMOD:510,389-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|Q06124|PTN11_HUMAN	Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	579-UNIMOD:510,580-UNIMOD:21,590-UNIMOD:510,586-UNIMOD:35	0.02	26.0	2	1	0
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	65-UNIMOD:510,65-UNIMOD:21,69-UNIMOD:21,75-UNIMOD:510	0.04	26.0	1	1	1
PRT	sp|P12814|ACTN1_HUMAN	Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	421-UNIMOD:510,422-UNIMOD:21,431-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	62-UNIMOD:510,67-UNIMOD:21,105-UNIMOD:510,115-UNIMOD:21,434-UNIMOD:510,445-UNIMOD:21,352-UNIMOD:510,356-UNIMOD:21,362-UNIMOD:510,95-UNIMOD:510,95-UNIMOD:21,104-UNIMOD:510,100-UNIMOD:21	0.13	26.0	6	5	4
PRT	sp|P67775|PP2AA_HUMAN	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	75-UNIMOD:510,78-UNIMOD:21,75-UNIMOD:21	0.05	26.0	2	1	0
PRT	sp|P51813|BMX_HUMAN	Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens OX=9606 GN=BMX PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	86-UNIMOD:510,90-UNIMOD:21,92-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	70-UNIMOD:510,76-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	644-UNIMOD:510,645-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	null	285-UNIMOD:510,285-UNIMOD:21,295-UNIMOD:21,298-UNIMOD:510	0.05	26.0	1	1	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	61-UNIMOD:510,65-UNIMOD:21,64-UNIMOD:21,47-UNIMOD:510,102-UNIMOD:510,113-UNIMOD:510,563-UNIMOD:510,573-UNIMOD:510	0.08	26.0	5	4	3
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	null	312-UNIMOD:510,318-UNIMOD:21,325-UNIMOD:510	0.04	26.0	1	1	0
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	null	368-UNIMOD:510,378-UNIMOD:21,382-UNIMOD:510	0.01	26.0	1	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	175-UNIMOD:510,192-UNIMOD:21,193-UNIMOD:510,121-UNIMOD:510,131-UNIMOD:510,204-UNIMOD:510,222-UNIMOD:510	0.22	25.0	3	3	2
PRT	sp|Q9BRX8-2|PXL2A_HUMAN	Isoform 2 of Peroxiredoxin-like 2A OS=Homo sapiens OX=9606 GN=PRXL2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	33-UNIMOD:510,37-UNIMOD:21,44-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	164-UNIMOD:510,171-UNIMOD:21,179-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	156-UNIMOD:510,161-UNIMOD:510,168-UNIMOD:21,395-UNIMOD:510,402-UNIMOD:21	0.05	25.0	2	2	2
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	697-UNIMOD:510,698-UNIMOD:21,699-UNIMOD:21,706-UNIMOD:510,786-UNIMOD:510,787-UNIMOD:21,800-UNIMOD:510	0.03	25.0	2	2	2
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	25.0	1	1	1
PRT	sp|Q99439-2|CNN2_HUMAN	Isoform 2 of Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	9-UNIMOD:510,12-UNIMOD:21,19-UNIMOD:510	0.04	25.0	1	1	0
PRT	sp|Q99873-2|ANM1_HUMAN	Isoform 2 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	333-UNIMOD:510,336-UNIMOD:4,340-UNIMOD:4,344-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	237-UNIMOD:510,241-UNIMOD:21,246-UNIMOD:510	0.01	25.0	2	1	0
PRT	sp|Q7RTV0|PHF5A_HUMAN	PHD finger-like domain-containing protein 5A OS=Homo sapiens OX=9606 GN=PHF5A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	45-UNIMOD:510,46-UNIMOD:4,49-UNIMOD:4,51-UNIMOD:21	0.13	25.0	1	1	1
PRT	sp|Q07666-3|KHDR1_HUMAN	Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	139-UNIMOD:510,145-UNIMOD:21,152-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	211-UNIMOD:510,213-UNIMOD:21,222-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|O60664-4|PLIN3_HUMAN	Isoform 4 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	85-UNIMOD:510,95-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	630-UNIMOD:510,632-UNIMOD:21,633-UNIMOD:4,651-UNIMOD:510	0.03	25.0	1	1	0
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	57-UNIMOD:510,59-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q53H82|LACB2_HUMAN	Endoribonuclease LACTB2 OS=Homo sapiens OX=9606 GN=LACTB2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	107-UNIMOD:510,121-UNIMOD:21,125-UNIMOD:510	0.07	25.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	236-UNIMOD:510,250-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	4-UNIMOD:510,17-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q86UK7-2|ZN598_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZNF598 OS=Homo sapiens OX=9606 GN=ZNF598	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	296-UNIMOD:510,306-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	78-UNIMOD:510,86-UNIMOD:21,88-UNIMOD:35,96-UNIMOD:510	0.05	25.0	2	1	0
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	205-UNIMOD:510,206-UNIMOD:21,215-UNIMOD:510,205-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	109-UNIMOD:510,119-UNIMOD:21,121-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	288-UNIMOD:510,289-UNIMOD:21,292-UNIMOD:21,297-UNIMOD:510	0.02	25.0	2	1	0
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	395-UNIMOD:510,405-UNIMOD:21,407-UNIMOD:4,416-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|Q8WX93-7|PALLD_HUMAN	Isoform 7 of Palladin OS=Homo sapiens OX=9606 GN=PALLD	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	350-UNIMOD:510,350-UNIMOD:21,361-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	135-UNIMOD:510,146-UNIMOD:4,147-UNIMOD:4,152-UNIMOD:21,153-UNIMOD:21,155-UNIMOD:510,42-UNIMOD:510,50-UNIMOD:21,53-UNIMOD:510	0.07	25.0	2	2	2
PRT	sp|Q6NVV1|R13P3_HUMAN	Putative 60S ribosomal protein L13a protein RPL13AP3 OS=Homo sapiens OX=9606 GN=RPL13AP3 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	63-UNIMOD:510,63-UNIMOD:21,73-UNIMOD:510	0.12	25.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	69-UNIMOD:510,70-UNIMOD:21,82-UNIMOD:510,46-UNIMOD:510,48-UNIMOD:21,54-UNIMOD:510	0.06	25.0	2	2	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	187-UNIMOD:510,202-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	638-UNIMOD:510,641-UNIMOD:4,642-UNIMOD:21,659-UNIMOD:510	0.03	25.0	1	1	0
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	207-UNIMOD:510,210-UNIMOD:510,216-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q07157|ZO1_HUMAN	Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	null	1061-UNIMOD:510,1066-UNIMOD:21	0.01	25.0	1	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	20-UNIMOD:510,22-UNIMOD:21,30-UNIMOD:510,18-UNIMOD:510,19-UNIMOD:510	0.03	25.0	2	2	2
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	359-UNIMOD:510,363-UNIMOD:21,370-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|E9PAV3|NACAM_HUMAN	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	null	1977-UNIMOD:510,1983-UNIMOD:21,1990-UNIMOD:510	0.01	25.0	1	1	1
PRT	sp|Q99439|CNN2_HUMAN	Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	9-UNIMOD:510,11-UNIMOD:21,19-UNIMOD:510	0.04	25.0	1	1	0
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	499-UNIMOD:510,508-UNIMOD:21,510-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|P30043|BLVRB_HUMAN	Flavin reductase (NADPH) OS=Homo sapiens OX=9606 GN=BLVRB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	188-UNIMOD:510,188-UNIMOD:4,202-UNIMOD:21	0.10	24.0	1	1	1
PRT	sp|P09234|RU1C_HUMAN	U1 small nuclear ribonucleoprotein C OS=Homo sapiens OX=9606 GN=SNRPC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	4-UNIMOD:510,6-UNIMOD:4,8-UNIMOD:21,9-UNIMOD:4	0.12	24.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	635-UNIMOD:510,637-UNIMOD:21,639-UNIMOD:21,644-UNIMOD:510	0.01	24.0	1	1	1
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	323-UNIMOD:510,328-UNIMOD:21,333-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	49-UNIMOD:510,49-UNIMOD:35,53-UNIMOD:21,55-UNIMOD:21	0.12	24.0	2	1	0
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	209-UNIMOD:510,214-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|A5YKK6-3|CNOT1_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	1563-UNIMOD:510,1567-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	175-UNIMOD:510,181-UNIMOD:21,185-UNIMOD:510,100-UNIMOD:510,105-UNIMOD:4,43-UNIMOD:510,57-UNIMOD:510,6-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:510	0.19	24.0	4	4	4
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	110-UNIMOD:510,116-UNIMOD:21,120-UNIMOD:510,111-UNIMOD:510,28-UNIMOD:510,35-UNIMOD:510	0.11	24.0	3	3	3
PRT	sp|Q05209|PTN12_HUMAN	Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	81-UNIMOD:510,88-UNIMOD:21,95-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	508-UNIMOD:510,517-UNIMOD:21,128-UNIMOD:510,133-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	454-UNIMOD:510,459-UNIMOD:21,463-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|A6NEC2|PSAL_HUMAN	Puromycin-sensitive aminopeptidase-like protein OS=Homo sapiens OX=9606 GN=NPEPPSL1 PE=2 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	173-UNIMOD:510,173-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	343-UNIMOD:510,358-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	114-UNIMOD:510,114-UNIMOD:21	0.13	24.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	542-UNIMOD:510,544-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	780-UNIMOD:510,787-UNIMOD:510,794-UNIMOD:21,796-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	146-UNIMOD:510,147-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	445-UNIMOD:510,447-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	3187-UNIMOD:510,3193-UNIMOD:21	0.00	23.0	1	1	1
PRT	sp|Q9NQW7-2|XPP1_HUMAN	Isoform 2 of Xaa-Pro aminopeptidase 1 OS=Homo sapiens OX=9606 GN=XPNPEP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	294-UNIMOD:510,296-UNIMOD:21,304-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	104-UNIMOD:510,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:510	0.12	23.0	1	1	1
PRT	sp|Q8N108-19|MIER1_HUMAN	Isoform 9 of Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	189-UNIMOD:510,195-UNIMOD:21,199-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	39-UNIMOD:510,40-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	937-UNIMOD:510,938-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P61158|ARP3_HUMAN	Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	399-UNIMOD:510,400-UNIMOD:21,408-UNIMOD:4,229-UNIMOD:510,231-UNIMOD:21,232-UNIMOD:21,235-UNIMOD:4,240-UNIMOD:510,398-UNIMOD:510	0.06	23.0	3	3	3
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	58-UNIMOD:510,59-UNIMOD:21,62-UNIMOD:4,54-UNIMOD:510,57-UNIMOD:510	0.05	23.0	2	2	2
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	420-UNIMOD:510,428-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P49903-2|SPS1_HUMAN	Isoform 2 of Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	5-UNIMOD:510,12-UNIMOD:21,16-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	36-UNIMOD:510,41-UNIMOD:21,44-UNIMOD:510	0.08	23.0	1	1	0
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	117-UNIMOD:510,121-UNIMOD:21,125-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	208-UNIMOD:510,209-UNIMOD:21,214-UNIMOD:21,216-UNIMOD:510	0.02	23.0	2	1	0
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1315-UNIMOD:510,1323-UNIMOD:21,1331-UNIMOD:510	0.01	23.0	1	1	0
PRT	sp|P50990-2|TCPQ_HUMAN	Isoform 2 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:510,11-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P48643-2|TCPE_HUMAN	Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	171-UNIMOD:510,172-UNIMOD:510,181-UNIMOD:21,182-UNIMOD:510,173-UNIMOD:510	0.03	23.0	2	2	2
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	216-UNIMOD:510,228-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1485-UNIMOD:510,1492-UNIMOD:21,1497-UNIMOD:510,940-UNIMOD:510,942-UNIMOD:21	0.02	23.0	2	2	2
PRT	sp|O00232-2|PSD12_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	16-UNIMOD:510,20-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|O60934|NBN_HUMAN	Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	671-UNIMOD:510,679-UNIMOD:21,683-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|Q13228-4|SBP1_HUMAN	Isoform 4 of Methanethiol oxidase OS=Homo sapiens OX=9606 GN=SELENBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	77-UNIMOD:510,85-UNIMOD:21,94-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P23434|GCSH_HUMAN	Glycine cleavage system H protein, mitochondrial OS=Homo sapiens OX=9606 GN=GCSH PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	137-UNIMOD:510,138-UNIMOD:4,139-UNIMOD:21,146-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	441-UNIMOD:510,444-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	381-UNIMOD:510,384-UNIMOD:21,392-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	68-UNIMOD:510,78-UNIMOD:4,79-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	551-UNIMOD:510,566-UNIMOD:21,569-UNIMOD:510	0.03	23.0	1	1	0
PRT	sp|Q16719|KYNU_HUMAN	Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	85-UNIMOD:510,93-UNIMOD:510,86-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q8NBS9-2|TXND5_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	137-UNIMOD:510,139-UNIMOD:4,143-UNIMOD:21,146-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|P52888-2|THOP1_HUMAN	Isoform 2 of Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	71-UNIMOD:510,87-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|P49189-2|AL9A1_HUMAN	Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	283-UNIMOD:510,285-UNIMOD:4,290-UNIMOD:21,296-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	135-UNIMOD:510,140-UNIMOD:21,142-UNIMOD:35,148-UNIMOD:510,138-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	471-UNIMOD:510,479-UNIMOD:21,489-UNIMOD:510,490-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	966-UNIMOD:510,966-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	null	258-UNIMOD:510,260-UNIMOD:21,267-UNIMOD:510	0.03	23.0	1	1	0
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	360-UNIMOD:510,362-UNIMOD:21,292-UNIMOD:510,297-UNIMOD:21,305-UNIMOD:35,239-UNIMOD:510,239-UNIMOD:21,197-UNIMOD:510	0.17	23.0	4	4	0
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	142-UNIMOD:510,143-UNIMOD:21,146-UNIMOD:4,164-UNIMOD:510	0.04	23.0	1	1	0
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	117-UNIMOD:510,119-UNIMOD:21,129-UNIMOD:510,117-UNIMOD:21	0.06	23.0	2	1	0
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	null	582-UNIMOD:510,598-UNIMOD:21,600-UNIMOD:510	0.03	23.0	1	1	0
PRT	sp|Q8N999-3|CL029_HUMAN	Isoform 3 of Uncharacterized protein C12orf29 OS=Homo sapiens OX=9606 GN=C12orf29	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	20-UNIMOD:510,26-UNIMOD:21,33-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|Q9UPQ0-7|LIMC1_HUMAN	Isoform 7 of LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	17-UNIMOD:510,20-UNIMOD:21,23-UNIMOD:4	0.09	22.0	1	1	1
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	319-UNIMOD:510,327-UNIMOD:21,335-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	330-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	52-UNIMOD:510,54-UNIMOD:21,60-UNIMOD:510,56-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|P19105|ML12A_HUMAN	Myosin regulatory light chain 12A OS=Homo sapiens OX=9606 GN=MYL12A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	151-UNIMOD:510,155-UNIMOD:21,150-UNIMOD:510	0.07	22.0	2	2	2
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	198-UNIMOD:510,207-UNIMOD:21,200-UNIMOD:35	0.04	22.0	2	1	0
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	341-UNIMOD:510,343-UNIMOD:35,350-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	200-UNIMOD:510,202-UNIMOD:510,210-UNIMOD:21,217-UNIMOD:510	0.09	22.0	1	1	1
PRT	sp|O00429-4|DNM1L_HUMAN	Isoform 3 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	100-UNIMOD:510,101-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	485-UNIMOD:510,490-UNIMOD:21,495-UNIMOD:510,166-UNIMOD:510	0.05	22.0	2	2	2
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	278-UNIMOD:510,285-UNIMOD:21,302-UNIMOD:510,63-UNIMOD:510,92-UNIMOD:21,97-UNIMOD:510,286-UNIMOD:21	0.11	22.0	3	2	1
PRT	sp|Q15527|SURF2_HUMAN	Surfeit locus protein 2 OS=Homo sapiens OX=9606 GN=SURF2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	119-UNIMOD:510,123-UNIMOD:21,127-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|P52298-3|NCBP2_HUMAN	Isoform 3 of Nuclear cap-binding protein subunit 2 OS=Homo sapiens OX=9606 GN=NCBP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	11-UNIMOD:510,14-UNIMOD:21	0.12	22.0	1	1	0
PRT	sp|Q02809|PLOD1_HUMAN	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens OX=9606 GN=PLOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	431-UNIMOD:510,434-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	447-UNIMOD:510,449-UNIMOD:21,460-UNIMOD:21,462-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	408-UNIMOD:510,417-UNIMOD:21,418-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	21-UNIMOD:510,29-UNIMOD:21,30-UNIMOD:510,85-UNIMOD:510,88-UNIMOD:21,85-UNIMOD:21	0.05	22.0	3	2	1
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	285-UNIMOD:510,286-UNIMOD:4,289-UNIMOD:21,292-UNIMOD:21,293-UNIMOD:510,141-UNIMOD:510,145-UNIMOD:4,150-UNIMOD:21,163-UNIMOD:510	0.06	22.0	2	2	1
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	170-UNIMOD:510,179-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	981-UNIMOD:510,987-UNIMOD:21	0.01	22.0	1	1	0
PRT	sp|Q9BXS5|AP1M1_HUMAN	AP-1 complex subunit mu-1 OS=Homo sapiens OX=9606 GN=AP1M1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	411-UNIMOD:510,418-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P31153-2|METK2_HUMAN	Isoform 2 of S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	172-UNIMOD:510,172-UNIMOD:21,179-UNIMOD:21	0.05	22.0	2	1	0
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	37-UNIMOD:510,42-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9Y5S9|RBM8A_HUMAN	RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	50-UNIMOD:510,54-UNIMOD:21	0.11	22.0	1	1	0
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	273-UNIMOD:510,279-UNIMOD:21,281-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|P06493|CDK1_HUMAN	Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	10-UNIMOD:510,15-UNIMOD:21,20-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|P52298|NCBP2_HUMAN	Nuclear cap-binding protein subunit 2 OS=Homo sapiens OX=9606 GN=NCBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	11-UNIMOD:510,13-UNIMOD:21	0.08	22.0	1	1	0
PRT	sp|P62195|PRS8_HUMAN	26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	143-UNIMOD:510,147-UNIMOD:21,156-UNIMOD:510	0.04	22.0	1	1	0
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	90-UNIMOD:510,91-UNIMOD:510,97-UNIMOD:21	0.10	21.0	1	1	1
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	46-UNIMOD:510,48-UNIMOD:4,50-UNIMOD:21,55-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q9NQE9|HINT3_HUMAN	Histidine triad nucleotide-binding protein 3 OS=Homo sapiens OX=9606 GN=HINT3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	43-UNIMOD:510,44-UNIMOD:21,48-UNIMOD:4,51-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|Q08830|FGL1_HUMAN	Fibrinogen-like protein 1 OS=Homo sapiens OX=9606 GN=FGL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	139-UNIMOD:510,140-UNIMOD:21,150-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|P11310|ACADM_HUMAN	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	58-UNIMOD:510,67-UNIMOD:21,69-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|O75223-3|GGCT_HUMAN	Isoform 3 of Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	55-UNIMOD:510,62-UNIMOD:21,65-UNIMOD:510	0.13	21.0	1	1	1
PRT	sp|Q99536-2|VAT1_HUMAN	Isoform 2 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	97-UNIMOD:510,106-UNIMOD:21,109-UNIMOD:21,116-UNIMOD:510	0.08	21.0	1	1	1
PRT	sp|Q9Y3U8|RL36_HUMAN	60S ribosomal protein L36 OS=Homo sapiens OX=9606 GN=RPL36 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	46-UNIMOD:510,48-UNIMOD:4,53-UNIMOD:21	0.11	21.0	2	2	2
PRT	sp|L0R819|ASURF_HUMAN	ASNSD1 upstream open reading frame protein OS=Homo sapiens OX=9606 GN=ASDURF PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	82-UNIMOD:510,83-UNIMOD:21,91-UNIMOD:510	0.11	21.0	1	1	1
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	480-UNIMOD:510,488-UNIMOD:21,490-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	175-UNIMOD:510,180-UNIMOD:21,184-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	295-UNIMOD:510,305-UNIMOD:510,368-UNIMOD:510,370-UNIMOD:21	0.04	21.0	3	2	1
PRT	sp|Q00005-6|2ABB_HUMAN	Isoform 6 of Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Homo sapiens OX=9606 GN=PPP2R2B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	54-UNIMOD:510,56-UNIMOD:21,59-UNIMOD:21,73-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	232-UNIMOD:510,238-UNIMOD:21,240-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P23526-2|SAHH_HUMAN	Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	124-UNIMOD:510,137-UNIMOD:21,138-UNIMOD:510,159-UNIMOD:510,160-UNIMOD:510,165-UNIMOD:21,167-UNIMOD:4	0.07	21.0	2	2	2
PRT	sp|Q92796-3|DLG3_HUMAN	Isoform 3 of Disks large homolog 3 OS=Homo sapiens OX=9606 GN=DLG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	157-UNIMOD:510,164-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P40926-2|MDHM_HUMAN	Isoform 2 of Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	79-UNIMOD:510,80-UNIMOD:21,89-UNIMOD:4,91-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q96GX9|MTNB_HUMAN	Methylthioribulose-1-phosphate dehydratase OS=Homo sapiens OX=9606 GN=APIP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	52-UNIMOD:510,57-UNIMOD:21,65-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P46778|RL21_HUMAN	60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	22-UNIMOD:510,30-UNIMOD:21,29-UNIMOD:21,31-UNIMOD:35	0.08	21.0	2	1	0
