MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100709_011DYRK1A.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100709_011DYRK1A.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	47.0	null	333-UNIMOD:510,336-UNIMOD:21	0.06	47.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	46.0	null	42-UNIMOD:510,42-UNIMOD:4,43-UNIMOD:21,67-UNIMOD:510	0.05	46.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	39-UNIMOD:510,41-UNIMOD:21	0.02	43.0	1	1	1
PRT	sp|Q96S44|PRPK_HUMAN	EKC/KEOPS complex subunit TP53RK OS=Homo sapiens OX=9606 GN=TP53RK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	6-UNIMOD:510,8-UNIMOD:21	0.09	42.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	228-UNIMOD:510	0.09	42.0	7	1	0
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	171-UNIMOD:510,173-UNIMOD:21,179-UNIMOD:4	0.04	41.0	2	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null	230-UNIMOD:510,232-UNIMOD:21,231-UNIMOD:21	0.04	41.0	2	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	180-UNIMOD:510,182-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	337-UNIMOD:510,346-UNIMOD:21,345-UNIMOD:21	0.03	39.0	2	1	0
PRT	sp|A0MZ66-7|SHOT1_HUMAN	Isoform 7 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	74-UNIMOD:510,82-UNIMOD:21,93-UNIMOD:510	0.10	38.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	204-UNIMOD:510,222-UNIMOD:510,213-UNIMOD:35	0.09	37.0	3	1	0
PRT	sp|Q13627-2|DYR1A_HUMAN	Isoform 1 of Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	126-UNIMOD:510,127-UNIMOD:21,141-UNIMOD:510,732-UNIMOD:510,739-UNIMOD:21,745-UNIMOD:4,749-UNIMOD:21,753-UNIMOD:21,741-UNIMOD:35,72-UNIMOD:510,75-UNIMOD:21,81-UNIMOD:21	0.07	37.0	6	3	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	22-UNIMOD:510,37-UNIMOD:21	0.09	36.0	1	1	1
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	104-UNIMOD:510,105-UNIMOD:4,109-UNIMOD:21,121-UNIMOD:510	0.04	35.0	1	1	1
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	308-UNIMOD:510,312-UNIMOD:21	0.04	35.0	1	1	0
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	null	330-UNIMOD:510,333-UNIMOD:21	0.03	35.0	1	1	0
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	75-UNIMOD:510,84-UNIMOD:35	0.13	34.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	362-UNIMOD:510,364-UNIMOD:21,368-UNIMOD:21	0.03	34.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	203-UNIMOD:510,221-UNIMOD:510	0.05	33.0	1	1	1
PRT	sp|Q8WWM7-7|ATX2L_HUMAN	Isoform 7 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	107-UNIMOD:510,111-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	292-UNIMOD:510,306-UNIMOD:510,492-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,45-UNIMOD:21	0.06	33.0	4	3	2
PRT	sp|Q14693|LPIN1_HUMAN	Phosphatidate phosphatase LPIN1 OS=Homo sapiens OX=9606 GN=LPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	434-UNIMOD:510,438-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	221-UNIMOD:510	0.03	33.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	74-UNIMOD:510,76-UNIMOD:21,80-UNIMOD:4	0.06	33.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	428-UNIMOD:510,435-UNIMOD:21,442-UNIMOD:510,437-UNIMOD:21,1099-UNIMOD:510,1103-UNIMOD:21,492-UNIMOD:510,498-UNIMOD:21,501-UNIMOD:21	0.03	32.0	4	3	2
PRT	sp|P29692-4|EF1D_HUMAN	Isoform 4 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	125-UNIMOD:510,143-UNIMOD:21,150-UNIMOD:510	0.10	32.0	2	1	0
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	232-UNIMOD:510,233-UNIMOD:21,245-UNIMOD:510,225-UNIMOD:510	0.08	32.0	2	2	1
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	87-UNIMOD:510,89-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	250-UNIMOD:510,251-UNIMOD:510,252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4,281-UNIMOD:510	0.04	31.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	8-UNIMOD:510,15-UNIMOD:21,28-UNIMOD:510	0.05	31.0	1	1	1
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	405-UNIMOD:510,409-UNIMOD:21,419-UNIMOD:510	0.02	31.0	1	1	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	204-UNIMOD:510,206-UNIMOD:21,215-UNIMOD:35,210-UNIMOD:35,182-UNIMOD:510,184-UNIMOD:21,192-UNIMOD:510	0.12	31.0	4	2	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	373-UNIMOD:510,376-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	14-UNIMOD:510,17-UNIMOD:21,38-UNIMOD:510	0.14	31.0	2	2	2