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	9-UNIMOD:510,11-UNIMOD:21,18-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	592-UNIMOD:510,601-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	648-UNIMOD:510,657-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	16-UNIMOD:510,17-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|Q15819|UB2V2_HUMAN	Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	134-UNIMOD:510,143-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|O15270|SPTC2_HUMAN	Serine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=SPTLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	544-UNIMOD:510,556-UNIMOD:21,557-UNIMOD:21	0.04	21.0	2	1	0
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	763-UNIMOD:510,768-UNIMOD:21,772-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	836-UNIMOD:510,837-UNIMOD:21,840-UNIMOD:35	0.01	21.0	2	1	0
PRT	sp|Q8N3C0-3|ASCC3_HUMAN	Isoform 2 of Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	19-UNIMOD:510,22-UNIMOD:21,30-UNIMOD:510	0.12	21.0	1	1	1
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	307-UNIMOD:510,311-UNIMOD:21,317-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	620-UNIMOD:510,629-UNIMOD:21,630-UNIMOD:4,636-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	81-UNIMOD:510,84-UNIMOD:21,103-UNIMOD:510,82-UNIMOD:510	0.18	21.0	2	2	2
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	46-UNIMOD:510,52-UNIMOD:21	0.12	21.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1089-UNIMOD:510,1094-UNIMOD:21,1099-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|P35270|SPRE_HUMAN	Sepiapterin reductase OS=Homo sapiens OX=9606 GN=SPR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	252-UNIMOD:510,259-UNIMOD:21,261-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	458-UNIMOD:510,462-UNIMOD:21,467-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P42224-2|STAT1_HUMAN	Isoform Beta of Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	162-UNIMOD:510,170-UNIMOD:21,173-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P26196|DDX6_HUMAN	Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	467-UNIMOD:510,469-UNIMOD:21,473-UNIMOD:21,482-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	348-UNIMOD:510,351-UNIMOD:4,352-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9H6T3-2|RPAP3_HUMAN	Isoform 2 of RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	87-UNIMOD:510,88-UNIMOD:21,90-UNIMOD:21,95-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	52-UNIMOD:510,53-UNIMOD:21,56-UNIMOD:4	0.12	21.0	1	1	1
PRT	sp|P15374|UCHL3_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens OX=9606 GN=UCHL3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	137-UNIMOD:510,141-UNIMOD:21,137-UNIMOD:21	0.04	21.0	2	1	0
PRT	sp|P61353|RL27_HUMAN	60S ribosomal protein L27 OS=Homo sapiens OX=9606 GN=RPL27 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	85-UNIMOD:510,85-UNIMOD:21,93-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	249-UNIMOD:510,250-UNIMOD:21,254-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	141-UNIMOD:510,151-UNIMOD:21,159-UNIMOD:510,160-UNIMOD:510,147-UNIMOD:21	0.09	21.0	2	2	1
PRT	sp|Q14257|RCN2_HUMAN	Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	306-UNIMOD:510,311-UNIMOD:21,313-UNIMOD:21	0.04	21.0	2	1	0
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	110-UNIMOD:510,115-UNIMOD:21,119-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	143-UNIMOD:510,147-UNIMOD:21,152-UNIMOD:510,146-UNIMOD:21	0.05	21.0	3	1	0
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	258-UNIMOD:510,260-UNIMOD:35,269-UNIMOD:21,272-UNIMOD:35	0.03	21.0	1	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	2662-UNIMOD:510,2666-UNIMOD:21,2682-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|Q92538|GBF1_HUMAN	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	1315-UNIMOD:510,1324-UNIMOD:21,1331-UNIMOD:510	0.01	21.0	1	1	0
PRT	sp|P19622|HME2_HUMAN	Homeobox protein engrailed-2 OS=Homo sapiens OX=9606 GN=EN2 PE=2 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	36-UNIMOD:21,42-UNIMOD:21	0.08	21.0	2	1	0
PRT	sp|P31153|METK2_HUMAN	S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	235-UNIMOD:510,242-UNIMOD:21	0.04	21.0	1	1	0
PRT	sp|Q9UK59|DBR1_HUMAN	Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	529-UNIMOD:510,533-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	36-UNIMOD:510,39-UNIMOD:21,44-UNIMOD:510	0.08	21.0	1	1	0
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	64-UNIMOD:510,72-UNIMOD:21,70-UNIMOD:21	0.15	20.0	2	1	0
PRT	sp|Q99747-2|SNAG_HUMAN	Isoform 2 of Gamma-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPG	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	51-UNIMOD:510,55-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	128-UNIMOD:510,128-UNIMOD:4,129-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	44-UNIMOD:510,52-UNIMOD:510	0.07	20.0	1	1	1
PRT	sp|O43390-4|HNRPR_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	277-UNIMOD:510,278-UNIMOD:21,192-UNIMOD:510,194-UNIMOD:4,198-UNIMOD:21,202-UNIMOD:510	0.04	20.0	2	2	2
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	2880-UNIMOD:510,2881-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	217-UNIMOD:510,223-UNIMOD:4,233-UNIMOD:21,238-UNIMOD:510	0.10	20.0	1	1	1
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	56-UNIMOD:510,59-UNIMOD:4,75-UNIMOD:21,81-UNIMOD:510	0.05	20.0	1	1	0
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	74-UNIMOD:510	0.11	20.0	1	1	1
PRT	sp|Q99848|EBP2_HUMAN	Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null	263-UNIMOD:510,265-UNIMOD:21,264-UNIMOD:21	0.04	20.0	2	1	0
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	322-UNIMOD:510,323-UNIMOD:21,331-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	91-UNIMOD:510,94-UNIMOD:4,129-UNIMOD:510,130-UNIMOD:4,136-UNIMOD:21	0.15	20.0	2	2	2
PRT	sp|Q9NY33-4|DPP3_HUMAN	Isoform 4 of Dipeptidyl peptidase 3 OS=Homo sapiens OX=9606 GN=DPP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	219-UNIMOD:510,221-UNIMOD:21,227-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|Q96P70|IPO9_HUMAN	Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	885-UNIMOD:510,889-UNIMOD:21,883-UNIMOD:510,884-UNIMOD:510,890-UNIMOD:21	0.01	20.0	2	2	2
PRT	sp|O95340|PAPS2_HUMAN	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens OX=9606 GN=PAPSS2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	174-UNIMOD:510,182-UNIMOD:21,184-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	237-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	67-UNIMOD:510,69-UNIMOD:21,50-UNIMOD:510,50-UNIMOD:21,55-UNIMOD:21	0.06	20.0	2	2	2
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	156-UNIMOD:510,163-UNIMOD:21,165-UNIMOD:510,161-UNIMOD:35	0.03	20.0	2	1	0
PRT	sp|Q15052-2|ARHG6_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	333-UNIMOD:510,334-UNIMOD:21,341-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q99615-2|DNJC7_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	82-UNIMOD:510,89-UNIMOD:21,91-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	544-UNIMOD:510,556-UNIMOD:21,565-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P01116-2|RASK_HUMAN	Isoform 2B of GTPase KRas OS=Homo sapiens OX=9606 GN=KRAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	136-UNIMOD:510,137-UNIMOD:21,147-UNIMOD:510	0.07	20.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	494-UNIMOD:510,495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21,521-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	5-UNIMOD:510,11-UNIMOD:21,8-UNIMOD:510	0.06	20.0	2	2	2
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	134-UNIMOD:510,137-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P54764|EPHA4_HUMAN	Ephrin type-A receptor 4 OS=Homo sapiens OX=9606 GN=EPHA4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	790-UNIMOD:510,798-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	67-UNIMOD:510,70-UNIMOD:21	0.05	20.0	1	1	0
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	20.0	null	1036-UNIMOD:510,1042-UNIMOD:21,1046-UNIMOD:510	0.01	20.0	2	1	0
PRT	sp|Q6N043-3|Z280D_HUMAN	Isoform 3 of Zinc finger protein 280D OS=Homo sapiens OX=9606 GN=ZNF280D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	577-UNIMOD:21,578-UNIMOD:21,584-UNIMOD:21,592-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	184-UNIMOD:510,193-UNIMOD:21,197-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	300-UNIMOD:510,313-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9Y639-3|NPTN_HUMAN	Isoform 3 of Neuroplastin OS=Homo sapiens OX=9606 GN=NPTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	94-UNIMOD:510,100-UNIMOD:21,102-UNIMOD:4,111-UNIMOD:510	0.07	19.0	1	1	0
PRT	sp|P47813|IF1AX_HUMAN	Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	105-UNIMOD:510,106-UNIMOD:21,114-UNIMOD:510	0.08	19.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	194-UNIMOD:510,197-UNIMOD:21,202-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|Q13162|PRDX4_HUMAN	Peroxiredoxin-4 OS=Homo sapiens OX=9606 GN=PRDX4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	187-UNIMOD:510,188-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|P49321-2|NASP_HUMAN	Isoform 2 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	197-UNIMOD:510,201-UNIMOD:21,208-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	189-UNIMOD:510,194-UNIMOD:21,196-UNIMOD:510,291-UNIMOD:510,291-UNIMOD:21,297-UNIMOD:21,299-UNIMOD:510	0.03	19.0	2	2	2
PRT	sp|Q9UGI8-2|TES_HUMAN	Isoform 2 of Testin OS=Homo sapiens OX=9606 GN=TES	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	236-UNIMOD:510,242-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|O14579-3|COPE_HUMAN	Isoform 3 of Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	242-UNIMOD:510,252-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	294-UNIMOD:510,295-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	155-UNIMOD:510,166-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	410-UNIMOD:510,414-UNIMOD:21,423-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P51965-2|UB2E1_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens OX=9606 GN=UBE2E1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	40-UNIMOD:510,44-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	210-UNIMOD:510,211-UNIMOD:21,225-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	134-UNIMOD:510,142-UNIMOD:510,145-UNIMOD:21,154-UNIMOD:510	0.07	19.0	1	1	1
PRT	sp|P49419-4|AL7A1_HUMAN	Isoform 4 of Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	82-UNIMOD:510,88-UNIMOD:21,93-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	111-UNIMOD:510,117-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|Q9UBS4|DJB11_HUMAN	DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	85-UNIMOD:510,89-UNIMOD:21,95-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P28074-3|PSB5_HUMAN	Isoform 3 of Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	63-UNIMOD:510,68-UNIMOD:21,69-UNIMOD:21	0.09	19.0	1	1	1
PRT	sp|P28066|PSA5_HUMAN	Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	6-UNIMOD:510,8-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	1875-UNIMOD:510,1891-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q05397-4|FAK1_HUMAN	Isoform 4 of Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	205-UNIMOD:510,205-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|P04632|CPNS1_HUMAN	Calpain small subunit 1 OS=Homo sapiens OX=9606 GN=CAPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	85-UNIMOD:510,85-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|O95834|EMAL2_HUMAN	Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	342-UNIMOD:510,352-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q9Y3D8-2|KAD6_HUMAN	Isoform 2 of Adenylate kinase isoenzyme 6 OS=Homo sapiens OX=9606 GN=AK6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	28-UNIMOD:510,28-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|O60506|HNRPQ_HUMAN	Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	null	372-UNIMOD:510,373-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	415-UNIMOD:510,421-UNIMOD:21,428-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	null	85-UNIMOD:510,89-UNIMOD:21,95-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|Q9Y639|NPTN_HUMAN	Neuroplastin OS=Homo sapiens OX=9606 GN=NPTN PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4,227-UNIMOD:510	0.05	19.0	1	1	0
PRT	sp|Q8N2K0-3|ABD12_HUMAN	Isoform 3 of Lysophosphatidylserine lipase ABHD12 OS=Homo sapiens OX=9606 GN=ABHD12	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	5-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:35,21-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|P13646|K1C13_HUMAN	Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	null	327-UNIMOD:21,337-UNIMOD:21,340-UNIMOD:21,341-UNIMOD:35,342-UNIMOD:510	0.04	19.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	null	129-UNIMOD:510,144-UNIMOD:21,150-UNIMOD:510	0.09	19.0	1	1	0
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	126-UNIMOD:510,136-UNIMOD:21,140-UNIMOD:510	0.07	18.0	1	1	1
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	480-UNIMOD:510,493-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	96-UNIMOD:510	0.09	18.0	1	1	1
PRT	sp|P48556|PSMD8_HUMAN	26S proteasome non-ATPase regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMD8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	219-UNIMOD:510,225-UNIMOD:21,227-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|P55084-2|ECHB_HUMAN	Isoform 2 of Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	327-UNIMOD:510,334-UNIMOD:21,339-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	122-UNIMOD:510,127-UNIMOD:21,129-UNIMOD:510	0.07	18.0	1	1	1
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	435-UNIMOD:510,436-UNIMOD:21,441-UNIMOD:21,447-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	428-UNIMOD:510,438-UNIMOD:21,441-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|P31327-2|CPSM_HUMAN	Isoform 2 of Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	180-UNIMOD:510,183-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9NUP9|LIN7C_HUMAN	Protein lin-7 homolog C OS=Homo sapiens OX=9606 GN=LIN7C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	112-UNIMOD:510,118-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	515-UNIMOD:510,516-UNIMOD:21,526-UNIMOD:510	0.01	18.0	1	1	1
PRT	sp|Q9NVS9-4|PNPO_HUMAN	Isoform 4 of Pyridoxine-5'-phosphate oxidase OS=Homo sapiens OX=9606 GN=PNPO	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	207-UNIMOD:510,213-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P61081|UBC12_HUMAN	NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	170-UNIMOD:510,172-UNIMOD:21,177-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|Q9NZB2-2|F120A_HUMAN	Isoform B of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	89-UNIMOD:510,94-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P53611|PGTB2_HUMAN	Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens OX=9606 GN=RABGGTB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	23-UNIMOD:510,26-UNIMOD:21,33-UNIMOD:510	0.04	18.0	1	1	1
PRT	sp|Q9BVP2-2|GNL3_HUMAN	Isoform 2 of Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	523-UNIMOD:510,536-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	199-UNIMOD:510,207-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|O95456-2|PSMG1_HUMAN	Isoform 2 of Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	255-UNIMOD:510,256-UNIMOD:35,267-UNIMOD:21	0.05	18.0	1	1	0
PRT	sp|O60488-2|ACSL4_HUMAN	Isoform Short of Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	536-UNIMOD:510,541-UNIMOD:21,546-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|Q9BUP3-2|HTAI2_HUMAN	Isoform 2 of Oxidoreductase HTATIP2 OS=Homo sapiens OX=9606 GN=HTATIP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	55-UNIMOD:510,62-UNIMOD:21,63-UNIMOD:510	0.08	18.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	45-UNIMOD:510,52-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P26885|FKBP2_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo sapiens OX=9606 GN=FKBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	104-UNIMOD:510,112-UNIMOD:21	0.09	18.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	283-UNIMOD:510,297-UNIMOD:21,299-UNIMOD:510	0.04	18.0	1	1	1
PRT	sp|Q9NPI1|BRD7_HUMAN	Bromodomain-containing protein 7 OS=Homo sapiens OX=9606 GN=BRD7 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	187-UNIMOD:510,190-UNIMOD:21,197-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	80-UNIMOD:510,84-UNIMOD:21,86-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P36915-2|GNL1_HUMAN	Isoform 2 of Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	420-UNIMOD:510,422-UNIMOD:21,430-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1233-UNIMOD:510,1241-UNIMOD:21	0.01	18.0	1	1	0
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	493-UNIMOD:510,509-UNIMOD:21,511-UNIMOD:510	0.04	18.0	1	1	1
PRT	sp|O95297-5|MPZL1_HUMAN	Isoform 5 of Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	108-UNIMOD:510,113-UNIMOD:21	0.09	18.0	1	1	1
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	200-UNIMOD:510,207-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|P11498|PYC_HUMAN	Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	831-UNIMOD:510,834-UNIMOD:21,835-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	640-UNIMOD:510,659-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q9NRX4|PHP14_HUMAN	14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	49-UNIMOD:510,52-UNIMOD:21,57-UNIMOD:21,59-UNIMOD:510	0.10	18.0	1	1	1
PRT	sp|Q9HB71-3|CYBP_HUMAN	Isoform 3 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	120-UNIMOD:510,122-UNIMOD:21,128-UNIMOD:510	0.05	18.0	1	1	1
PRT	sp|Q9HB07|MYG1_HUMAN	MYG1 exonuclease OS=Homo sapiens OX=9606 GN=MYG1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	189-UNIMOD:510,189-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P61163|ACTZ_HUMAN	Alpha-centractin OS=Homo sapiens OX=9606 GN=ACTR1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	33-UNIMOD:510,33-UNIMOD:21,34-UNIMOD:4,38-UNIMOD:21,43-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|O75083|WDR1_HUMAN	WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=WDR1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	96-UNIMOD:510,98-UNIMOD:21,104-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	28-UNIMOD:510,28-UNIMOD:21,36-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|P29320|EPHA3_HUMAN	Ephrin type-A receptor 3 OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	null	736-UNIMOD:510,736-UNIMOD:21,742-UNIMOD:21	0.01	18.0	1	1	0
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	1253-UNIMOD:510,1258-UNIMOD:21	0.01	18.0	1	1	0
PRT	sp|Q99426|TBCB_HUMAN	Tubulin-folding cofactor B OS=Homo sapiens OX=9606 GN=TBCB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	95-UNIMOD:510,98-UNIMOD:21,106-UNIMOD:510	0.05	18.0	1	1	0
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	49-UNIMOD:510,54-UNIMOD:21,58-UNIMOD:510	0.07	18.0	1	1	1
PRT	sp|O95456|PSMG1_HUMAN	Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	276-UNIMOD:510,277-UNIMOD:35,287-UNIMOD:21	0.05	18.0	1	1	0
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	110-UNIMOD:510,115-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	773-UNIMOD:510,805-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	null	634-UNIMOD:510,634-UNIMOD:21	0.02	18.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	1	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2522	32.256	2	2302.9275	2302.9275	R	S	314	339
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	2	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=4234	45.542	3	3586.4667	3586.4667	R	-	207	238
PSM	DNLTLWTSDQQDDDGGEGNN	3	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	44.0	1-UNIMOD:510	ms_run[1]:scan=4863	51.22501166666667	2	2226.945378	2226.936145	R	-	228	248
PSM	AEDGSVIDYELIDQDAR	4	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4664	49.275	2	2021.9043	2021.9043	R	D	198	215
PSM	RQDEDYDEQVEESLQDEDDNDVYILTK	5	sp|O00410-2|IPO5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,6-UNIMOD:21,27-UNIMOD:510	ms_run[2]:scan=5013	52.576	3	3450.5148	3450.5148	K	V	755	782
PSM	DYEEVGVDSVEGEGEEEGEEY	6	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4957	52.12036833333333	2	2461.936380	2461.927019	K	-	431	452
PSM	AAVPSGASTGIYEALELR	7	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=5087	53.348	2	1917.9661	1917.9661	R	D	33	51
PSM	EAAGEGPALYEDPPDQK	8	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,10-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=2250	30.205	2	1933.8983	1933.8983	K	T	36	53
PSM	TSIDAYDNFDNISLAQR	9	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4743	50.163	2	2055.9363	2055.9363	R	L	1482	1499
PSM	VGLIGSCTNSSYEDMGR	10	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=3368	38.721	2	1958.8327	1958.8327	R	S	379	396
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	11	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=4693	49.56102333333333	3	3570.4862	3570.4712	R	-	207	238
PSM	DNLTLWTSDTQGDEAEAGEGGEN	12	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510	ms_run[2]:scan=4995	52.433	2	2442.0519	2442.0519	R	-	223	246
PSM	DYEEVGVDSVEGEGEEEGEEY	13	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4573	48.435	2	2461.927	2461.9270	K	-	396	417
PSM	DYEEVGVDSVEGEGEEEGEEY	14	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510	ms_run[2]:scan=4658	49.227	2	2381.9607	2381.9607	K	-	396	417
PSM	NYTDEAIETDDLTIK	15	sp|O14818-2|PSA7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,2-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4059	44.086	2	1887.9027	1887.9027	K	L	105	120
PSM	TVDFTQDSNYLLTGGQDK	16	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4839	51.033	2	2149.0253	2149.0253	K	L	105	123
PSM	DYEEVGADSADGEDEGEEY	17	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3694	41.228	2	2191.7691	2191.7691	K	-	431	450
PSM	QTIDNSQGAYQEAFDISK	18	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3609	40.577	2	2162.0205	2162.0205	K	K	140	158
PSM	DYEEVGVDSVEGEGEEEGEEY	19	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4849	51.113155	2	2461.9359	2461.9265	K	-	431	452
PSM	YADLTEDQLPSCESLK	20	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[1]:scan=3844	42.39037166666667	2	2015.9517	2015.9430	R	D	142	158
PSM	ASNLENSTYDLYTIPK	21	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4215	45.391	2	2055.948	2055.9480	R	D	383	399
PSM	DLYANTVLSGGTTMYPGIADR	22	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=4857	51.175	2	2344.087	2344.0870	K	M	292	313
PSM	GNAGQSNYGFANSAMER	23	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=1677	25.904	2	1902.778	1902.7780	R	I	2027	2044
PSM	ELFDDPSYVNVQNLDK	24	sp|P29353-5|SHC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,8-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4899	51.536	2	2042.9874	2042.9874	R	A	206	222
PSM	RAEDGSVIDYELIDQDAR	25	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3988	43.531	2	2178.0054	2178.0054	R	D	197	215
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	26	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4693	49.561	3	3570.4718	3570.4718	R	-	207	238
PSM	TSRPENAIIYNNNEDFQVGQAK	27	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,10-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=3254	37.86	3	2655.2966	2655.2966	R	V	472	494
PSM	TYADYESVNECMEGVCK	28	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=3541	40.054	2	2201.8993	2201.8993	R	M	18	35
PSM	VDATEESDLAQQYGVR	29	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2953	35.574	2	1893.857	1893.8570	K	G	82	98
PSM	YTDQGGEEEEDYESEEQLQHR	30	sp|O75208-2|COQ9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2096	29.043	3	2684.0612	2684.0612	R	I	82	103
PSM	NPDDITQEEYGEFYK	31	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3781	41.895345	2	1994.8909	1994.8818	R	S	292	307
PSM	QVYEEEYGSSLEDDVVGDTSGYYQR	32	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=4973	52.25243833333333	3	3001.2742	3001.2602	K	M	127	152
PSM	TYIDPDTYEDPSLAVHEFAK	33	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=4965	52.186461666666666	3	2538.139589	2538.128105	K	E	605	625
PSM	DNLTLWTSENQGDEGDAGEGEN	34	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=4814	50.832	2	2384.01	2384.0100	R	-	223	245
PSM	DYEEVGVDSVEGEGEEEGEEY	35	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,2-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=5120	53.68	2	2541.8933	2541.8933	K	-	396	417
PSM	GNAGQSNYGFANSAMER	36	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2475	31.906	2	1886.7831	1886.7831	R	I	2027	2044
PSM	GTENEDAGSDYQSDNQASWIHR	37	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2480	31.946	3	2593.0567	2593.0567	K	M	446	468
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	38	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4140	44.744	3	3090.3451	3090.3451	K	E	120	146
PSM	DYEEVGVDSVEGEGEEEGEEY	39	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=5074	53.233169999999994	2	2461.9359	2461.9265	K	-	431	452
PSM	TDLNPDNLQGGDDLDPNYVLSSR	40	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=5219	54.72911	3	2631.204596	2631.191388	K	V	108	131
PSM	DATNVGDEGGFAPNILENK	41	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4493	47.72	2	2028.0436	2028.0436	K	E	203	222
PSM	DDEEADAIYAALDK	42	sp|O94906-2|PRP6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=5323	55.787	2	1685.771	1685.7710	K	R	97	111
PSM	DFPEYTFAIADEEDYAGEVK	43	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,15-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5866	62.993	2	2456.0985	2456.0985	K	D	444	464
PSM	DNLTLWTSENQGDEGDAGEGEN	44	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=4819	50.873	3	2384.01	2384.0100	R	-	223	245
PSM	EAQRDYLDFLDDEEDQGIYQSK	45	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,6-UNIMOD:21,19-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=5317	55.74	3	2904.2416	2904.2416	R	V	14	36
PSM	EILVGDVGQTVDDPYATFVK	46	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,15-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5226	54.804	2	2313.1818	2313.1818	K	M	54	74
PSM	GNDISSGTVLSDYVGSGPPK	47	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=3893	42.77	2	2097.0304	2097.0304	K	G	94	114
PSM	QLEVYTSGGDPESVAGEYGR	48	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3773	41.835	2	2226.9894	2226.9894	R	H	195	215
PSM	TDYNASVSVPDSSGPER	49	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2249	30.198	2	1893.8206	1893.8206	R	I	70	87
PSM	VNDGVCDCCDGTDEYNSGVICENTCK	50	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,6-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:21,21-UNIMOD:4,25-UNIMOD:4,26-UNIMOD:510	ms_run[2]:scan=2825	34.597	3	3188.2175	3188.2175	R	E	92	118
PSM	TYIDPDTYEDPSLAVHEFAK	51	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,8-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=4682	49.43759166666667	3	2458.173921	2458.161774	K	E	605	625
PSM	EQGPYETYEGSPVSK	52	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=2069	28.842148333333334	2	1817.8481	1817.8392	K	G	549	564
PSM	EAQRDYLDFLDDEEDQGIYQSK	53	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,6-UNIMOD:21,21-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=5317	55.739866666666664	3	2904.255290	2904.241631	R	V	14	36
PSM	AGGIETIANEYSDR	54	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2878	35.003	2	1608.7245	1608.7245	R	C	20	34
PSM	AVTEQGAELSNEER	55	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=1434	24.055	2	1565.7745	1565.7745	K	N	28	42
PSM	DNLTLWTSDQQDDDGGEGNN	56	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4989	52.381	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDQQDEEAGEGN	57	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4909	51.622	2	2154.9402	2154.9402	R	-	228	247
PSM	EAQRDYLDFLDDEEDQGIYQSK	58	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,6-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=5058	53.028	3	2824.2753	2824.2753	R	V	14	36
PSM	ENPGFDFSGAEISGNYTK	59	sp|Q8WVJ2|NUDC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,17-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4506	47.84	2	2079.9463	2079.9463	K	G	130	148
PSM	ETVSEESNVLCLSK	60	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3277	38.03	2	1661.8818	1661.8818	R	S	581	595
PSM	NQDATVYVGGLDEK	61	sp|Q15427|SF3B4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2940	35.478	2	1655.808	1655.8080	R	V	10	24
PSM	NQYDNDVTVWSPQGR	62	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3591	40.436	2	1891.8314	1891.8314	R	I	4	19
PSM	QEPLGSDSEGVNCLAYDEAIMAQQDR	63	sp|Q96FW1|OTUB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,13-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=5183	54.358	3	3009.2945	3009.2945	K	I	11	37
PSM	QSDDEVYAPGLDIESSLK	64	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,7-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4892	51.464	2	2113.014	2113.0140	K	Q	385	403
PSM	SGGIETIANEYSDR	65	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2824	34.59	2	1624.7194	1624.7194	R	C	20	34
PSM	SSGPYGGGGQYFAK	66	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2173	29.625	2	1602.6793	1602.6793	R	P	232	246
PSM	TSCGSPNYAAPEVISGR	67	sp|P54646|AAPK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=2532	32.331	2	1878.8395	1878.8395	R	L	172	189
PSM	TTYDSSLSSYTVPLEK	68	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4110	44.499	2	2017.9211	2017.9211	K	D	268	284
PSM	TYIDPDTYEDPSLAVHEFAK	69	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=4965	52.186461666666666	3	2538.1382	2538.1272	K	E	605	625
PSM	AGGIETIANEYSDR	70	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=2878	35.003233333333334	2	1608.7314	1608.7240	R	C	20	34
PSM	GAVYSFDPVGSYQR	71	sp|P20618|PSB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=3856	42.48411	2	1658.7631	1658.7549	K	D	147	161
PSM	ENPGFDFSGAEISGNYTK	72	sp|Q8WVJ2|NUDC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,16-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=4506	47.83974166666667	2	2079.9555	2079.9458	K	G	130	148
PSM	ADNFEYSDPVDGSISR	73	sp|P36871-2|PGM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3488	39.649	2	1884.7991	1884.7991	K	N	489	505
PSM	DSLYVDGDCTMDIR	74	sp|P35080-2|PROF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=3244	37.785	2	1788.716	1788.7160	R	T	76	90
PSM	DWEDDSDEDMSNFDR	75	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=3134	36.938	2	1924.7117	1924.7117	K	F	75	90
PSM	DWILPSDYDHAEAEAR	76	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4282	45.927	2	2000.873	2000.8730	K	H	256	272
PSM	DYEEVGVDSVEGEGEEEGEEY	77	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,2-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=5121	53.688	3	2541.8933	2541.8933	K	-	396	417
PSM	EDMAALEKDYEEVGVDSVEGEGEEEGEEY	78	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,8-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=5130	53.781	3	3383.396	3383.3960	R	-	388	417
PSM	SYELPDGQVITIGNER	79	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:21	ms_run[2]:scan=4759	50.298	2	1869.851	1869.8510	K	F	239	255
PSM	SYELPDGQVITIGNER	80	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4768	50.369	2	1823.9478	1823.9478	K	F	239	255
PSM	TAENATSGETLEENEAGD	81	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=1928	27.792	2	1870.8128	1870.8128	K	-	323	341
PSM	TDLNPDNLQGGDDLDPNYVLSSR	82	sp|P12277|KCRB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=5228	54.819	2	2631.1914	2631.1914	K	V	108	131
PSM	TGGAYGEDLGADYNLSQVCDGK	83	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:510,13-UNIMOD:21,19-UNIMOD:4,22-UNIMOD:510	ms_run[1]:scan=3999	43.61778833333333	3	2437.090095	2437.078121	K	V	2450	2472
PSM	TYIDPDTYEDPSLAVHEFAK	84	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,1-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=4951	52.03892333333334	3	2458.1802	2458.1612	K	E	605	625
PSM	DYEEVGVDSVEGEGEEEGEEY	85	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4851	51.128523333333334	3	2461.939632	2461.927019	K	-	431	452
PSM	LNIQPSEADYAVDIR	86	sp|Q9NYU2|UGGG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=4300	46.07288666666666	2	1816.890879	1816.882063	K	S	440	455
PSM	GTENEDAGSDYQSDNQASWIHR	87	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=2480	31.94558833333333	3	2593.0682	2593.0562	K	M	446	468
PSM	APQETYADIGGLDNQIQEIK	88	sp|P62191-2|PRS4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4661	49.249	2	2350.173	2350.1730	K	E	106	126
PSM	DMESDYSGQGVDQLQR	89	sp|P04818|TYSY_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2911	35.251	2	1940.8036	1940.8036	R	V	148	164
PSM	DYEEVGVDSVEGEGEEEGEEY	90	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=5565	58.726	2	2461.927	2461.9270	K	-	396	417
PSM	FLCADYAEQDELDYHR	91	sp|Q9UKV3-3|ACINU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=3656	40.932	3	2157.8927	2157.8927	K	G	323	339
PSM	IDFYFDENPYFENK	92	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=5583	58.949	2	1987.8917	1987.8917	R	V	112	126
PSM	KEESEESDDDMGFGLFD	93	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4479	47.604	2	2032.8732	2032.8732	K	-	73	90
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	94	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2348	30.951	3	2847.2212	2847.2212	K	M	445	470
PSM	LGNYAGAVQDCER	95	sp|O43765|SGTA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=2055	28.741	2	1565.6758	1565.6758	K	A	138	151
PSM	QVYEEEYGSSLEDDVVGDTSGYYQR	96	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4973	52.252	3	3001.2603	3001.2603	K	M	127	152
PSM	SGQVYSFGCNDEGALGR	97	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3167	37.188	2	1929.8141	1929.8141	K	D	85	102
PSM	SSGPYGGGGQYFAK	98	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2247	30.181	2	1522.713	1522.7130	R	P	232	246
PSM	TYIDPDTYEDPSLAVHEFAK	99	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,12-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4682	49.438	3	2458.1618	2458.1618	K	E	605	625
PSM	TYIDPDTYEDPSLAVHEFAK	100	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4951	52.039	3	2458.1618	2458.1618	K	E	605	625
PSM	TYIDPDTYEDPSLAVHEFAK	101	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4966	52.194	3	2458.1618	2458.1618	K	E	605	625
PSM	TYIDPDTYEDPSLAVHEFAK	102	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:21,8-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4965	52.186	3	2538.1281	2538.1281	K	E	605	625
PSM	VHNDAQSFDYDHDAFLGAEEAK	103	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=3358	38.647	3	2626.165	2626.1650	K	T	38	60
PSM	VIAINVDDPDAANYNDINDVK	104	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,14-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=4440	47.275	3	2435.1894	2435.1894	K	R	156	177
PSM	VIAINVDDPDAANYNDINDVK	105	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,14-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=4446	47.322	2	2435.1894	2435.1894	K	R	156	177
PSM	VLEDDPEAAYTTTGGK	106	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,10-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=2224	30.012185	2	1813.8738	1813.8654	R	I	822	838
PSM	DYEEVGADSADGEDEGEEY	107	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=7609	96.730845	2	2192.7672	2191.7682	K	-	431	450
PSM	DYEEVGVDSVEGEGEEEGEEY	108	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=7588	96.27435	2	2461.9372	2461.9262	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	109	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=5179	54.308081666666666	2	2461.9359	2461.9265	K	-	431	452
PSM	GAYGGGYGGYDDYNGYNDGYGFGSDR	110	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=4378	46.75663333333333	3	2830.0802	2830.0662	R	F	234	260
PSM	TTYDSSLSSYTVPLEK	111	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=4110	44.498648333333335	2	2017.930543	2017.921072	K	D	268	284
PSM	EILVGDVGQTVDDPYATFVK	112	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,17-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=5226	54.80407833333333	2	2313.191896	2313.181781	K	M	54	74
PSM	ASNLENSTYDLYTIPK	113	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,9-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4332	46.355	2	1975.9816	1975.9816	R	D	383	399
PSM	GAYGGGYGGYDDYNGYNDGYGFGSDR	114	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4378	46.757	3	2830.0669	2830.0669	R	F	234	260
PSM	GIAAQPLYAGYCNHENM	115	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=3113	36.781	2	2037.8538	2037.8538	R	-	540	557
PSM	GIVDQSQQAYQEAFEISK	116	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4176	45.039	2	2188.0726	2188.0726	K	K	140	158
PSM	GMAAAGNYAWVNR	117	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2997	35.907	2	1493.6699	1493.6699	K	S	309	322
PSM	HDDSSDNFCEADDIQSPEAEYVDLLLNPER	118	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,9-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=5786	61.868	3	3606.5194	3606.5194	K	Y	158	188
PSM	IIENAENEYQTAISENYQTMSDTTFK	119	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,9-UNIMOD:21,17-UNIMOD:21,20-UNIMOD:35,26-UNIMOD:510	ms_run[2]:scan=3943	43.168	3	3283.4193	3283.4193	K	A	231	257
PSM	LAYINPDLALEEK	120	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4624	48.953	2	1635.8797	1635.8797	R	N	328	341
PSM	NAEDCLYELPENIR	121	sp|Q9NZ63|TLS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=4452	47.368	2	1848.8177	1848.8177	K	V	141	155
PSM	QEYDESGPSIVHR	122	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1516	24.68	2	1629.7248	1629.7248	K	K	360	373
PSM	QVYEEEYGSSLEDDVVGDTSGYYQR	123	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=5388	56.512	3	3081.2266	3081.2266	K	M	127	152
PSM	SEGTYCCGPVPVR	124	sp|P21980|TGM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=1991	28.258	2	1594.6733	1594.6733	K	A	365	378
PSM	SEYSELDEDESQAPYDPNGKPER	125	sp|P19387|RPB3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,1-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2740	33.953	3	2802.2182	2802.2182	K	F	206	229
PSM	SGDSEVYQLGDVSQK	126	sp|Q04837|SSBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,7-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2974	35.736	2	1758.835	1758.8350	R	T	67	82
PSM	SPDTNYLFMGDYVDR	127	sp|P67775-2|PP2AA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=5184	54.366	2	1905.8068	1905.8068	K	G	75	90
PSM	SYELPDGQVITIGNER	128	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4595	48.704	2	1903.9141	1903.9141	K	F	239	255
PSM	TAFQEALDAAGDK	129	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3251	37.839	2	1403.7569	1403.7569	K	L	9	22
PSM	TDMDNQIVVSDYAQMDR	130	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,12-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=3264	37.935	2	2129.8859	2129.8859	K	V	228	245
PSM	TPEELDDSDFETEDFDVR	131	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4977	52.286	2	2271.9157	2271.9157	R	S	264	282
PSM	TTGFGMIYDSLDYAK	132	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=5945	64.136	2	1908.8294	1908.8294	K	K	69	84
PSM	VEFNVNYTQDLDK	133	sp|Q9GZT8-3|NIF3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4055	44.055	2	1731.8393	1731.8393	R	V	169	182
PSM	YYDDIYFDSDSEDEDR	134	sp|Q56P03|EAPP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4119	44.573	2	2159.7945	2159.7945	R	A	101	117
PSM	YYDVMSDEEIER	135	sp|O15460-2|P4HA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3431	39.207	2	1661.6744	1661.6744	R	I	341	353
PSM	SEYSELDEDESQAPYDPNGKPER	136	sp|P19387|RPB3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=2740	33.95317166666667	3	2802.2302	2802.2172	K	F	206	229
PSM	SEGTYCCGPVPVR	137	sp|P21980|TGM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1991	28.258343333333336	2	1594.680513	1594.673333	K	A	365	378
PSM	DSLYVDGDCTMDIR	138	sp|P35080|PROF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:35	ms_run[1]:scan=3244	37.78512333333333	2	1788.724470	1788.715985	R	T	76	90
PSM	AEDGSVIDYELIDQDARDLYDAGVK	139	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,9-UNIMOD:21,20-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=6040	65.584	3	2997.357	2997.3570	R	R	198	223
PSM	AEEYEFLTPVEEAPK	140	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4422	47.134	2	1898.9227	1898.9227	R	G	153	168
PSM	DFQDYMEPEEGCQGSPQR	141	sp|O43237-2|DC1L2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=3803	42.067	2	2285.8819	2285.8819	K	R	103	121
PSM	ELPPDQAEYCIAR	142	sp|O43707-2|ACTN4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=2965	35.667	2	1674.7537	1674.7537	R	M	651	664
PSM	FVESVDEYQFVER	143	sp|Q13405|RM49_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3970	43.385	2	1759.7918	1759.7919	R	L	38	51
PSM	GILAADESTGSIAK	144	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=2377	31.169	2	1399.8195	1399.8195	K	R	29	43
PSM	HELQANCYEEVK	145	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,7-UNIMOD:4,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1300	22.987	2	1666.7699	1666.7699	K	D	133	145
PSM	IGGDAGTSLNSNDYGYGGQK	146	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,14-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2465	31.831	2	2120.9688	2120.9688	K	R	45	65
PSM	IIYGGSVTGATCK	147	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1917	27.71	2	1473.7575	1473.7575	R	E	244	257
PSM	LFQQIYSDGSDEVK	148	sp|Q9Y2Z0-2|SGT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3199	37.434	2	1775.8655	1775.8655	R	R	280	294
PSM	LISWYDNEFGYSNR	149	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=5099	53.461	2	1876.8245	1876.8245	K	V	310	324
PSM	NSYVAGQYDDAASYQR	150	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2272	30.368	2	1920.8104	1920.8104	R	L	105	121
PSM	NYAAALETFTEGQK	151	sp|Q9Y2Z0-2|SGT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4423	47.141	2	1689.8288	1689.8288	K	L	94	108
PSM	SFEGNNNYDTPELR	152	sp|O14786-3|NRP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2845	34.752	2	1768.7518	1768.7518	K	T	539	553
PSM	SYELPDGQVITIGNER	153	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4221	45.439	2	1903.9141	1903.9141	K	F	239	255