PRT	sp|Q96B36-2|AKTS1_HUMAN	Isoform 2 of Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	72-UNIMOD:510,82-UNIMOD:21	0.13	31.0	1	1	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	158-UNIMOD:510,160-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	86-UNIMOD:510,87-UNIMOD:21,89-UNIMOD:21	0.02	31.0	3	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	1072-UNIMOD:510,1084-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	30.0	1	1	1
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	463-UNIMOD:510,473-UNIMOD:21,482-UNIMOD:510	0.01	30.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510,163-UNIMOD:510,168-UNIMOD:21,172-UNIMOD:21,174-UNIMOD:510	0.06	30.0	3	2	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	418-UNIMOD:510,435-UNIMOD:21,441-UNIMOD:510,420-UNIMOD:35	0.05	30.0	2	1	0
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	656-UNIMOD:510,658-UNIMOD:21,669-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	4-UNIMOD:510,14-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	468-UNIMOD:510,470-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P60484|PTEN_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	350-UNIMOD:510,366-UNIMOD:21,355-UNIMOD:21	0.07	30.0	2	1	0
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	502-UNIMOD:510,507-UNIMOD:21,522-UNIMOD:4,515-UNIMOD:21	0.06	29.0	2	1	0
PRT	sp|Q9HDC5|JPH1_HUMAN	Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	411-UNIMOD:510,413-UNIMOD:21,425-UNIMOD:510	0.02	29.0	1	1	1
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	6-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:21,18-UNIMOD:35	0.04	29.0	2	1	0
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	815-UNIMOD:510,815-UNIMOD:21,819-UNIMOD:21,817-UNIMOD:21	0.03	29.0	2	1	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	28-UNIMOD:510,223-UNIMOD:510,28-UNIMOD:21	0.16	29.0	3	2	1
PRT	sp|O60664-4|PLIN3_HUMAN	Isoform 4 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	155-UNIMOD:510,163-UNIMOD:21,165-UNIMOD:35	0.04	29.0	2	1	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	608-UNIMOD:510,621-UNIMOD:21	0.02	29.0	1	1	0
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	null	1744-UNIMOD:510,1760-UNIMOD:21	0.01	29.0	1	1	0
PRT	sp|Q96AY3|FKB10_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens OX=9606 GN=FKBP10 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	34-UNIMOD:510,35-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|P61916-2|NPC2_HUMAN	Isoform 2 of NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	36-UNIMOD:510,40-UNIMOD:21,42-UNIMOD:4,47-UNIMOD:4,51-UNIMOD:510	0.14	28.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	103-UNIMOD:510,105-UNIMOD:21,108-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	16-UNIMOD:510,35-UNIMOD:21,47-UNIMOD:4,48-UNIMOD:510	0.05	28.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	126-UNIMOD:510,133-UNIMOD:21	0.11	28.0	1	1	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	505-UNIMOD:510,516-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	411-UNIMOD:510,415-UNIMOD:4,417-UNIMOD:4,423-UNIMOD:21,431-UNIMOD:510,1363-UNIMOD:510,1367-UNIMOD:21	0.03	28.0	2	2	2
PRT	sp|O60245|PCDH7_HUMAN	Protocadherin-7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	241-UNIMOD:510,241-UNIMOD:21,256-UNIMOD:510	0.02	28.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	239-UNIMOD:510,19-UNIMOD:510	0.07	28.0	2	2	2
PRT	sp|Q14258|TRI25_HUMAN	E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	96-UNIMOD:510,100-UNIMOD:21,107-UNIMOD:4,110-UNIMOD:4,112-UNIMOD:510	0.03	27.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	45-UNIMOD:510,57-UNIMOD:21	0.17	27.0	1	1	1