PSM	TDDYLDQPCLETVNR	154	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3737	41.554	2	1951.8447	1951.8447	R	I	194	209
PSM	TYGGCEGPDAMYVK	155	sp|Q15369|ELOC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2888	35.076	2	1774.7021	1774.7021	K	L	7	21
PSM	YISPDQLADLYK	156	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4960	52.143	2	1572.8113	1572.8113	R	S	270	282
PSM	YSQVLANGLDNK	157	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2566	32.594	2	1468.7599	1468.7599	K	L	95	107
PSM	NPDDITNEEYGEFYK	158	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3788	41.94853833333333	2	2060.8417	2060.8325	R	S	300	315
PSM	QTIDNSQGAYQEAFDISKK	159	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510,19-UNIMOD:510	ms_run[1]:scan=3027	36.134434999999996	3	2324.1892	2324.1782	K	E	140	159
PSM	TYIDPDTYEDPSLAVHEFAK	160	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=4927	51.79211166666666	2	2538.1367	2538.1276	K	E	605	625
PSM	ESLVVNYEDLAAR	161	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=3956	43.273693333333334	2	1591.778434	1591.770721	R	E	228	241
PSM	QGGPTYYIDTNALR	162	sp|O96019|ACL6A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=3975	43.42529	2	1681.800778	1681.792519	K	V	63	77
PSM	ASGNYATVISHNPETK	163	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,7-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=1610	25.378891666666664	2	1835.917744	1835.909128	R	K	129	145
PSM	ASNLENSTYDLYTIPK	164	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=4215	45.391185	2	2055.958131	2055.947956	R	D	383	399
PSM	AVYTQDCPLAAAK	165	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2445	31.684	2	1554.779	1554.7790	K	A	665	678
PSM	CDYENVPTTVFTPLEYGACGLSEEK	166	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:510	ms_run[2]:scan=5871	63.056	3	3026.3603	3026.3603	K	A	327	352
PSM	CEFQDAYVLLSEK	167	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5107	53.543	2	1748.8369	1748.8369	K	K	237	250
PSM	CLYASVLTAQPR	168	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=3583	40.375	2	1491.7369	1491.7369	R	L	728	740
PSM	DFPEYTFAIADEEDYAGEVK	169	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,15-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5860	62.934	3	2456.0985	2456.0985	K	D	444	464
PSM	DSGSDEDFLMEDDDDSDYGSSK	170	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:35,18-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4012	43.718	3	2591.9531	2591.9531	K	K	89	111
PSM	EEASDYLELDTIK	171	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4319	46.247	2	1592.8458	1592.8458	K	N	253	266
PSM	ELAPYDENWFYTR	172	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=5574	58.849	2	1896.7585	1896.7585	K	A	44	57
PSM	ELSDPAGAIIYTSR	173	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=4204	45.305	2	1605.7864	1605.7864	K	F	528	542
PSM	ETIPLQETSLYTQDR	174	sp|P50897-2|PPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3716	41.397	2	1906.9138	1906.9138	K	L	151	166
PSM	EVDEQMLNVQNK	175	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1707	26.124	2	1529.8032	1529.8032	K	N	325	337
PSM	EVDEQMLNVQNK	176	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2673	33.437	2	1513.8083	1513.8083	K	N	325	337
PSM	EYLPIGGLAEFCK	177	sp|P00505|AATM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=5511	57.989	2	1643.8307	1643.8307	K	A	95	108
PSM	EYQDAFLFNELK	178	sp|Q9Y230-2|RUVB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5510	57.982	2	1663.8171	1663.8171	K	G	400	412
PSM	FNALFAQGNYSEAAK	179	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3892	42.763	2	1777.8713	1777.8713	K	V	368	383
PSM	GAMAATYSALNR	180	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2078	28.91	2	1338.6216	1338.6216	K	N	701	713
PSM	GGTYDTYVGSGWLIK	181	sp|Q96AY3|FKB10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=5589	59.018	2	1843.8471	1843.8471	K	G	198	213
PSM	GIVDQSQQAYQEAFEISKK	182	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3768	41.797	3	2350.2306	2350.2306	K	E	140	159
PSM	IIENAENEYQTAISENYQTMSDTTFK	183	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21,17-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4651	49.171	3	3267.4244	3267.4244	K	A	231	257
PSM	LISWYDNEFGYSNR	184	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=5416	56.812	2	1956.7909	1956.7909	K	V	310	324
PSM	NGSEADIDEGLYSR	185	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2504	32.122	2	1638.6987	1638.6987	K	Q	4	18
PSM	NYAGEEEEEGSGSSEGFDPPATDR	186	sp|P16989-3|YBOX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2763	34.127	3	2643.0346	2643.0346	R	Q	191	215
PSM	SLYDEVAAQGEVVRK	187	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3267	37.957	2	1810.9503	1810.9503	K	L	825	840
PSM	TYEQVLENLESK	188	sp|Q16762|THTR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4052	44.033	2	1599.807	1599.8070	K	R	164	176
PSM	TYGGCEGPDAMYVK	189	sp|Q15369|ELOC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=2685	33.53	2	1694.7358	1694.7358	K	L	7	21
PSM	YISPDQLADLYK	190	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4315	46.214	2	1572.8113	1572.8113	R	S	270	282
PSM	DYEEVGVDSVEGEGEEEGEEY	191	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=7542	95.18793166666667	2	2461.9372	2461.9262	K	-	431	452
PSM	ELAPYDENWFYTR	192	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=5175	54.25845833333334	2	1816.800976	1816.792185	K	A	44	57
PSM	LAPDYDALDVANK	193	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=3625	40.69875666666667	2	1551.793354	1551.785825	R	I	140	153
PSM	SEDYVDIVQGNR	194	sp|O00469|PLOD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=2959	35.62113166666666	2	1507.6837	1507.6763	R	V	441	453
PSM	EGENTQVAEPEACDQMYESLAR	195	sp|Q9BRT2|UQCC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,13-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=3550	40.12365333333333	3	2641.1062	2640.0932	R	L	41	63
PSM	EQGPYETYEGSPVSK	196	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=2069	28.842148333333334	2	1817.848578	1817.839711	K	G	549	564
PSM	GGTYDTYVGSGWLIK	197	sp|Q96AY3|FKB10_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=5589	59.017915	2	1843.856395	1843.847119	K	G	198	213
PSM	DYEEVGVDSVEGEGEEEGEEY	198	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=4849	51.113155	2	2461.936380	2461.927019	K	-	431	452
PSM	AFLAELEQNSPK	199	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4150	44.826	2	1493.7803	1493.7803	K	I	2424	2436
PSM	DINAYNCEEPTEK	200	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1874	27.381	2	1729.7543	1729.7543	K	L	85	98
PSM	EALTYDGALLGDR	201	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3911	42.913	2	1506.718	1506.7180	K	S	97	110
PSM	EIDDTYIEDAADVDAR	202	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4257	45.727	2	1923.8199	1923.8199	R	K	506	522
PSM	EMLNLYIENEGK	203	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:35,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3755	41.694	2	1615.7841	1615.7841	R	M	592	604
PSM	ETCAWFTDNYEQAR	204	sp|Q13630|FCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=3996	43.594	2	1903.766	1903.7660	K	K	307	321
PSM	EYIPTVFDNYSAQSAVDGR	205	sp|P84095|RHOG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=5037	52.809	3	2245.0153	2245.0153	K	T	31	50
PSM	HEQNIDCGGGYVK	206	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:4,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1034	20.817	2	1623.7389	1623.7389	K	L	99	112
PSM	HWILPQDYDHAQAEAR	207	sp|Q15293-2|RCN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3008	35.992	3	2062.9475	2062.9475	R	H	220	236
PSM	IEIDNGDELTADFLYEEVHPK	208	sp|Q12792-3|TWF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,15-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=5755	61.418	3	2594.2466	2594.2466	K	Q	302	323
PSM	MNVSPDVNYEELAR	209	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3649	40.879	2	1749.7857	1749.7857	K	C	373	387
PSM	NNDFYVTGESYAGK	210	sp|Q9H3G5|CPVL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3296	38.172	2	1711.7767	1711.7767	K	Y	195	209
PSM	NNDGYIDYAEFAK	211	sp|Q8NI22-2|MCFD2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4207	45.327	2	1666.7553	1666.7553	K	S	79	92
PSM	NPDDITNEEYGEFYK	212	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3895	42.785	2	1980.8667	1980.8667	R	S	300	315
PSM	NPDDITQEEYGEFYK	213	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3954	43.255	2	1994.8823	1994.8823	R	S	292	307
PSM	NVNIYRDSAIPVESDTDDEGAPR	214	sp|Q96D46|NMD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3189	37.356	3	2646.2023	2646.2023	K	I	455	478
PSM	QTTVSNSQQAYQEAFEISK	215	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3315	38.315	3	2306.1104	2306.1104	K	K	139	158
PSM	SEDPDQQYLILNTAR	216	sp|Q96QK1|VPS35_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3857	42.491	2	1875.8828	1875.8828	R	K	500	515
PSM	SLYESFVSSSDR	217	sp|P18615-3|NELFE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3718	41.411	2	1489.655	1489.6550	K	L	138	150
PSM	SVTEQGAELSNEER	218	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=1571	25.092	2	1581.7695	1581.7695	K	N	28	42
PSM	SWASPVYTEADGTFSR	219	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4253	45.692	2	1886.83	1886.8300	R	L	342	358
PSM	TYIDPDTYEDPSLAVHEFAK	220	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4856	51.168	3	2538.1281	2538.1281	K	E	605	625
PSM	TYSYLTPDLWK	221	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:21,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=5622	59.45	2	1613.7456	1613.7456	K	E	247	258
PSM	VAVVDYVEPSPQGTR	222	sp|Q9NNW7-2|TRXR2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3561	40.207	2	1729.85	1729.8500	K	W	39	54
PSM	RAEDGSVIDYELIDQDAR	223	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=3976	43.43259666666667	3	2178.0162	2178.0052	R	D	179	197
PSM	TAFDEAIAELDTLSEESYK	224	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,18-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=6120	67.06643000000001	3	2279.0872	2279.0762	K	D	194	213
PSM	DNLTLWTSDTQGDEAEAGEGGEN	225	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510	ms_run[1]:scan=4996	52.44039166666666	3	2442.0632	2442.0512	R	-	223	246
PSM	VEIIANDQGNR	226	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510	ms_run[1]:scan=1578	25.145308333333336	2	1261.6892	1261.6834	K	T	26	37
PSM	EAAENSLVAYK	227	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=1968	28.090731666666667	2	1341.6913	1341.6849	K	A	143	154
PSM	INVYYNEATGGK	228	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2534	32.34917	2	1555.707215	1555.699727	R	Y	47	59
PSM	DQGTYEDYVEGLR	229	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=4043	43.960611666666665	2	1657.716581	1657.708515	K	V	82	95
PSM	MNVSPDVNYEELAR	230	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,1-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=2993	35.879015	2	1765.7884	1765.7801	K	C	373	387
PSM	KLENCNYAVELGK	231	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,5-UNIMOD:4,7-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=2118	29.204861666666663	2	1718.9238	1718.9158	K	H	459	472
PSM	ASGNYATVISHNPETK	232	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=1610	25.378891666666664	2	1835.9172	1835.9086	R	K	129	145
PSM	AALVAQNYINYQQGTPHR	233	sp|Q9BS40|LXN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=2918	35.30484833333333	3	2158.070718	2157.058070	R	V	13	31
PSM	AVYTQDCPLAAAK	234	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,13-UNIMOD:510	ms_run[1]:scan=2445	31.683954999999997	2	1554.786390	1554.778966	K	A	665	678
PSM	SYELPDGQVITIGNER	235	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=4221	45.438991666666666	2	1903.923328	1903.914091	K	F	241	257
PSM	SGQVYSFGCNDEGALGR	236	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=3167	37.18768833333333	2	1929.826233	1929.814060	K	D	85	102
PSM	DMESDYSGQGVDQLQR	237	sp|P04818|TYSY_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=2911	35.251025	2	1940.812791	1940.803554	R	V	148	164
PSM	APVPTGEVYFADSFDR	238	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4842	51.055	2	1883.8555	1883.8555	K	G	62	78
PSM	DFPEYTFAIADEEDYAGEVK	239	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5955	64.271	2	2536.0648	2536.0648	K	D	444	464
PSM	DNLTLWTADNAGEEGGEAPQEPQS	240	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4997	52.448	3	2562.157	2562.1570	R	-	193	217
PSM	DQGTYEDYVEGLR	241	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=3900	42.825	2	1737.6748	1737.6748	K	V	82	95
PSM	DYEEVGVDSVEGEGEEEGEEY	242	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4574	48.442	3	2461.927	2461.9270	K	-	396	417
PSM	DYEEVGVDSVEGEGEEEGEEY	243	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=4666	49.29	3	2381.9607	2381.9607	K	-	396	417
PSM	EGLELPEDEEEK	244	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2868	34.931	2	1483.7566	1483.7566	K	K	547	559
PSM	ELPPDQAEYCIAR	245	sp|O43707-2|ACTN4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=3105	36.721	2	1674.7537	1674.7537	R	M	651	664
PSM	EQGPYETYEGSPVSK	246	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1943	27.902	2	1897.806	1897.8060	K	G	549	564
PSM	EVEIAYSDVAK	247	sp|Q9Y696|CLIC4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2698	33.63	2	1370.7007	1370.7007	K	R	239	250
PSM	GASQAGMTGYGMPR	248	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=1156	21.854	2	1512.6315	1512.6315	R	Q	204	218
PSM	GAVYSFDPVGSYQR	249	sp|P20618|PSB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3978	43.451	2	1738.7217	1738.7217	K	D	147	161
PSM	GDPQVYEELFSYSCPK	250	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=4998	52.456	2	2065.938	2065.9380	K	F	356	372
PSM	HWILPQDYDHAQAEAR	251	sp|Q15293-2|RCN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3013	36.027	2	2062.9475	2062.9475	R	H	220	236
PSM	IGGDAGTSLNSNDYGYGGQK	252	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,14-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2458	31.782	3	2120.9688	2120.9688	K	R	45	65
PSM	ILYSQCGDVMR	253	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=1611	25.386	2	1470.6461	1470.6461	K	A	27	38
PSM	LGEYEDVSRVEK	254	sp|Q99426-2|TBCB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1958	28.017	2	1570.7916	1570.7916	R	Y	44	56
PSM	LQDTYNLDTDTISK	255	sp|P13674-3|P4HA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3010	36.005	2	1773.871	1773.8710	R	G	137	151
PSM	LYGDADYLEER	256	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=3291	38.136	2	1536.5999	1536.5999	K	H	236	247
PSM	QITAQAWDGTTDYQVEETSR	257	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3699	41.268	3	2412.0695	2412.0695	R	E	341	361
PSM	QTTVSNSQQAYQEAFEISK	258	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3321	38.362	2	2306.1104	2306.1104	K	K	139	158
PSM	SEAPNWATQDSGFY	259	sp|P60228|EIF3E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=4701	49.657	2	1685.6823	1685.6823	R	-	432	446
PSM	SIAEEQYSDLEK	260	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2366	31.087	2	1558.744	1558.7440	R	E	930	942
PSM	SYNDELQFLEK	261	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4675	49.362	2	1532.7436	1532.7436	R	I	4	15
PSM	SYPLDLEGGSEYK	262	sp|Q9UET6-2|TRM7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3821	42.209	2	1604.7648	1604.7648	R	Y	247	260
PSM	TDDYLDQPCYETINR	263	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,9-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=3536	40.014	2	2015.8396	2015.8396	R	I	149	164
PSM	TDSDSDLQLYK	264	sp|Q01433-3|AMPD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2481	31.953	2	1431.6807	1431.6807	K	E	69	80
PSM	TTGFGMIYDSLDYAK	265	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:35,8-UNIMOD:21,13-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=5279	55.367	2	1924.8243	1924.8243	K	K	69	84
PSM	VERADGYEPPVQESV	266	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2367	31.094	2	1787.8191	1787.8191	K	-	250	265
PSM	VLGTEDLYDYIDK	267	sp|P68400|CSK21_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5072	53.214	2	1690.8379	1690.8379	K	Y	248	261
PSM	YAALYQPLFDK	268	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4591	48.669	2	1475.7738	1475.7738	K	R	95	106
PSM	YEEIDNAPEER	269	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1451	24.187	2	1477.6186	1477.6186	K	A	92	103
PSM	YRCELLYEGPPDDEAAMGIK	270	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:4,7-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4553	48.239	3	2474.1535	2474.1535	K	S	367	387
PSM	NPDDITNEEYGEFYK	271	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3696	41.24306166666666	2	1980.8753	1980.8661	R	S	300	315
PSM	QTQTFTTYSDNQPGVLIQVYEGER	272	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,4-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=5125	53.72088333333334	3	2967.3292	2967.3152	K	A	424	448
PSM	ELAPYDENWFYTR	273	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=5352	56.106423333333325	2	1816.8008	1816.7917	K	A	44	57
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	274	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,2-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1893	27.52907833333333	3	2318.933277	2318.922441	R	S	326	351
PSM	EIYENMAPGENK	275	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2032	28.572695	2	1541.719192	1541.710946	K	R	108	120
PSM	VLEDDPEAAYTTTGGK	276	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,13-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=2224	30.012185	2	1813.874315	1813.865926	R	I	822	838
PSM	LISWYDNEFGYSNR	277	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=5416	56.812415	2	1956.800112	1956.790879	K	V	310	324
PSM	AMEVDERPTEQYSDIGGLDK	278	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=3174	37.24	3	2400.1193	2400.1193	K	Q	174	194
PSM	CADYVVTGAWSAK	279	sp|Q9Y617-2|SERC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:4,4-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3645	40.847	2	1574.7477	1574.7477	R	A	98	111
PSM	CDPAGYYCGFK	280	sp|P60900-3|PSA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:21,8-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=2798	34.393	2	1484.6142	1484.6142	K	A	75	86
PSM	DAEAHPWLSDYDDLTSATYDK	281	sp|P50542-2|PEX5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=4841	51.047	3	2560.1319	2560.1319	R	G	265	286
PSM	DNLTLWTSDSAGEECDAAEGAEN	282	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=5084	53.322	2	2488.0396	2488.0396	R	-	223	246
PSM	DQVANSAFVER	283	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=2084	28.956	2	1268.6573	1268.6573	K	L	500	511
PSM	EQINQLTSYIDASNVYGSTEHEAR	284	sp|Q92626|PXDN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=4462	47.467	3	2918.2585	2918.2585	R	S	901	925
PSM	ESLKEEDESDDDNM	285	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=1005	20.552	2	1738.7364	1738.7364	K	-	235	249
PSM	GYEEWLLNEIR	286	sp|O43707-2|ACTN4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=5542	58.408	2	1534.7281	1534.7281	K	R	177	188
PSM	ISVYYNEATGGK	287	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2471	31.877	2	1448.7225	1448.7225	R	Y	47	59
PSM	LGDVYVNDAFGTAHR	288	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3627	40.713	2	1747.8143	1747.8143	K	A	129	144
PSM	LQNAENDYINASLVDIEEAQR	289	sp|P17706-3|PTN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=5186	54.384	3	2518.1801	2518.1801	K	S	61	82
PSM	LYTLVLTDPDAPSR	290	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4614	48.873	2	1673.849	1673.8490	K	K	63	77
PSM	NAVITVPAYFNDSQR	291	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4214	45.384	2	1807.8718	1807.8718	K	Q	188	203
PSM	NGQYAEASALYGR	292	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2494	32.048	2	1512.6822	1512.6822	R	A	22	35
PSM	QADYVPSDQDLLR	293	sp|P63092-3|GNAS2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3571	40.282	2	1632.7609	1632.7609	K	C	172	185
PSM	QTQTFTTYSDNQPGVLIQVYEGER	294	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=4802	50.732	3	2887.349	2887.3490	K	A	424	448
PSM	QTQTFTTYSDNQPGVLIQVYEGER	295	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=5125	53.721	3	2967.3153	2967.3153	K	A	424	448
PSM	RLEAAYLDLQR	296	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3155	37.099	2	1460.7601	1460.7601	R	I	70	81
PSM	SDYLNTFEFMDK	297	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5414	56.794	2	1656.7419	1656.7419	R	L	389	401
PSM	SLYDEVAAQGEVVR	298	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3840	42.358	2	1648.7922	1648.7922	K	K	825	839
PSM	SPDTNYLFMGDYVDR	299	sp|P67775-2|PP2AA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4514	47.898	2	1921.8018	1921.8018	K	G	75	90
PSM	TYADYESVNECMEGVCK	300	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:4,12-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=2461	31.803	3	2217.8942	2217.8942	R	M	18	35
PSM	TYSYLTPDLWK	301	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=5288	55.456	2	1533.7793	1533.7793	K	E	247	258
PSM	VYENVGLMQQQK	302	sp|Q06124|PTN11_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2693	33.591	2	1583.8055	1583.8055	R	S	579	591
PSM	YAVLYQPLFDK	303	sp|P55209-3|NP1L1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=5127	53.739	2	1583.7714	1583.7714	K	E	65	76
PSM	YDYNSGEELESYK	304	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3012	36.02	2	1743.7553	1743.7553	K	G	250	263
PSM	YISPDQLADLYK	305	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=4834	50.993285	2	1652.7849	1652.7771	R	S	270	282
PSM	DYEEVGVDSVEGEGEEEGEEY	306	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4981	52.31791166666667	3	2461.9392	2461.9262	K	-	431	452
PSM	DYETATLSEIK	307	sp|P12814|ACTN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,2-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=3521	39.899948333333334	2	1416.7129	1416.7057	K	A	421	432
PSM	RLAPEYEAAATR	308	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=1367	23.539748333333335	2	1460.730772	1460.723711	K	L	62	74
PSM	SPDTNYLFMGDYVDR	309	sp|P67775|PP2AA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=5184	54.36573666666667	2	1905.8157	1905.8063	K	G	75	90
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	310	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=2511	32.175536666666666	3	2302.9372	2302.9272	R	S	326	351
PSM	TYADYESVNECMEGVCK	311	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:510	ms_run[1]:scan=3540	40.046445	3	2201.9092	2201.8992	R	M	18	35
PSM	TYADYESVNECMEGVCK	312	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:4,12-UNIMOD:35,16-UNIMOD:4,17-UNIMOD:510	ms_run[1]:scan=2461	31.803348333333332	3	2217.9032	2217.8932	R	M	18	35
PSM	DGLLYVYASNEESR	313	sp|P51813|BMX_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=4555	48.25409333333334	2	1808.7571	1808.7478	K	S	86	100
PSM	NVDGVNYASITR	314	sp|Q9UBR2|CATZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=2567	32.601443333333336	2	1421.6831	1421.6759	R	N	70	82
PSM	EYVDPNNIFGNR	315	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4396	46.91869	2	1550.7052	1550.6974	K	N	644	656
PSM	SSGPYGGGGQYFAK	316	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2173	29.625178333333334	2	1602.686860	1602.679326	R	P	285	299
PSM	ITPSYVAFTPEGER	317	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3682	41.132525	2	1679.810120	1679.802021	R	L	61	75
PSM	LFQQIYSDGSDEVK	318	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=3199	37.43438333333333	2	1775.874144	1775.865532	R	R	312	326
PSM	FNALFAQGNYSEAAK	319	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3892	42.76287	2	1777.879701	1777.871286	K	V	368	383
PSM	WVVIGDENYGEGSSR	320	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[1]:scan=3871	42.600143333333335	2	1780.796660	1780.788162	R	E	657	672
PSM	GRRAEDGSVIDYELIDQDAR	321	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=3329	38.42334666666667	3	2391.139385	2391.128000	K	D	177	197
PSM	AAFDDAIAELDTLSEESYK	322	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,18-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=6173	67.978	3	2235.0508	2235.0508	K	D	175	194
PSM	AALEYLEDIDLK	323	sp|Q9BRX8-2|PXL2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5381	56.437	2	1539.811	1539.8110	K	T	33	45
PSM	ASGNYATVISHNPETK	324	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1610	25.379	2	1835.9091	1835.9091	R	K	129	145
PSM	DLNYCFSGMSDHR	325	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=3412	39.06	2	1714.6693	1714.6693	R	Y	263	276
PSM	DLTLDQAYSYAVENAK	326	sp|P23381-2|SYWC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4854	51.15	2	1947.9503	1947.9503	K	D	164	180
PSM	DMSGHYQNALYLGDVSER	327	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4310	46.157	3	2247.9121	2247.9121	K	V	728	746
PSM	DVIELTDDSFDK	328	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=4563	48.351	2	1463.7668	1463.7668	K	N	158	170
PSM	EAGSQKDENLALYVENQFR	329	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4852	51.136	3	2358.1529	2358.1529	R	E	156	175
PSM	EILVGDVGQTVDDPYATFVK	330	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,17-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5215	54.695	3	2313.1818	2313.1818	K	M	54	74
PSM	ELISNASDALDK	331	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2738	33.939	2	1342.7616	1342.7616	R	I	42	54
PSM	EQVANSAFVER	332	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1762	26.54	2	1282.673	1282.6730	K	V	492	503
PSM	ERPTPSLNNNCTTSEDSLVLYNR	333	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=3212	37.533	3	2793.2853	2793.2853	K	V	734	757
PSM	ESEDKPEIEDVGSDEEEEK	334	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=2027	28.532	3	2294.1022	2294.1022	K	K	251	270
PSM	EYYEALPELK	335	sp|P06737-2|PYGL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4351	46.512	2	1481.6769	1481.6769	K	L	697	707
PSM	FYEQMNGPVAGASR	336	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=1741	26.383	2	1655.7227	1655.7227	R	Q	25	39
PSM	GFCYVEFDEVDSLK	337	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:4,4-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=5315	55.722	2	1854.8424	1854.8424	K	E	83	97
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	338	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2165	29.559	3	2826.1852	2826.1852	R	E	418	442
PSM	GPSYGLSAEVK	339	sp|Q99439-2|CNN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2010	28.409	2	1254.6534	1254.6534	K	N	9	20
PSM	GQLCELSCSTDYR	340	sp|Q99873-2|ANM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:4,8-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=2535	32.357	2	1701.6952	1701.6952	K	M	333	346
PSM	GVAVDYLPER	341	sp|P13674-3|P4HA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3049	36.298	2	1231.6062	1231.6062	K	Q	277	287
PSM	GYFEYIEENK	342	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3908	42.888	2	1438.6694	1438.6694	R	Y	237	247
PSM	ICDECNYGSYQGR	343	sp|Q7RTV0|PHF5A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:4,5-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=1510	24.637	2	1734.6591	1734.6591	R	C	45	58
PSM	KDDEENYLDLFSHK	344	sp|Q07666-3|KHDR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3754	41.687	3	1933.9559	1933.9559	K	N	139	153
PSM	LDYDEDASAMLK	345	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3695	41.236	2	1517.6997	1517.6997	K	E	211	223
PSM	LEPQIASASEYAHR	346	sp|O60664-4|PLIN3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2162	29.537	3	1684.8034	1684.8034	K	G	85	99
PSM	NESCSENYTTDFIYQLYSEEGK	347	sp|Q01813-2|PFKAP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:4,22-UNIMOD:510	ms_run[2]:scan=5864	62.973	3	2824.2099	2824.2099	R	G	630	652
PSM	NFFTRYDYEEVEAEGANK	348	sp|P36871-2|PGM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4025	43.82	3	2329.0576	2329.0576	R	M	441	459
PSM	NFYQEHPDLAR	349	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2043	28.653	2	1502.6768	1502.6768	K	R	57	68
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	350	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:35,6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=1780	26.67	3	2398.8888	2398.8888	R	S	314	339
PSM	NPQREEIIGNGEQQYVYLK	351	sp|Q53H82|LACB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,15-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3219	37.59	3	2425.2315	2425.2315	R	D	107	126
PSM	NSLESYAFNMK	352	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=3068	36.441	2	1466.6789	1466.6789	K	A	540	551
PSM	NSLESYAFNMK	353	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4020	43.781	2	1450.684	1450.6840	K	A	540	551
PSM	QQLSAEELDAQLDAYNAR	354	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=4143	44.769	3	2147.9949	2147.9949	K	M	236	254
PSM	QVLLSEPEEAAALYR	355	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=4322	46.272	2	1801.9075	1801.9075	R	G	4	19
PSM	RNEGVVGGEDYEEVDR	356	sp|Q86UK7-2|ZN598_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1667	25.827	3	1935.8424	1935.8424	R	Y	296	312
PSM	RTGYESGEYEMLGEGLGVK	357	sp|Q13561|DCTN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3214	37.551	3	2238.0552	2238.0552	K	E	78	97
PSM	SYDVPPPPMEPDHPFYSNISK	358	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,17-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=4266	45.8	3	2644.1634	2644.1634	R	D	118	139
PSM	SYEPLEDPGVK	359	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2441	31.655	2	1380.685	1380.6850	K	S	205	216
PSM	TAFDEAIAELDTLNEESYK	360	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,18-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=5910	63.587	3	2306.0879	2306.0879	K	D	194	213
PSM	TNQELQEINR	361	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1458	24.242	2	1277.6788	1277.6788	R	V	154	164
PSM	TPSSDVLVFDYTK	362	sp|Q09028-4|RBBP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4205	45.312	2	1618.8168	1618.8168	K	H	109	122
PSM	TYTAYVDLEK	363	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3261	37.913	2	1429.6456	1429.6456	K	D	288	298
PSM	VNPVTSLSENYTCSDSEESSEK	364	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:4,22-UNIMOD:510	ms_run[2]:scan=3154	37.091	3	2609.1364	2609.1364	R	D	395	417
PSM	YAALSDQGLDIK	365	sp|Q8WX93-7|PALLD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3587	40.404	2	1440.7538	1440.7538	R	A	350	362
PSM	YHTSQSGDEMTSLSEYVSR	366	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3290	38.129	3	2289.9673	2289.9673	R	M	457	476
PSM	YLEVSEPQDIECCGALEYYDK	367	sp|O15371-2|EIF3D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:4,13-UNIMOD:4,18-UNIMOD:21,19-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=5009	52.543	3	2808.1625	2808.1625	R	A	135	156
PSM	YQAVTATLEEK	368	sp|Q6NVV1|R13P3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2184	29.71	2	1399.7272	1399.7272	K	R	63	74
PSM	YISPDQLADLYK	369	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=4874	51.30967666666667	2	1652.7849	1652.7771	R	S	270	282
PSM	SLYQSAGVAPESFEYIEAHGTGTK	370	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,15-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=4756	50.276223333333334	3	2769.2742	2769.2612	R	V	275	299
PSM	DYEEVGVDSVEGEGEEEGEEY	371	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=5095	53.43075833333334	3	2462.9432	2461.9262	K	-	431	452
PSM	TTPSYVAFTDTER	372	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3094	36.63489666666667	2	1600.7301	1600.7229	R	L	37	50
PSM	ISVYYNEATGGK	373	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2611	32.957705	2	1528.696490	1528.688828	R	Y	47	59
PSM	VLTPELYAELR	374	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=4511	47.87891666666667	2	1416.7542	1416.7473	K	A	33	44
PSM	GYDVIAQAQSGTGK	375	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2346	30.936185	2	1541.7834	1541.7758	K	T	69	83
PSM	DSFDDRGPSLNPVLDYDHGSR	376	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=3741	41.58617	3	2475.104066	2475.091614	R	S	187	208
PSM	NESCSENYTTDFIYQLYSEEGK	377	sp|Q01813|PFKAP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,4-UNIMOD:4,5-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=5864	62.97295166666666	3	2824.2232	2824.2092	R	G	638	660
PSM	GSFKDDPQLYQEIQER	378	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,4-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=3238	37.73771666666667	3	2100.0302	2100.0192	K	G	207	223
PSM	YESSSYTDQFSR	379	sp|Q07157|ZO1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=2108	29.13126333333333	2	1582.647666	1582.640101	R	N	1061	1073
PSM	EVYELLDSPGK	380	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=3393	38.91359833333333	2	1396.7226	1396.7158	K	V	20	31
PSM	QAQEYEALLNIK	381	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=4138	44.726456666666664	2	1566.8404	1566.8326	R	V	359	371
PSM	SPASDTYIVFGEAK	382	sp|E9PAV3|NACAM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=4056	44.06231	2	1631.820095	1631.812040	K	I	1977	1991
PSM	GPSYGLSAEVK	383	sp|Q99439|CNN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2010	28.40938833333333	2	1254.6588	1254.6528	K	N	9	20
PSM	ELAPYDENWFYTR	384	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[1]:scan=5352	56.106423333333325	2	1816.801290	1816.792185	K	A	44	57
PSM	YISPDQLADLYK	385	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=4874	51.30967666666667	2	1652.785418	1652.777643	R	S	270	282
PSM	SYDVPPPPMEPDHPFYSNISK	386	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,17-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=4266	45.800081666666664	3	2644.175284	2644.163445	R	D	118	139
PSM	AFALNDLDDYEK	387	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4461	47.459	2	1560.7385	1560.7385	R	H	499	511
PSM	AGFAGDDAPR	388	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1178	22.028	2	1009.5041	1009.5041	K	A	19	29
PSM	APQETYADIGGLDNQIQEIK	389	sp|P62191-2|PRS4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4648	49.147	3	2350.173	2350.1730	K	E	106	126
PSM	CLTTDEYDGHSTYPSHQYQ	390	sp|P30043|BLVRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=2235	30.092	3	2414.9575	2414.9575	R	-	188	207
PSM	CSVLAAANPVYGR	391	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=3395	38.928	2	1490.7165	1490.7165	R	Y	446	459
PSM	FYCDYCDTYLTHDSPSVR	392	sp|P09234|RU1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:4,5-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=3405	39.007	3	2411.9652	2411.9652	K	K	4	22
PSM	GAMAATYSALNR	393	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=1316	23.147	2	1354.6165	1354.6165	K	N	701	713
PSM	GFYIYQEGVK	394	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4209	45.344	2	1430.6561	1430.6561	K	R	635	645
PSM	HGEIDYEAIVK	395	sp|P62333|PRS10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2688	33.555	2	1420.7276	1420.7276	K	L	323	334
PSM	HYGGLTGLNK	396	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1420	23.95	2	1206.6435	1206.6435	R	A	91	101
PSM	ISVYYNEATGGK	397	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2755	34.066	2	1448.7225	1448.7225	R	Y	47	59
PSM	KEESEESDDDMGFGLFD	398	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=5220	54.737	2	2016.8783	2016.8783	K	-	73	90
PSM	MAPYQGPDAVPGALDYK	399	sp|O43707-2|ACTN4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,16-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4041	43.943	2	2019.9091	2019.9091	R	S	664	681
PSM	MREDYDSVEQDGDEPGPQR	400	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=1472	24.349	3	2351.9426	2351.9426	R	S	49	68
PSM	NEQDAYAINSYTR	401	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2509	32.161	2	1657.7197	1657.7197	R	S	209	222
PSM	NLDIERPTYTNLNR	402	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2860	34.87	2	1831.9042	1831.9042	R	L	181	195
PSM	NPDDITQEEYGEFYK	403	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3939	43.134	2	1914.916	1914.9160	R	S	292	307
PSM	QEYDESGPSIVHR	404	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1590	25.233	3	1549.7585	1549.7585	K	K	360	373
PSM	QLAVYEEFAR	405	sp|A5YKK6-3|CNOT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3726	41.473	2	1338.6433	1338.6433	K	N	1563	1573
PSM	QVVESAYEVIK	406	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3067	36.434	2	1411.7636	1411.7636	K	L	175	186
PSM	RTIAQDYGVLK	407	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2063	28.801	2	1410.7908	1410.7909	K	A	110	121
PSM	SLYQSAGVAPESFEYIEAHGTGTK	408	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=4756	50.276	3	2769.2612	2769.2612	R	V	275	299
PSM	TDMDNQIVVSDYAQMDR	409	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=3262	37.92	3	2129.8859	2129.8859	K	V	228	245
PSM	TDYNASVSVPDSSGPER	410	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2383	31.212	2	1813.8543	1813.8543	R	I	70	87
PSM	TPSQDSDYINANFIK	411	sp|Q05209|PTN12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3860	42.514	2	1859.8979	1859.8979	K	G	81	96
PSM	TYADYESVNECMEGVCK	412	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,11-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=3540	40.046	3	2201.8993	2201.8993	R	M	18	35
PSM	VFPGSTTEDYNLIVIER	413	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=5122	53.695	2	2066.0186	2066.0186	K	G	508	525
PSM	VRIDEYDYSK	414	sp|P31040-3|SDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2026	28.525	2	1434.7068	1434.7068	K	P	454	464
PSM	WVVIGDENYGEGSSR	415	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3871	42.6	2	1780.7882	1780.7882	R	E	657	672
PSM	YAAVTQFEATDAR	416	sp|A6NEC2|PSAL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=2725	33.837	2	1555.7132	1555.7132	R	R	173	186
PSM	YALYDATYETK	417	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:21,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3137	36.963	2	1564.6776	1564.6776	R	E	82	93
PSM	YEGSGEDGGAAAQSLYIANHAY	418	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=4361	46.611	3	2357.0062	2357.0062	K	-	343	365
PSM	YFQINQDEEEEEDED	419	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3879	42.661	2	2044.7523	2044.7523	R	-	114	129
PSM	YYDVMSDEEIER	420	sp|O15460-2|P4HA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=2336	30.858	2	1677.6694	1677.6694	R	I	341	353
PSM	GRRAEDGSVIDYELIDQDAR	421	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[1]:scan=3329	38.42334666666667	3	2391.1382	2391.1272	K	D	177	197
PSM	GIVDQSQQAYQEAFEISK	422	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=4172	45.006346666666666	3	2188.0832	2188.0722	K	K	140	158
PSM	DNLTLWTSDSAGEECDAAEGAEN	423	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[1]:scan=5086	53.340781666666665	3	2488.0512	2488.0392	R	-	223	246
PSM	GNDISSGTVLSDYVGSGPPK	424	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=3884	42.69877	3	2097.0402	2097.0302	K	G	94	114
PSM	HGSYEDAVHSGALND	425	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1602	25.317973333333335	2	1684.702202	1684.694262	K	-	542	557
PSM	GGSDDSSKDPIDVNYEK	426	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,8-UNIMOD:510,15-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=1887	27.481616666666667	3	2006.966775	2006.957049	R	L	780	797
PSM	DYIALNEDLR	427	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4036	43.90418333333333	2	1334.639709	1334.633165	K	S	146	156
PSM	NAVITVPAYFNDSQR	428	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=4214	45.38386499999999	2	1807.881022	1807.871832	K	Q	188	203
PSM	NKDQGTYEDYVEGLR	429	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,2-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=2982	35.79828	3	1933.918962	1933.909522	K	V	80	95
PSM	AFYVNVLNEEQR	430	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4472	47.547	2	1594.7605	1594.7605	R	K	445	457
PSM	ARQEELYSELQAR	431	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2316	30.706	2	1705.8249	1705.8249	R	E	3187	3200
PSM	ASYAVSETIPK	432	sp|Q9NQW7-2|XPP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2180	29.678	2	1312.6952	1312.6952	K	D	294	305
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	433	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=3441	39.285	4	3527.556	3527.5560	K	L	104	135
PSM	DFPEYTFAIADEEDYAGEVK	434	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5950	64.194	3	2536.0648	2536.0648	K	D	444	464
PSM	DNEQALYELVK	435	sp|Q8N108-19|MIER1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4936	51.896	2	1468.7487	1468.7487	K	C	189	200
PSM	DQGTYEDYVEGLR	436	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=4290	45.991	2	1577.7422	1577.7422	K	V	82	95
PSM	DSLYVDGDCTMDIR	437	sp|P35080-2|PROF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=4187	45.129	2	1772.7211	1772.7211	R	T	76	90
PSM	DSSTSPGDYVLSVSENSR	438	sp|P46108-2|CRK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4615	48.88	2	2012.8788	2012.8788	R	V	39	57
PSM	DSYVGDEAQSK	439	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1038	20.858	2	1345.6075	1345.6075	K	R	51	62
PSM	DYDWINAER	440	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3938	43.127	2	1294.5443	1294.5443	K	H	937	946
PSM	DYEEIGPSICR	441	sp|P61158|ARP3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=3147	37.035	2	1451.6216	1451.6216	K	H	399	410
PSM	DYLLCDYNR	442	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=3883	42.692	2	1344.5634	1344.5634	K	D	58	67
PSM	EDIYAVEIVGGATR	443	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4564	48.358	2	1605.7864	1605.7864	K	I	333	347
PSM	ELPVNAQNYVR	444	sp|P30520|PURA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3099	36.674	2	1415.7022	1415.7022	K	F	420	431
PSM	ESFNPESYELDK	445	sp|P49903-2|SPS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3532	39.982	2	1604.7284	1604.7284	R	S	5	17
PSM	ESYSVYVYK	446	sp|Q99880|H2B1L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2941	35.485	2	1284.6316	1284.6316	K	V	36	45
PSM	EVGVYEALK	447	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2690	33.569	2	1154.6261	1154.6261	K	D	117	126
PSM	FYEQMNGPVAGASR	448	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2578	32.684	2	1639.7278	1639.7278	R	Q	25	39
PSM	GYGFIEYEK	449	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3700	41.276	2	1332.5717	1332.5717	K	A	208	217
PSM	GYSFTTTAER	450	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=1792	26.763	2	1245.5491	1245.5491	R	E	197	207
PSM	GYTSDSEVYTDHGRPGK	451	sp|Q92538-3|GBF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1083	21.244	3	2015.9262	2015.9262	R	I	1315	1332
PSM	HFSGLEEAVYR	452	sp|P50990-2|TCPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2836	34.683	2	1420.66	1420.6600	M	N	2	13
PSM	HIYYITGETK	453	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2073	28.874	2	1451.6775	1451.6775	K	D	490	500
PSM	HKLDVTSVEDYK	454	sp|P48643-2|TCPE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2098	29.057	2	1614.8755	1614.8755	K	A	171	183
PSM	HYEDGYPGGSDNYGSLSR	455	sp|O60716|CTND1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2065	28.814	3	2086.8482	2086.8482	R	V	216	234
PSM	INVYYNEATGGK	456	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2473	31.891	2	1475.7334	1475.7334	R	Y	47	59
PSM	IVPEWQDYDQEIK	457	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4368	46.673	2	1809.8863	1809.8863	R	Q	1485	1498
PSM	KNSVVEASEAAYK	458	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1142	21.737	2	1576.8598	1576.8598	K	E	143	156
PSM	LAEQAERYDDMAAAMK	459	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2694	33.599	2	1959.9108	1959.9108	K	A	12	28
PSM	LAEQAERYEDMAAFMK	460	sp|P31947-2|1433S_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:510	ms_run[2]:scan=3131	36.918	3	2065.9526	2065.9526	K	G	12	28
PSM	MEVDYSATVDQR	461	sp|O00232-2|PSD12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2335	30.851	2	1526.6536	1526.6536	K	L	16	28
PSM	NNDGYIDYAEFAK	462	sp|Q8NI22-2|MCFD2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4033	43.88	2	1666.7553	1666.7553	K	S	79	92
PSM	NPSGINDDYGQLK	463	sp|O60934|NBN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2136	29.334	2	1567.7556	1567.7556	R	N	671	684
PSM	NTGTEAPDYLATVDVDPK	464	sp|Q13228-4|SBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3832	42.297	2	2052.9929	2052.9929	R	S	77	95
PSM	QENCGAQQVPAGPGTSTPPSSPVR	465	sp|Q96G46-2|DUS3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=2347	30.943	3	2535.1637	2535.1637	R	T	257	281
PSM	SCYEDGWLIK	466	sp|P23434|GCSH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:4,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4331	46.348	2	1417.6625	1417.6625	K	M	137	147
PSM	SEDYVELVQR	467	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3024	36.11	2	1350.6281	1350.6281	R	K	441	451
PSM	SNVSDAVAQSTR	468	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1374	23.593	2	1267.6581	1267.6581	K	I	232	244
PSM	SSAYESLMEIVK	469	sp|Q14974-2|IMB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5154	54.055	2	1503.7568	1503.7568	R	N	381	393
PSM	STAGDTHLGGEDFDNR	470	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1697	26.051	3	1724.7814	1724.7814	K	M	221	237
PSM	SYELPDGQVITIGNER	471	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4347	46.479	2	1903.9141	1903.9141	K	F	239	255
PSM	TDIQIALPSGCYGR	472	sp|P33316-2|DUT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=4268	45.815	2	1663.7853	1663.7853	K	V	68	82
PSM	THSVNGITEEADPTIYSGK	473	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,16-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2420	31.497	3	2166.0518	2166.0518	K	V	551	570
PSM	TIAQDYGVLK	474	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2628	33.091	2	1254.6897	1254.6897	R	A	111	121
PSM	TYLEEELDK	475	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=2935	35.439	2	1206.6656	1206.6656	K	W	85	94
PSM	VDCTQHYELCSGNQVR	476	sp|Q8NBS9-2|TXND5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:4,7-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=1662	25.787	3	2078.8763	2078.8763	K	G	137	153
PSM	VDQALHTQTDADPAEEYAR	477	sp|P52888-2|THOP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=1857	27.253	3	2242.9956	2242.9956	K	L	71	90
PSM	VLCGGDIYVPEDPK	478	sp|P49189-2|AL9A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:4,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3567	40.25	2	1708.842	1708.8420	K	L	283	297
PSM	VLQAQGSSDPEEESVLYSNR	479	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=3151	37.066	3	2321.0637	2321.0637	R	A	38	58
PSM	VPDSTYEMIGGLDK	480	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:35,14-UNIMOD:510	ms_run[2]:scan=2967	35.681	2	1687.8052	1687.8052	K	Q	135	149
PSM	WQPDTEEEYEDSSGNVVNKK	481	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21,19-UNIMOD:510,20-UNIMOD:510	ms_run[2]:scan=2551	32.479	3	2535.1903	2535.1903	R	T	471	491
PSM	YALYDATYETK	482	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2942	35.492	2	1484.7113	1484.7113	R	E	82	93
PSM	YIDQEELNK	483	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=1551	24.941	2	1218.6769	1218.6769	K	T	284	293
PSM	YIDQEELNK	484	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=1849	27.199	2	1298.6432	1298.6432	K	T	284	293
PSM	YRCELLYEGPPDDEAAMGIK	485	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:4,7-UNIMOD:21,17-UNIMOD:35,20-UNIMOD:510	ms_run[2]:scan=4031	43.865	3	2490.1484	2490.1484	K	S	367	387
PSM	YYEDLDEVSSTSSVSQSLESEDAR	486	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4394	46.9	3	2809.1915	2809.1915	R	T	966	990
PSM	NPDDITQEEYGEFYK	487	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3854	42.466586666666664	2	2074.8575	2074.8481	R	S	292	307
PSM	SIYYITGESK	488	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=3069	36.44828833333333	2	1307.675137	1307.668670	K	E	258	268
PSM	DYPVVSIEDPFDQDDWGAWQK	489	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,2-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=6414	72.72279833333333	3	2657.2132	2657.1992	K	F	286	307
PSM	AEDGSVIDYELIDQDAR	490	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=4662	49.25673833333333	3	2021.9138	2021.9038	R	D	180	197
PSM	QEYDESGPSIVHR	491	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1506	24.608093333333333	3	1629.7319	1629.7243	K	K	360	373
PSM	QTIDNSQGAYQEAFDISK	492	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=3603	40.53052666666667	3	2162.0312	2162.0202	K	K	140	158
PSM	ITPSYVAFTPEGER	493	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=3682	41.132525	2	1679.8096	1679.8015	R	L	61	75
PSM	NKDQGTYEDYVEGLR	494	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,2-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=2982	35.79828	3	1933.9184	1933.9090	K	V	80	95
PSM	VTVVCEPEDYVVVSTEMQSSESK	495	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:4,23-UNIMOD:510	ms_run[1]:scan=4604	48.776804999999996	3	2749.2872	2749.2742	R	D	142	165
PSM	DNLTLWTSDQQDDDGGEGNN	496	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510	ms_run[1]:scan=4871	51.286184999999996	3	2226.9462	2226.9352	R	-	228	248
PSM	DFPEYTFAIADEEDYAGEVK	497	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=5950	64.19420833333334	3	2536.0772	2536.0642	K	D	444	464
PSM	QLEPVYNSLAK	498	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2859	34.862655	2	1408.7701	1408.7634	K	K	560	571
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	499	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=4694	49.56843333333333	4	3570.4892	3570.4712	R	-	207	238
PSM	EGICALGGTSELSSEGTQHSYSEEEK	500	sp|P13797|PLST_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,4-UNIMOD:4,22-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=3146	37.027456666666666	3	2932.3092	2932.2952	K	Y	101	127
PSM	SIYGERFPDENFK	501	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=3313	38.29788666666666	2	1748.8529	1748.8442	K	L	117	130
PSM	TYSYLTPDLWK	502	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=5288	55.455769999999994	2	1533.787938	1533.779283	K	E	247	258
PSM	THSVNGITEEADPTIYSGK	503	sp|O75534|CSDE1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,17-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=2420	31.496511666666663	3	2166.063313	2166.051830	K	V	582	601
PSM	DFPEYTFAIADEEDYAGEVK	504	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=5955	64.27133833333333	2	2536.075731	2536.064836	K	D	444	464
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	505	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=4244	45.619114999999994	4	3586.484036	3586.466697	R	-	207	238
PSM	ALDADIYSAIPTEK	506	sp|Q8N999-3|CL029_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4338	46.406	2	1653.8539	1653.8539	K	V	20	34
PSM	ALELDPDNETYK	507	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3071	36.462	2	1554.7491	1554.7491	K	S	185	197
PSM	DLNYCFSGMSDHR	508	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=2478	31.928	3	1730.6642	1730.6642	R	Y	263	276
PSM	DNLTLWTSDQQDDDGGEGNN	509	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4992	52.406	3	2226.9361	2226.9361	R	-	228	248
PSM	DSFDDRGPSLNPVLDYDHGSR	510	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3745	41.617	4	2475.0916	2475.0916	R	S	187	208
PSM	DSGSDEDFLMEDDDDSDYGSSK	511	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,18-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4690	49.536	3	2575.9582	2575.9582	K	K	89	111
PSM	DSGYIDCWDSER	512	sp|Q9UPQ0-7|LIMC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=3755	41.694	2	1615.6074	1615.6074	R	S	17	29
PSM	DSYLILETLPTEYDSR	513	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=5831	62.453	2	2027.9553	2027.9553	K	V	156	172
PSM	DVNQQEFVR	514	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2085	28.963	2	1167.6097	1167.6097	K	A	8	17
PSM	EDMAALEKDYEEVGADSADGEDEGEEY	515	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=4581	48.556	3	3113.238	3113.2380	R	-	423	450
PSM	EGALCEENMR	516	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:4	ms_run[2]:scan=1381	23.652	2	1241.5593	1241.5593	K	G	689	699
PSM	EGYSGVGLLSR	517	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3169	37.202	2	1250.612	1250.6120	K	Q	126	137
PSM	ELQQELQEYEVVTESEK	518	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4082	44.262	3	2228.0774	2228.0774	K	R	319	336
PSM	ENRESLVVNYEDLAAR	519	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3320	38.355	3	1990.9574	1990.9574	K	E	225	241
PSM	EYAQNIWNVEPSDLK	520	sp|P06737-2|PYGL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4923	51.759	2	1952.9557	1952.9557	K	I	786	801
PSM	GASQAGMTGYGMPR	521	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=1987	28.226	2	1496.6366	1496.6366	R	Q	204	218
PSM	GATQQILDEAER	522	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2428	31.558	2	1363.7156	1363.7156	R	S	330	342
PSM	GIYAYGFEK	523	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3615	40.624	2	1194.5999	1194.5999	R	P	52	61
PSM	GLGTGTLYIAESR	524	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3764	41.766	2	1450.7281	1450.7281	K	L	31	44
PSM	GNFNYIEFTR	525	sp|P19105|ML12A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4152	44.844	2	1373.6229	1373.6229	K	I	151	161
PSM	GYGFIEYEK	526	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3616	40.631	2	1252.6053	1252.6053	K	A	208	217
PSM	HELQANCYEEVK	527	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1389	23.713	3	1586.8035	1586.8035	K	D	133	145
PSM	HIMGQNVADYMR	528	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2904	35.197	2	1547.6838	1547.6838	K	Y	198	210
PSM	HLVYESDQNK	529	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=876	19.109	2	1379.6759	1379.6759	R	D	272	282
PSM	ILYSQCGDVMR	530	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=2440	31.648	2	1454.6511	1454.6511	K	A	27	38
PSM	INVYYNEATGGKYVPR	531	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:21,12-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3220	37.598	3	2150.9517	2150.9517	R	A	47	63
PSM	LFMAQALQEYNN	532	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=3785	41.927	2	1570.6951	1570.6951	K	-	341	353
PSM	LLKPGEEPSEYTDEEDTK	533	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:510,11-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=1999	28.324	3	2261.1089	2261.1089	R	D	200	218
PSM	LYTDFDEIRQEIENETER	534	sp|O00429-4|DNM1L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=5764	61.56	3	2413.0899	2413.0899	K	I	100	118
PSM	MREDYDSVEQDGDEPGPQR	535	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1750	26.451	3	2335.9477	2335.9477	R	S	49	68
PSM	NALESYAFNMK	536	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3957	43.281	2	1434.6891	1434.6891	K	S	485	496
PSM	NDQDTWDYTNPNLSGQGDPGSNPNK	537	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3385	38.851	3	2881.2465	2881.2465	K	R	278	303
PSM	NFSDNQLQEGK	538	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1765	26.561	2	1346.7103	1346.7103	R	N	182	193
PSM	NKDQGTYEDYVEGLR	539	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=2806	34.455	3	2013.8759	2013.8759	K	V	80	95
PSM	QGVEYVPACLVHR	540	sp|Q15527|SURF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3051	36.313	2	1640.7958	1640.7958	K	R	119	132
PSM	SDSYVELSQYR	541	sp|P52298-3|NCBP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2985	35.819	2	1459.6445	1459.6445	R	D	11	22
PSM	SEDYVDIVQGR	542	sp|Q02809|PLOD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3089	36.598	2	1393.6339	1393.6339	R	R	431	442
PSM	SIYGERFPDENFK	543	sp|P23284|PPIB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3313	38.298	2	1748.8447	1748.8447	K	L	117	130
PSM	SIYYITGESK	544	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2729	33.869	2	1227.7023	1227.7023	K	E	482	492
PSM	SLYHDISGDTSGDYRK	545	sp|P50995-2|ANX11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2099	29.065	3	2040.8868	2040.8868	K	I	447	463
PSM	STIGVDGSVYK	546	sp|P52789|HXK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2111	29.153	2	1272.6639	1272.6639	R	K	408	419
PSM	STTTGHLIYK	547	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1192	22.137	2	1267.685	1267.6850	K	C	21	31
PSM	TAFDEAIAELDTLNEDSYK	548	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,18-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=5913	63.631	3	2292.0723	2292.0723	K	D	194	213
PSM	TDNAGDQHGGGGGGGGGAGAAGGGGGGENYDDPHK	549	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,30-UNIMOD:21,35-UNIMOD:510	ms_run[2]:scan=812	18.175	4	3128.2878	3128.2878	K	T	63	98
PSM	TTYDSSLSSYTVPLEK	550	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4242	45.602	2	1937.9547	1937.9547	K	D	268	284
PSM	TYLEEELDK	551	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3304	38.231	2	1286.6319	1286.6319	K	W	85	94
PSM	VCMVYDLYK	552	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:4,5-UNIMOD:21,8-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=4206	45.32	2	1417.61	1417.6100	K	T	285	294
PSM	VEVTEFEDIK	553	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3687	41.172	2	1275.7235	1275.7235	R	S	98	108
PSM	VIGSGCNLDSAR	554	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1421	23.957	2	1281.656	1281.6560	R	F	100	112
PSM	VPDSTYEMIGGLDK	555	sp|P62195-2|PRS8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4173	45.014	2	1671.8103	1671.8103	K	Q	135	149
PSM	VQHASPAGTYAHTVNR	556	sp|P09923|PPBI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=829	18.463	3	1821.8736	1821.8736	R	N	170	186
PSM	VTVVCEPEDYVVVSTEMQSSESK	557	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:4,10-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=4604	48.777	3	2749.2752	2749.2752	R	D	141	164
PSM	WAEEYLEQSEEK	558	sp|P50542-2|PEX5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3287	38.105	2	1687.7655	1687.7655	R	L	159	171
PSM	YAALYQPLFDK	559	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4835	51.001	2	1555.7401	1555.7401	K	R	95	106
PSM	YEQGTGCWQGPNR	560	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=1889	27.496	2	1665.6819	1665.6819	K	S	462	475
PSM	YESSSYTDQFSR	561	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2108	29.131	2	1582.6401	1582.6401	R	N	981	993
PSM	YITQNGDYQLR	562	sp|Q9BXS5|AP1M1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2042	28.646	2	1483.6921	1483.6921	R	T	411	422
PSM	YLDEDTIYHLQPSGR	563	sp|P31153-2|METK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=3907	42.88	3	1999.8542	1999.8542	K	F	172	187
PSM	YLGQDYEQLR	564	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2594	32.809	2	1397.6441	1397.6441	K	V	37	47
PSM	YMACCLLYR	565	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,4-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=3708	41.335	2	1362.5748	1362.5748	K	G	277	286
PSM	SIYYITGESK	566	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=3148	37.04213166666666	2	1387.6412	1387.6345	K	E	482	492
PSM	INVYYNEATGGK	567	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2710	33.71968	2	1475.7401	1475.7329	R	Y	47	59
PSM	YALYDATYETK	568	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=3253	37.853118333333335	2	1484.7180	1484.7107	R	E	82	93
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	569	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=4244	45.619114999999994	4	3586.4832	3586.4662	R	-	207	238
PSM	ERYSYVCPDLVK	570	sp|P61158|ARP3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:510	ms_run[1]:scan=2934	35.43186666666667	3	1755.8060	1755.7975	K	E	229	241
PSM	MREDYDSVEQDGDEPGPQR	571	sp|Q9Y5S9|RBM8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=1750	26.451186666666665	3	2335.958690	2335.947652	R	S	50	69
PSM	GEPNVSYICSR	572	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=2385	31.230053333333334	2	1394.6176	1394.6109	R	Y	273	284
PSM	IGEGTYGVVYK	573	sp|P06493|CDK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2581	32.70767	2	1332.7067	1332.6998	K	G	10	21
PSM	SYEPLEDPGVK	574	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2441	31.654981666666664	2	1380.692150	1380.685049	K	S	205	216
PSM	SDSYVELSQYR	575	sp|P52298|NCBP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2985	35.81946166666666	2	1459.651770	1459.644458	R	D	11	22
PSM	VPDSTYEMIGGLDK	576	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=4173	45.01409833333334	2	1671.814505	1671.810325	K	Q	143	157
PSM	AAVPSGASTGIYEALELRDNDK	577	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4432	47.213	3	2424.221	2424.2210	R	T	33	55
PSM	AKHDELTYF	578	sp|P04080|CYTB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2751	34.035	2	1270.6271	1270.6271	K	-	90	99
PSM	AMEVDERPTEQYSDIGGLDK	579	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:35,13-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2629	33.098	3	2416.1142	2416.1142	K	Q	174	194
PSM	ASCLYGQLPK	580	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:4,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2546	32.44	2	1283.6621	1283.6621	K	F	46	56
PSM	ASGNYATVISHNPETK	581	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1601	25.312	3	1835.9091	1835.9091	R	K	129	145
PSM	AYTNFDAER	582	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=1691	26.007	2	1199.5072	1199.5072	K	D	47	56
PSM	CDYENVPTTVFTPLEYGACGLSEEK	583	sp|Q16881-7|TRXR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21,16-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:510	ms_run[2]:scan=6123	67.11	3	3106.3266	3106.3266	K	A	327	352
PSM	DIVENYFMR	584	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4840	51.04	2	1299.5783	1299.5783	K	D	128	137
PSM	DLADELALVDVIEDK	585	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6284	70.087	2	1724.972	1724.9720	K	L	43	58
PSM	DQGTYEDYVEGLRVFDK	586	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=5091	53.398	3	2181.0304	2181.0304	K	E	82	99
PSM	DSYLILETLPTEYDSR	587	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=6060	65.948	2	2107.9216	2107.9216	K	V	156	172
PSM	DYDSTCVFCR	588	sp|Q9NQE9|HINT3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=3103	36.703	2	1435.5362	1435.5362	K	I	43	53
PSM	DYEEVGVDSVEGEGEEEGEEY	589	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=6021	65.287	2	2461.927	2461.9270	K	-	396	417
PSM	DYENGFGNFVQK	590	sp|Q08830|FGL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4230	45.51	2	1564.7236	1564.7236	K	H	139	151
PSM	EAAENSLVAYK	591	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2067	28.828	2	1261.7191	1261.7191	K	A	121	132
PSM	EDQTEYLEER	592	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1817	26.956	2	1424.5921	1424.5921	K	R	192	202
PSM	EEIIPVAAEYDK	593	sp|P11310|ACADM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3605	40.545	2	1523.7797	1523.7797	R	T	58	70
PSM	ELISNSSDALDK	594	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2213	29.93	2	1358.7566	1358.7566	R	I	47	59
PSM	ENGLPLEYQEK	595	sp|O75223-3|GGCT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2812	34.499	2	1466.7331	1466.7331	K	L	55	66
PSM	ENGVTHPIDYHTTDYVDEIK	596	sp|Q99536-2|VAT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=3310	38.276	3	2573.1401	2573.1401	K	K	97	117
PSM	EVCGFAPYERR	597	sp|Q9Y3U8|RL36_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=1948	27.942	2	1496.6696	1496.6696	R	A	46	57
PSM	EYQEIENLDK	598	sp|L0R819|ASURF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2658	33.314	2	1427.6858	1427.6858	K	T	82	92
PSM	FAQHGTFEYEYSQR	599	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2419	31.489	3	1875.8041	1875.8041	R	W	480	494
PSM	FLDGIYVSEK	600	sp|P32969|RL9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4184	45.105	2	1317.6894	1317.6894	K	G	175	185
PSM	GDLGIEIPAEK	601	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3525	39.929	2	1208.7289	1208.7289	R	V	295	306
PSM	GDYPLEAVR	602	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2516	32.211	2	1052.5715	1052.5715	K	M	368	377
PSM	GEYNVYSTFQSHEPEFDYLK	603	sp|Q00005-6|2ABB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5168	54.198	3	2680.1448	2680.1448	R	S	54	74
PSM	GFGFVSYEK	604	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3748	41.639	2	1180.5842	1180.5842	K	H	232	241
PSM	GIAAQPLYAGYCNHENM	605	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=3111	36.766	3	2037.8538	2037.8538	R	-	540	557
PSM	GISEETTTGVHNLYK	606	sp|P23526-2|SAHH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2167	29.574	3	1795.903	1795.9030	R	M	124	139
PSM	GLLYDSDEEDEERPARK	607	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1743	26.397	3	2169.0263	2169.0263	R	R	134	151
PSM	GNAGQSNYGFANSAMER	608	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=1670	25.849	3	1902.778	1902.7780	R	I	2027	2044
PSM	GQEDAILSYEPVTR	609	sp|Q92796-3|DLG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3498	39.725	2	1690.8027	1690.8027	K	Q	157	171
PSM	GYLGPEQLPDCLK	610	sp|P40926-2|MDHM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,11-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=4363	46.629	2	1636.8208	1636.8208	K	G	79	92
PSM	HGDEIYIAPSGVQK	611	sp|Q96GX9|MTNB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2349	30.959	2	1660.8498	1660.8498	K	E	52	66
PSM	HGVVPLATYMR	612	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2807	34.463	2	1356.6838	1356.6838	K	I	22	33
PSM	HIMGQNVADYMR	613	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=2121	29.226	2	1563.6788	1563.6788	K	Y	198	210
PSM	IEYDTFGELK	614	sp|P07954-2|FUMH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3816	42.171	2	1361.6792	1361.6792	R	V	9	19
PSM	IEYQFFEDR	615	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4007	43.677	2	1359.596	1359.5961	R	H	940	949
PSM	IFRDGEEAGAYDGPR	616	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1517	24.688	3	1765.7885	1765.7885	K	T	105	120
PSM	ITPAHDQNDYEVGQR	617	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1219	22.341	3	1855.8314	1855.8314	K	H	592	607
PSM	IVLDSDAAEYGGHQR	618	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2030	28.558	3	1743.8041	1743.8041	K	L	648	663
PSM	IYIDSNNNPER	619	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2186	29.724	2	1447.6557	1447.6557	K	F	882	893
PSM	IYVGNLPTDVR	620	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4001	43.632	2	1359.7012	1359.7012	R	E	16	27
PSM	LPQPPEGQTYNN	621	sp|Q15819|UB2V2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2100	29.072	2	1470.6604	1470.6604	K	-	134	146
PSM	LVPLLDRPFDETTYEETED	622	sp|O15270|SPTC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=5620	59.432	2	2395.0932	2395.0932	R	-	544	563
PSM	MAQELYMEQK	623	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2483	31.968	2	1417.6659	1417.6659	K	N	763	773
PSM	NKDQGTYEDYVEGLR	624	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=2809	34.478	2	2013.8759	2013.8759	K	V	80	95
PSM	NYITMDELR	625	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=2512	32.183	2	1283.5681	1283.5681	K	R	836	845
PSM	QDNYNEEVADLK	626	sp|Q8N3C0-3|ASCC3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2564	32.577	2	1584.7345	1584.7345	K	I	19	31
PSM	QFQLYEEPDTK	627	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3181	37.297	2	1544.7436	1544.7436	K	L	307	318
PSM	QLLLTADDR	628	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2573	32.644	2	1077.6242	1077.6242	R	V	61	70
PSM	QTQTFTTYSDNQPGVLIQVYEGER	629	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=5202	54.565	3	2887.349	2887.3490	K	A	424	448
PSM	QVMVVPVGPTCDEYAQK	630	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=3723	41.448	2	2068.0047	2068.0047	R	V	620	637
PSM	RDNYVPEVSALDQEIIEVDPDTK	631	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=5421	56.871	3	2792.3794	2792.3794	R	E	81	104
PSM	RISGLIYEETR	632	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2683	33.516	2	1449.7441	1449.7441	K	G	46	57
PSM	RWIYEDVER	633	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2879	35.01	2	1378.6495	1378.6495	K	Q	103	112
PSM	SEGSEYEEIPK	634	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1908	27.643	2	1414.6541	1414.6541	R	R	1089	1100
PSM	SGAHVDFYDK	635	sp|P35270|SPRE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1518	24.695	2	1285.6017	1285.6017	K	-	252	262
PSM	SGYLLPDTK	636	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=2488	32.003	2	1060.6441	1060.6441	R	A	725	734
PSM	SISLYYTGEK	637	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3373	38.759	2	1307.6687	1307.6687	R	G	458	468
PSM	SLEDLQDEYDFK	638	sp|P42224-2|STAT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4168	44.973	2	1648.7546	1648.7546	K	C	162	174
PSM	SLYVAEYHSEPVEDEKP	639	sp|P26196|DDX6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3112	36.773	3	2218.9749	2218.9749	K	-	467	484
PSM	SQECYFDPELYR	640	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=4216	45.399	2	1719.7064	1719.7064	R	S	348	360
PSM	SYDYEAWAK	641	sp|Q9H6T3-2|RPAP3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,4-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3336	38.478	2	1359.5462	1359.5462	K	L	87	96
PSM	TGGAYGEDLGADYNLSQVCDGK	642	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:21,19-UNIMOD:4,22-UNIMOD:510	ms_run[2]:scan=4197	45.231	3	2517.0444	2517.0445	K	V	2450	2472
PSM	TYAICGAIR	643	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2491	32.027	2	1137.5466	1137.5466	K	R	52	61
PSM	YLENYDAIR	644	sp|P15374|UCHL3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2470	31.87	2	1269.5855	1269.5855	R	V	137	146
PSM	YSVDIPLDK	645	sp|P61353|RL27_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3259	37.897	2	1196.6366	1196.6366	R	T	85	94
PSM	YYLAPKIEDEEGS	646	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,6-UNIMOD:510	ms_run[2]:scan=3629	40.728	2	1660.791	1660.7910	K	-	249	262
PSM	SPDDPSRYISPDQLADLYK	647	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,18-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=4799	50.705695	3	2407.114080	2407.102225	K	S	263	282
PSM	DLYANTVLSGGTTMYPGIADR	648	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=4850	51.12083333333333	3	2344.0982	2344.0862	K	M	292	313
PSM	QTTVSNSQQAYQEAFEISKK	649	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,11-UNIMOD:21,19-UNIMOD:510,20-UNIMOD:510	ms_run[1]:scan=2848	34.77694	3	2468.2802	2468.2682	K	E	141	161
PSM	NGRVEIIANDQGNR	650	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=1221	22.35536833333333	3	1588.8562	1588.8489	K	I	47	61
PSM	MDATANDVPSPYEVR	651	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[1]:scan=2915	35.27969	2	1777.7890	1777.7801	K	G	434	449
PSM	SLYDEVAAQGEVVRK	652	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3252	37.84572333333333	3	1810.9583	1810.9497	K	L	825	840
PSM	SYDVPPPPMEPDHPFYSNISK	653	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=4266	45.800081666666664	3	2644.1752	2644.1632	R	D	118	139
PSM	QLHDDYFYHDEL	654	sp|Q14257|RCN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=3798	42.02776666666667	2	1707.7108	1707.7025	R	-	306	318
PSM	DNYVPEVSALDQEIIEVDPDTK	655	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=6018	65.24149666666666	3	2636.2912	2636.2782	R	E	82	104
PSM	RLSEDYGVLK	656	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=2018	28.468208333333333	2	1326.7280	1326.7216	R	T	110	120
PSM	NLQYYDISAK	657	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=2994	35.88644	2	1361.697457	1361.690468	K	S	143	153
PSM	SDYLNTFEFMDK	658	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=5414	56.79374166666666	2	1656.7498	1656.7414	R	L	389	401
PSM	TDMDNQIVVSDYAQMDR	659	sp|P50991|TCPD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,3-UNIMOD:35,12-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=2562	32.56209333333334	3	2145.891067	2145.880819	K	V	258	275
PSM	NRPDYVSEEEEDDEDFETAVK	660	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=3378	38.794111666666666	3	2665.1632	2663.1432	K	K	2662	2683
PSM	GYTSDSEVYTDHGRPGK	661	sp|Q92538|GBF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=1083	21.244406666666666	3	2015.9362	2015.9262	R	I	1315	1332
PSM	QPESSPGGGSGGGGGSSPGEADTGRR	662	sp|P19622|HME2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	17-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=5321	55.77182166666667	2	2459.9222	2459.9332	R	R	20	46
PSM	YLDEDTIYHLQPSGR	663	sp|P31153|METK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=3528	39.953228333333335	3	1920.8992	1919.8872	K	F	235	250
PSM	NQAIYAAVDDDDDDAA	664	sp|Q9UK59|DBR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3522	39.90702833333333	2	1794.7128	1794.7040	R	-	529	545
PSM	LVPLLDRPFDETTYEETED	665	sp|O15270|SPTC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[1]:scan=5620	59.431756666666665	2	2395.1042	2395.0932	R	-	544	563
PSM	ESYSVYVYK	666	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:510	ms_run[1]:scan=2941	35.48484166666667	2	1284.637397	1284.631556	K	V	36	45
PSM	GNAGQSNYGFANSAMER	667	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1670	25.84894	3	1902.786942	1902.778008	R	I	2027	2044
PSM	SPDTNYLFMGDYVDR	668	sp|P67775|PP2AA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=5184	54.36573666666667	2	1905.816218	1905.806849	K	G	75	90
PSM	GIVDQSQQAYQEAFEISK	669	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=4172	45.006346666666666	3	2188.083642	2188.072565	K	K	140	158
PSM	TGGAYGEDLGADYNLSQVCDGK	670	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,13-UNIMOD:21,19-UNIMOD:4,22-UNIMOD:510	ms_run[1]:scan=4197	45.23120333333333	3	2517.056471	2517.044452	K	V	2450	2472
PSM	ADRDESSPYAAMLAAQDVAQR	671	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3937	43.119	3	2378.0786	2378.0786	K	C	64	85
PSM	ATAGDTHLGGEDFDNR	672	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1734	26.327	3	1708.7865	1708.7865	K	L	166	182
PSM	AVQLYQQTANVFENEER	673	sp|Q99747-2|SNAG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4164	44.942	3	2152.005	2152.0050	K	L	51	68
PSM	CYEMASHLR	674	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21	ms_run[2]:scan=1409	23.864	2	1279.5303	1279.5303	K	R	128	137
PSM	DFQDYMEPEEGCQGSPQR	675	sp|O43237-2|DC1L2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=3797	42.02	3	2285.8819	2285.8819	K	R	103	121
PSM	DISTNYYASQK	676	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2206	29.877	2	1436.6861	1436.6861	K	K	672	683
PSM	DLEEAEEYK	677	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2139	29.36	2	1272.5799	1272.5799	K	E	87	96
PSM	DLSLEEIQK	678	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=3459	39.42	2	1141.6867	1141.6867	K	K	44	53
PSM	DLYANTVLSGGTTMYPGIADR	679	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=5432	56.981	3	2408.0585	2408.0585	K	M	292	313
PSM	DWILPSDYDHAEAEAR	680	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4274	45.864	3	2000.873	2000.8730	K	H	256	272
PSM	DYAFVHFEDR	681	sp|O43390-4|HNRPR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3919	42.972	2	1411.6022	1411.6022	K	G	277	287
PSM	DYIPVDQEELR	682	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3691	41.204	2	1489.6914	1489.6914	K	D	2880	2891
PSM	EDQTEYLEER	683	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1979	28.17	2	1344.6258	1344.6258	K	R	192	202
PSM	EEFASTCPDDEEIELAYEQVAK	684	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:4,17-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=5008	52.536	3	2720.2089	2720.2089	R	A	217	239
PSM	EGICALGGTSELSSEGTQHSYSEEEK	685	sp|P13797-3|PLST_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:4,20-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3146	37.027	3	2932.2958	2932.2958	K	Y	56	82
PSM	EGMNIVEAMER	686	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4013	43.726	2	1311.6375	1311.6375	K	F	74	85
PSM	ESYDDVSSFR	687	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2520	32.242	2	1317.5338	1317.5338	R	A	263	273
PSM	EYDQALADLK	688	sp|Q08752|PPID_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3283	38.076	2	1312.6588	1312.6588	K	K	322	332
PSM	EYLPIGGLAEFCK	689	sp|P00505|AATM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=5514	58.015	3	1643.8307	1643.8307	K	A	95	108
PSM	FAQHGTFEYEYSQR	690	sp|P23246-2|SFPQ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=2304	30.618	3	1955.7705	1955.7705	R	W	480	494
PSM	FSGWYDADLSPAGHEEAK	691	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3967	43.359	3	2126.9623	2126.9623	R	R	22	40
PSM	FVESVDEYQFVER	692	sp|Q13405|RM49_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3971	43.393	3	1759.7918	1759.7919	R	L	38	51
PSM	GASQAGMTGYGMPR	693	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:35,10-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=784	17.681	2	1528.6264	1528.6264	R	Q	204	218
PSM	GDFCIQVGR	694	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=2903	35.191	2	1084.5548	1084.5548	R	N	91	100
PSM	GDYAPILQK	695	sp|Q9NY33-4|DPP3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2553	32.494	2	1151.6264	1151.6264	R	V	219	228
PSM	GEEIYSMDEGIR	696	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3211	37.526	2	1511.6427	1511.6427	K	T	885	897
PSM	GFCFLEYEDHK	697	sp|O43390-4|HNRPR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:4,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4088	44.308	3	1591.7055	1591.7055	R	S	192	203
PSM	GFTGIDSDYEKPETPER	698	sp|O95340|PAPS2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2585	32.74	3	2087.9725	2087.9725	K	V	174	191
PSM	GGIVDEGALLR	699	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3423	39.145	2	1132.6664	1132.6664	R	A	237	248
PSM	GIAAQPLYAGYCNHENM	700	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=3580	40.35	3	2021.8589	2021.8589	R	-	540	557
PSM	GIYLWDVEGR	701	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5301	55.585	2	1320.6328	1320.6328	K	K	67	77
PSM	GRNDLMEYAK	702	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1814	26.931	2	1343.6581	1343.6581	K	Q	156	166
PSM	HGVVPLATYMR	703	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=1854	27.232	2	1372.6787	1372.6787	K	I	22	33
PSM	IVYGHLDDPASQEIER	704	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2832	34.651	3	1954.925	1954.9250	K	G	69	85
PSM	KDYEEIGPSICR	705	sp|P61158|ARP3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=2120	29.219	2	1613.7797	1613.7797	K	H	398	410
PSM	KGNFNYIEFTR	706	sp|P19105|ML12A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3203	37.464	2	1535.781	1535.7810	K	I	150	161
PSM	LAEQAERYDDMAACMK	707	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:35,14-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=1688	25.985	3	2064.8992	2064.8992	K	S	12	28
PSM	LAEQAERYEDMAAFMK	708	sp|P31947-2|1433S_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3966	43.352	3	2049.9577	2049.9577	K	G	12	28
PSM	LEDTENWLYEDGEDQPK	709	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4341	46.431	3	2227.9835	2227.9835	K	Q	652	669
PSM	LVMEEAPESYK	710	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2476	31.914	2	1442.7041	1442.7041	K	N	466	477
PSM	LYGDADYLEER	711	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3078	36.516	2	1456.6336	1456.6336	K	H	236	247
PSM	MSGFIYQGK	712	sp|Q15052-2|ARHG6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3570	40.276	2	1177.5879	1177.5879	R	I	333	342
PSM	NANAVMEYEK	713	sp|Q99615-2|DNJC7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1595	25.269	2	1315.6156	1315.6156	K	I	82	92
PSM	NLQYYDISAK	714	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3001	35.939	2	1281.7241	1281.7241	K	S	143	153
PSM	NTFTAWSDEESDYEIDDRDVNK	715	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,13-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4115	44.541	3	2796.2076	2796.2076	K	I	544	566
PSM	NVDGVNYASITR	716	sp|Q9UBR2|CATZ_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2425	31.536	2	1421.6764	1421.6764	R	N	70	82
PSM	SAYQEAMDISKK	717	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2355	31.005	3	1551.8104	1551.8104	R	E	117	129
PSM	SDQDYILK	718	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=2287	30.484	2	1128.574	1128.5740	K	E	40	48
PSM	SYGIPFIETSAK	719	sp|P01116-2|RASK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4791	50.624	2	1459.7636	1459.7636	R	T	136	148
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	720	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510	ms_run[2]:scan=1150	21.803	4	3246.2875	3246.2875	R	K	494	522
PSM	TDDYLDQPCYETINR	721	sp|P50395-2|GDIB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,9-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=3655	40.924	3	2095.8059	2095.8059	R	I	149	164
PSM	TDMDNQIVVSDYAQMDR	722	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3886	42.714	3	2113.891	2113.8910	K	V	228	245
PSM	TPEELDDSDFETEDFDVR	723	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4974	52.26	3	2271.9157	2271.9157	R	S	264	282
PSM	TTPSYVAFTDTER	724	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3210	37.519	2	1520.7571	1520.7571	R	L	37	50
PSM	VSRDTLYEAVR	725	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2260	30.279	2	1421.7128	1421.7128	K	E	5	16
PSM	VWDYETGDFER	726	sp|P43034|LIS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3676	41.086	2	1529.6288	1529.6288	K	T	134	145
PSM	VYENVGLMQQQK	727	sp|Q06124|PTN11_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,8-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1890	27.504	2	1599.8004	1599.8004	R	S	579	591
PSM	YHTSQSGDEMTSLSEYVSR	728	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=3596	40.475	3	2369.9337	2369.9337	R	M	457	476
PSM	YLDEDTIYHLQPSGR	729	sp|P31153-2|METK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3815	42.163	3	1919.8879	1919.8879	K	F	172	187
PSM	YLENYDAIR	730	sp|P15374|UCHL3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2811	34.492	2	1349.5518	1349.5518	R	V	137	146
PSM	YMACCLLYR	731	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,2-UNIMOD:35,4-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=2952	35.567	2	1378.5697	1378.5697	K	G	277	286
PSM	YSEEANNLIEECEQAER	732	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=3830	42.282	3	2196.9095	2196.9095	K	L	120	137
PSM	YYVTIIDAPGHR	733	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3383	38.834	3	1517.7492	1517.7492	K	D	85	97
PSM	NPDDITQEEYGEFYK	734	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3891	42.75525833333333	3	2074.8592	2074.8482	R	S	292	307
PSM	YHTSQSGDEMTSLSEYVSR	735	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=3596	40.47469	3	2369.9452	2369.9332	R	M	457	476
PSM	AGLYGLPR	736	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=2817	34.53824	2	959.509815	959.505386	K	R	42	50
PSM	WTAPEAIAYR	737	sp|P54764|EPHA4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=3411	39.05330166666667	2	1290.628550	1290.622206	R	K	790	800
PSM	QTQTFTTYSDNQPGVLIQVYEGER	738	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=5202	54.56454166666666	3	2887.3622	2887.3482	K	A	424	448
PSM	EALQDVEDENQ	739	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510	ms_run[1]:scan=2275	30.39285	2	1322.6108	1322.6045	K	-	245	256
PSM	ALRTDYNASVSVPDSSGPER	740	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=2313	30.684095000000003	3	2234.0532	2234.0422	K	I	67	87
PSM	GIYAYGFEK	741	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[1]:scan=3599	40.49982833333333	2	1194.6049	1194.5993	R	P	46	55
PSM	AMEVDERPTEQYSDIGGLDK	742	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,2-UNIMOD:35,12-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=2629	33.09769166666667	3	2416.1252	2416.1132	K	Q	174	194
PSM	YSEEANNLIEECEQAER	743	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=3830	42.28159333333333	3	2196.9202	2196.9092	K	L	120	137
PSM	YGAHNYHPLPVALER	744	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=2682	33.50799333333333	3	1929.8842	1929.8742	K	G	50	65
PSM	ASGNYATVISHNPETK	745	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=1601	25.311833333333336	3	1835.9168	1835.9086	R	K	129	145
PSM	YYVTIIDAPGHR	746	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=3383	38.833708333333334	3	1517.7560	1517.7487	K	D	85	97
PSM	ADRDESSPYAAMLAAQDVAQR	747	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=3937	43.119011666666665	3	2378.0912	2378.0782	K	C	64	85
PSM	LDSSDIYNELK	748	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=4337	46.39924166666667	2	1443.7239	1443.7166	K	E	1036	1047
PSM	PNTSIVGAFTNALSVVPK	749	sp|Q6N043-3|Z280D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	3-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=3688	41.17895333333333	3	2087.9422	2087.9552	K	-	575	593
PSM	DPNQGGKDITEEIMSGAR	750	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=5914	63.63854333333334	2	2046.9090	2046.9136	R	T	184	202
PSM	ESYDDVSSFR	751	sp|Q99848|EBP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=2520	32.24210333333333	2	1317.540693	1317.533845	R	A	263	273
PSM	QTTVSNSQQAYQEAFEISK	752	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=3321	38.36213166666666	2	2306.120985	2306.110407	K	K	141	160
PSM	NDQDTWDYTNPNLSGQGDPGSNPNK	753	sp|P14866|HNRPL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,9-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=3385	38.85089333333333	3	2881.260350	2881.246460	K	R	278	303
PSM	AADEEAFEDNSEEYIRR	754	sp|P55060-4|XPO2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2615	32.988	3	2156.9112	2156.9112	R	D	300	317
PSM	AEDSGEYHCVYHFVSAPK	755	sp|Q9Y639-3|NPTN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4,18-UNIMOD:510	ms_run[2]:scan=2764	34.134	3	2243.0031	2243.0031	R	A	94	112
PSM	AEEYEFLTPVEEAPK	756	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4420	47.116	3	1898.9227	1898.9227	R	G	153	168
PSM	AENYDIPSADR	757	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1683	25.947	2	1363.5869	1363.5869	R	H	830	841
PSM	AYGELPEHAK	758	sp|P47813|IF1AX_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1097	21.378	2	1261.638	1261.6380	K	I	105	115
PSM	DISLSDYK	759	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:510	ms_run[2]:scan=3019	36.073	2	1007.5812	1007.5812	K	G	28	36
PSM	DLYANTVLSGGTTMYPGIADR	760	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=4850	51.121	3	2344.087	2344.0870	K	M	292	313
PSM	DLYANTVLSGGTTMYPGIADR	761	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5340	55.941	3	2328.0921	2328.0921	K	M	292	313
PSM	DNLTLWTSDMQGDGEEQNK	762	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4665	49.283	3	2248.059	2248.0590	R	E	204	223
PSM	DQIYDIFQK	763	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=5020	52.652	2	1316.669	1316.6690	K	L	194	203
PSM	DTLYEAVR	764	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2369	31.108	2	1079.5113	1079.5113	R	E	8	16
PSM	DYDDMSPR	765	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=1373	23.586	2	1111.4106	1111.4106	R	R	255	263
PSM	DYEEVGVDSVEGEGEEEGEEY	766	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=7601	96.556	3	2461.927	2461.9270	K	-	396	417
PSM	DYGVYLEDSGHTLR	767	sp|Q13162|PRDX4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3487	39.641	3	1737.7823	1737.7823	K	G	187	201
PSM	EAQLYAAQAHLK	768	sp|P49321-2|NASP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2107	29.124	3	1489.7967	1489.7967	K	L	197	209
PSM	EFHLNESGDPSSK	769	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=1746	26.419	3	1513.7685	1513.7685	K	S	130	143
PSM	EFTNVYIK	770	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=3224	37.631	2	1160.6155	1160.6155	K	N	189	197
PSM	EGDPAIYAER	771	sp|Q9UGI8-2|TES_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1706	26.118	2	1233.5491	1233.5491	K	A	236	246
PSM	EKYIDQEELNK	772	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1620	25.455	2	1589.8439	1589.8439	K	T	282	293
PSM	ENDFDRLVLQYAPSA	773	sp|O14579-3|COPE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=5442	57.109	2	1850.8664	1850.8664	K	-	242	257
PSM	ETCAWFTDNYEQARK	774	sp|Q13630|FCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:4,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3178	37.272	3	2065.9241	2065.9241	K	-	307	322
PSM	EYTDVYPEIIER	775	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4284	45.942	2	1639.7595	1639.7595	K	A	294	306
PSM	FGDRFPAMSDAYDR	776	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3391	38.896	3	1760.7442	1760.7442	R	T	155	169
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	777	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,34-UNIMOD:510	ms_run[2]:scan=5063	53.117	4	3824.5651	3824.5651	K	A	469	503
PSM	FLQDYFDGNLK	778	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4629	48.992	2	1506.7432	1506.7432	R	R	352	363
PSM	FVINYDYPNSSEDYVHR	779	sp|Q92841-1|DDX17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3972	43.4	3	2310.9448	2310.9448	K	I	410	427
PSM	GDNIYEWR	780	sp|P51965-2|UB2E1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2877	34.996	2	1165.5018	1165.5018	K	S	40	48
PSM	GFVEPDHYVVVGAQR	781	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3399	38.958	3	1785.8664	1785.8664	K	D	395	410
PSM	GNAGQSNYGFANSAMER	782	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2472	31.884	3	1886.7831	1886.7831	R	I	2027	2044
PSM	HNDDEQYAWESSAGGSFTVR	783	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3753	41.679	3	2368.981	2368.9810	K	T	154	174
PSM	IAVAAQNCYK	784	sp|P60174-3|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:4,10-UNIMOD:510	ms_run[2]:scan=1453	24.202	2	1204.6911	1204.6911	K	V	97	107
PSM	ITPAHDQNDYEVGQR	785	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1227	22.398	2	1855.8314	1855.8314	K	H	592	607
PSM	IYHLPDAESDEDEDFK	786	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3226	37.645	3	2069.9143	2069.9143	K	E	210	226
PSM	LAEQAERYDDMAACMK	787	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2526	32.288	3	2048.9043	2048.9043	K	S	12	28
PSM	LDSSDIYNELK	788	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4316	46.221	2	1443.7171	1443.7171	K	E	1036	1047
PSM	LMIEMDGTENK	789	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3070	36.455	2	1347.7051	1347.7051	K	S	93	104
PSM	LYDAYELK	790	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=2880	35.017	2	1241.5659	1241.5659	R	H	90	98
PSM	LYGDADYLEER	791	sp|P17812-2|PYRG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3337	38.485	2	1456.6336	1456.6336	K	H	236	247
PSM	NGSLDSPGKQDTEEDEEEDEK	792	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:510,12-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=1275	22.785	3	2532.1125	2532.1125	K	D	134	155
PSM	NKDQGTYEDYVEGLR	793	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3003	35.953	2	1933.9095	1933.9095	K	V	80	95
PSM	NSVVEASEAAYK	794	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1723	26.243	2	1414.7018	1414.7018	K	E	144	156
PSM	QASVADYEETVK	795	sp|P49419-4|AL7A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2003	28.356	2	1486.7229	1486.7229	R	K	82	94
PSM	QWYESHYALPLGR	796	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3950	43.223	2	1732.8187	1732.8187	R	K	111	124
PSM	QYDTYGEEGLK	797	sp|Q9UBS4|DJB11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2023	28.503	2	1449.6701	1449.6701	K	D	85	96
PSM	RGPGLYYVDSEGNR	798	sp|P28074-3|PSB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=2300	30.585	2	1775.7493	1775.7493	K	I	63	77
PSM	SAYQEAMDISK	799	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2762	34.12	2	1389.6524	1389.6524	R	K	117	128
PSM	SCAHDWVYE	800	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=2597	32.834	2	1279.4793	1279.4793	K	-	129	138
PSM	SEYDRGVNTFSPEGR	801	sp|P28066|PSA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2105	29.111	3	1826.8049	1826.8049	R	L	6	21
PSM	SKFDNLYGCR	802	sp|P23526-2|SAHH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=1712	26.163	2	1406.669	1406.6690	K	E	159	169
PSM	SNTSPEELGPLANQLTSDYGR	803	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=4644	49.112	3	2362.0902	2362.0902	K	L	1875	1896
PSM	THAVSVSETDDYAEIIDEEDTYTMPSTR	804	sp|Q05397-4|FAK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4441	47.283	3	3288.4117	3288.4117	R	D	205	233
PSM	THYSNIEANESEEVR	805	sp|P04632|CPNS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1414	23.903	3	1890.8209	1890.8209	R	Q	85	100
PSM	TTYDSSLSSYTVPLEK	806	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3920	42.979	2	1937.9547	1937.9547	K	D	268	284
PSM	TVAEGHGDTLYVGTTR	807	sp|O95834|EMAL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1894	27.537	3	1789.846	1789.8460	R	N	342	358
PSM	TWNDPSVQQDIK	808	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2655	33.289	2	1497.81	1497.8100	R	F	102	114
PSM	TYTAYVDLEK	809	sp|P54577|SYYC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3218	37.583	2	1349.6792	1349.6792	K	D	288	298
PSM	VADWTGATYQDK	810	sp|O15371-2|EIF3D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2426	31.544	2	1501.7127	1501.7127	K	R	42	54
PSM	VEAQVYILSK	811	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3507	39.793	2	1296.7367	1296.7367	K	E	352	362
PSM	VVGKDYLLCDYNR	812	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3093	36.628	3	1761.8797	1761.8797	K	D	54	67
PSM	VYEIQDIYENSWTK	813	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4985	52.348	2	2014.9003	2014.9003	K	L	88	102
PSM	YINVGDLAR	814	sp|Q9Y3D8-2|KAD6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3717	41.404	2	1133.5694	1133.5694	K	E	28	37
PSM	YTISQEAYDQR	815	sp|Q99426-2|TBCB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=2003	28.356	2	1486.6554	1486.6554	K	Q	56	67
PSM	SYELPDGQVITIGNER	816	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=4920	51.73299333333333	2	1904.9062	1903.9132	K	F	239	255
PSM	VDATEESDLAQQYGVR	817	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=2951	35.55970166666667	3	1893.866333	1893.856970	K	G	82	98
PSM	RTGYESGEYEMLGEGLGVK	818	sp|Q13561|DCTN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,9-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=3987	43.52296166666667	3	2222.0712	2222.0602	K	E	78	97
PSM	DYAFIHFDER	819	sp|O60506|HNRPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4380	46.77173833333333	2	1425.625079	1425.617849	K	D	372	382
PSM	LPSSPVYEDAASFK	820	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=3702	41.28989166666667	2	1657.8355	1657.8272	R	A	415	429
PSM	QPESSPGGGSGGGGGSSPGEADTGRR	821	sp|P19622|HME2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	17-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=7614	96.81004666666666	2	2459.9202	2459.9332	R	R	20	46
PSM	ENLSYDLVPLK	822	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=4674	49.35442333333334	2	1437.786525	1437.779283	K	N	85	96
PSM	AEDSGEYHCVYHFVSAPK	823	sp|Q9Y639|NPTN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4,18-UNIMOD:510	ms_run[1]:scan=2771	34.188336666666665	4	2243.0132	2243.0022	R	A	210	228
PSM	TEPVALEPRCAADAGMKR	824	sp|Q8N2K0-3|ABD12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:4,16-UNIMOD:35,17-UNIMOD:510	ms_run[1]:scan=4516	47.91560333333333	2	2137.0622	2135.0532	R	A	5	23
PSM	ALELDPDNETYK	825	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=3071	36.462195	2	1554.756526	1554.749105	K	S	185	197
PSM	TLQGLEIELQSQLSMK	826	sp|P13646|K1C13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:510	ms_run[1]:scan=6060	65.94782333333333	2	2107.932129	2106.917475	R	A	327	343
PSM	DSGSDEDFLMEDDDDSDYGSSK	827	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,16-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=4690	49.53579166666667	3	2575.971520	2575.958184	K	K	129	151
PSM	ADLEAQRDVTYEEAK	828	sp|P61106|RAB14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2046	28.674	3	1884.9143	1884.9143	K	Q	126	141
PSM	ALMDEVVK	829	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:510	ms_run[2]:scan=2600	32.857	2	971.59979	971.5998	K	A	326	334
PSM	ALRTDYNASVSVPDSSGPER	830	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2313	30.684	3	2234.0429	2234.0429	K	I	67	87
PSM	ASAETVDPASLWEY	831	sp|Q16658|FSCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=5700	60.615	2	1651.7231	1651.7231	K	-	480	494
PSM	DGNGYISAAELR	832	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=3182	37.305	2	1298.6679	1298.6679	K	H	96	108
PSM	DIQTNVYIK	833	sp|P48556|PSMD8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3079	36.523	2	1240.6741	1240.6741	K	H	219	228
PSM	DQLIYNLLK	834	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=5744	61.254	2	1266.7261	1266.7261	K	E	6	15
PSM	DQLLLGPTYATPK	835	sp|P55084-2|ECHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4021	43.788	2	1563.8586	1563.8586	K	V	327	340
PSM	DVIEEYFK	836	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=4100	44.419	2	1189.5944	1189.5944	K	C	122	130
PSM	DYEEVGVDSVEGEGEEEGEEY	837	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=5651	59.895	2	2461.927	2461.9270	K	-	396	417
PSM	DYFGAHTYELLAK	838	sp|P52209-2|6PGD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4771	50.394	2	1754.7994	1754.7994	R	P	435	448
PSM	EGALCEENMR	839	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=917	19.632	2	1257.5542	1257.5542	K	G	689	699
PSM	EHVEEISELFYDAK	840	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4884	51.388	2	1855.8917	1855.8917	K	S	428	442
PSM	EIEYEVVR	841	sp|P31327-2|CPSM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2306	30.632	2	1149.5531	1149.5531	K	D	180	188
PSM	EIIDLVLDR	842	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=4738	50.119	2	1118.6759	1118.6759	K	I	78	87
PSM	EQNSPIYISR	843	sp|Q9NUP9|LIN7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2477	31.921	2	1319.6335	1319.6335	K	I	112	122
PSM	EYELLSDELNQK	844	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4135	44.704	3	1627.8019	1627.8019	K	S	515	527
PSM	FDRGYISPYFINTSK	845	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4343	46.446	3	2034.953	2034.9530	K	G	219	234
PSM	FKKYEEIDNAPEER	846	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1350	23.41	3	1949.0032	1949.0032	K	A	89	103
PSM	GDYPLEAVR	847	sp|P14618-2|KPYM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2647	33.227	2	1132.5378	1132.5378	K	M	368	377
PSM	GEEDWLYER	848	sp|Q9NVS9-4|PNPO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3776	41.86	2	1309.544	1309.5440	R	L	207	216
PSM	GGYIGSTYFER	849	sp|P61081|UBC12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=3579	40.343	2	1442.5733	1442.5733	R	C	170	181
PSM	GIYAYGFEK	850	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3621	40.667	2	1274.5662	1274.5662	R	P	52	61
PSM	GLFDEYGSK	851	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=3160	37.134	2	1082.5921	1082.5921	R	K	396	405
PSM	GRNDLMEYAK	852	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:35,8-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1014	20.646	3	1359.653	1359.6530	K	Q	156	166
PSM	GVQGFQDYIEK	853	sp|Q9NZB2-2|F120A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3523	39.914	2	1430.7119	1430.7119	M	H	2	13
PSM	GYFEYIEENK	854	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3715	41.389	2	1358.7031	1358.7031	R	Y	237	247
PSM	GYNDDYYEESYFTTR	855	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4291	45.998	2	2035.7937	2035.7937	K	T	89	104
PSM	HADYIASYGSK	856	sp|P53611|PGTB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1466	24.303	2	1358.6544	1358.6544	K	K	23	34
PSM	HYAHTDCPGHADYVK	857	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:4,15-UNIMOD:510	ms_run[2]:scan=922	19.679	4	1837.8842	1837.8842	R	N	121	136
PSM	IIEEDDAYDFSTDYV	858	sp|Q9BVP2-2|GNL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=5430	56.963	2	1907.7814	1907.7814	K	-	523	538
PSM	IYESIEEAK	859	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=1998	28.317	2	1228.6265	1228.6265	K	S	721	730
PSM	LDVTSVEDYK	860	sp|P48643-2|TCPE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3432	39.215	2	1315.6585	1315.6585	K	A	173	183
PSM	LIIAGTSAYAR	861	sp|P34897-3|GLYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2706	33.688	2	1248.6692	1248.6692	R	L	199	210
PSM	LMTTNEIQSNIYT	862	sp|O95456-2|PSMG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=3514	39.846	2	1656.753	1656.7530	K	-	255	268
PSM	LQAGEYVSLGK	863	sp|O60488-2|ACSL4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2858	34.856	2	1311.7112	1311.7112	K	V	536	547
PSM	LTFDEEAYK	864	sp|Q9BUP3-2|HTAI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3123	36.859	2	1262.6108	1262.6108	K	N	55	64
PSM	LTRDETNYGIPQR	865	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=1600	25.306	3	1675.8143	1675.8143	K	A	45	58
PSM	LVIPSELGYGER	866	sp|P26885|FKBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4146	44.794	2	1445.738	1445.7380	K	G	104	116
PSM	NASTFEDVTQVSSAYQK	867	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,15-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3338	38.492	3	2021.962	2021.9620	K	T	283	300
PSM	NELESYAYSLK	868	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3736	41.547	2	1383.7558	1383.7558	R	N	563	574
PSM	NLQYYDISAK	869	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3397	38.943	2	1361.6905	1361.6905	K	S	143	153
PSM	NNDYQSIEELK	870	sp|Q9NPI1|BRD7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2828	34.62	2	1499.7181	1499.7181	K	D	187	198
PSM	NNLSYDCIGR	871	sp|Q01581|HMCS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2252	30.22	2	1324.5695	1324.5695	R	L	80	90
PSM	NPYALLGEDEC	872	sp|P36915-2|GNL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=4286	45.96	2	1393.5685	1393.5685	R	-	420	431
PSM	NQALNTDNYGHDLASVQALQR	873	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3455	39.391	3	2441.1549	2441.1549	K	K	1233	1254
PSM	NYITMDELR	874	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3707	41.328	2	1267.5732	1267.5732	K	R	836	845
PSM	QLEPVYNSLAK	875	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2859	34.863	2	1408.764	1408.7640	K	K	560	571
PSM	QLHDDYFYHDEL	876	sp|Q14257|RCN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=3989	43.538	2	1787.6694	1787.6694	R	-	306	318
PSM	QYEQQTYQVIPEVIK	877	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4279	45.902	2	2013.0496	2013.0496	R	N	39	54
PSM	RLSQSDEDVIR	878	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1777	26.649	2	1430.6979	1430.6979	K	L	119	130
PSM	RTSSAQVEGGVHSLHSYEK	879	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,17-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=1107	21.457	4	2219.1008	2219.1008	K	R	493	512
PSM	SESVVYADIR	880	sp|O95297-5|MPZL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2572	32.637	2	1251.596	1251.5961	K	K	108	118
PSM	SSGPYGGGGQYFAKPR	881	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1831	27.064	3	1855.8332	1855.8332	R	N	232	248
PSM	TLSNAEDYLDDEDSD	882	sp|Q92882|OSTF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4005	43.663	2	1814.6831	1814.6831	R	-	200	215
PSM	TTEMETIYDLGTK	883	sp|Q9Y230-2|RUVB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4264	45.783	2	1648.7943	1648.7943	K	M	120	133
PSM	VFDYSEYWEGAR	884	sp|P11498|PYC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=4548	48.196	2	1714.653	1714.6530	R	G	831	843
PSM	VKGEEIYSMDEGIR	885	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2715	33.755	2	1772.8692	1772.8692	R	T	883	897
PSM	VLEDDPEAAYTTTGGKIPIR	886	sp|Q9UF33|EPHA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3273	38.002	3	2293.1879	2293.1879	R	W	822	842
PSM	VPVLASSSQSGDSESDSDSYSSR	887	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=2134	29.319	3	2460.039	2460.0390	R	T	640	663
PSM	WAEYHADIYDK	888	sp|Q9NRX4|PHP14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2561	32.555	2	1637.6841	1637.6841	K	V	49	60
PSM	WDYLTQVEK	889	sp|Q9HB71-3|CYBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3635	40.772	2	1328.669	1328.6690	R	E	120	129
PSM	YADLLLEK	890	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=3563	40.222	2	1111.6203	1111.6203	R	E	788	796
PSM	YALTTTLSAR	891	sp|Q9HB07|MYG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=2521	32.249	2	1209.6219	1209.6219	R	V	189	199
PSM	YCFPNYVGRPK	892	sp|P61163|ACTZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,2-UNIMOD:4,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2290	30.508	3	1627.7296	1627.7296	K	H	33	44
PSM	YEYQPFAGK	893	sp|O75083|WDR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2160	29.519	2	1249.6057	1249.6057	K	I	96	105
PSM	YGVSGYPTLK	894	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2757	34.081	2	1231.6526	1231.6526	K	I	95	105
PSM	YLSDMGYVHR	895	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=2411	31.429	3	1353.6001	1353.6001	K	D	788	798
PSM	YLSDMGYVHR	896	sp|Q9UF33|EPHA6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=2214	29.937	3	1433.5664	1433.5664	K	D	788	798
PSM	YQGVNLYVK	897	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3098	36.667	2	1310.6349	1310.6349	R	N	291	300
PSM	YSFMATVTK	898	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3095	36.642	2	1194.6032	1194.6032	K	A	28	37
PSM	EQVANSAFVER	899	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510	ms_run[1]:scan=1772	26.614145	2	1282.6786	1282.6725	K	V	492	503
PSM	LSLEGDHSTPPSAYGSVK	900	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,14-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2510	32.167905	3	1991.9969	1991.9872	K	A	11	29
PSM	GYSFTTTAER	901	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510	ms_run[1]:scan=1986	28.219336666666663	2	1165.5876	1165.5822	R	E	197	207
PSM	YLSDMGYVHR	902	sp|P29320|EPHA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=2214	29.937326666666667	3	1433.572716	1433.566422	K	D	736	746
PSM	EDMAALEKDYEEVGADSADGEDEGEEY	903	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:35,8-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=3796	42.01250833333333	3	3129.2462	3129.2322	R	-	423	450
PSM	YGVSGYPTLK	904	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=2586	32.747209999999995	2	1311.6250	1311.6184	K	I	95	105
PSM	AVFDETYPDPVR	905	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=3524	39.921615	2	1521.7033	1521.6960	R	V	684	696
PSM	NQALNTDNYGHDLASVQALQR	906	sp|Q13813|SPTN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=3455	39.39062833333333	3	2441.1662	2441.1542	K	K	1253	1274
PSM	EVCGFAPYER	907	sp|Q9Y3U8|RL36_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=2626	33.07409166666667	2	1340.5747	1340.5679	R	R	46	56
PSM	LGEYEDVSRVEK	908	sp|Q99426|TBCB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=1957	28.009545000000003	3	1570.7981	1570.7911	R	Y	95	107
PSM	EAIEGTYIDK	909	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[1]:scan=2356	31.012676666666668	2	1285.6537	1285.6474	K	K	49	59
PSM	TKEVYELLDSPGK	910	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,2-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=3268	37.964075	2	1659.9302	1659.9216	K	V	18	31
PSM	LMTTNEIQSNIYT	911	sp|O95456|PSMG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,2-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=3514	39.84560333333333	2	1656.7610	1656.7525	K	-	276	289
PSM	IYVGNLPTDVR	912	sp|Q13242|SRSF9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4007	43.677095	2	1359.7070	1359.7007	R	E	16	27
PSM	DILIQYDR	913	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=3418	39.10955666666666	2	1148.5741	1148.5686	K	T	110	118
PSM	FPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG	914	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,33-UNIMOD:21	ms_run[1]:scan=3909	42.89461666666667	3	3333.3572	3333.3422	R	-	773	807
PSM	TPEELDDSDFETEDFDVR	915	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=4974	52.26008833333333	3	2271.927572	2271.915667	R	S	634	652