PRT	sp|P18827|SDC1_HUMAN	Syndecan-1 OS=Homo sapiens OX=9606 GN=SDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	231-UNIMOD:510,233-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	606-UNIMOD:510,612-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	1455-UNIMOD:510,1469-UNIMOD:21,1477-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|Q9C0D5-2|TANC1_HUMAN	Isoform 2 of Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	159-UNIMOD:510,163-UNIMOD:4,164-UNIMOD:21,181-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|P31749-2|AKT1_HUMAN	Isoform 2 of RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	60-UNIMOD:510,62-UNIMOD:21,78-UNIMOD:510	0.05	27.0	1	1	1
PRT	sp|Q9BXV9|GON7_HUMAN	EKC/KEOPS complex subunit GON7 OS=Homo sapiens OX=9606 GN=GON7 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	60-UNIMOD:510	0.27	27.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	734-UNIMOD:510,737-UNIMOD:21,744-UNIMOD:4,739-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q71RC2-6|LARP4_HUMAN	Isoform 6 of La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	522-UNIMOD:510,523-UNIMOD:21,528-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q9HCN4-3|GPN1_HUMAN	Isoform 3 of GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	203-UNIMOD:510,206-UNIMOD:21,215-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	519-UNIMOD:510,521-UNIMOD:21,532-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|Q9NUQ3|TXLNG_HUMAN	Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	94-UNIMOD:510,97-UNIMOD:21,101-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q13158|FADD_HUMAN	FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	190-UNIMOD:510,193-UNIMOD:35,194-UNIMOD:21,197-UNIMOD:21	0.10	26.0	3	1	0
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	292-UNIMOD:510,298-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	100-UNIMOD:510,102-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	453-UNIMOD:510,470-UNIMOD:21,477-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	50-UNIMOD:510,62-UNIMOD:21,69-UNIMOD:21,524-UNIMOD:510,534-UNIMOD:21,563-UNIMOD:510,573-UNIMOD:510	0.09	26.0	3	3	3
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	25-UNIMOD:510,34-UNIMOD:21,35-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|Q9NPI6-2|DCP1A_HUMAN	Isoform 2 of mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	483-UNIMOD:510,487-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P18583-8|SON_HUMAN	Isoform H of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	92-UNIMOD:510,92-UNIMOD:4,94-UNIMOD:21,106-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	42-UNIMOD:510,44-UNIMOD:21,47-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	82-UNIMOD:510	0.09	25.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	192-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510,547-UNIMOD:510,558-UNIMOD:510	0.05	25.0	3	3	3
PRT	sp|P35251-2|RFC1_HUMAN	Isoform 2 of Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	1084-UNIMOD:510,1085-UNIMOD:21,1108-UNIMOD:510	0.02	25.0	1	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	1101-UNIMOD:510,1103-UNIMOD:21,1001-UNIMOD:510,1013-UNIMOD:510,1014-UNIMOD:21,1016-UNIMOD:4,1020-UNIMOD:510	0.01	25.0	2	2	2
PRT	sp|O43598|DNPH1_HUMAN	2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	157-UNIMOD:510,169-UNIMOD:21	0.11	25.0	2	1	0
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	494-UNIMOD:510,498-UNIMOD:21,500-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P35251|RFC1_HUMAN	Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	1085-UNIMOD:510,1088-UNIMOD:21,1109-UNIMOD:510	0.02	25.0	1	1	0
PRT	sp|Q8IWW6|RHG12_HUMAN	Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	229-UNIMOD:510,231-UNIMOD:21,240-UNIMOD:21,250-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|O00115-2|DNS2A_HUMAN	Isoform 2 of Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	66-UNIMOD:510,70-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	884-UNIMOD:510,899-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P62979|RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	120-UNIMOD:510,121-UNIMOD:4,123-UNIMOD:21,126-UNIMOD:4	0.13	24.0	1	1	1
PRT	sp|Q96EK9|KTI12_HUMAN	Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	173-UNIMOD:510,184-UNIMOD:21,194-UNIMOD:510	0.06	24.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	186-UNIMOD:510	0.06	24.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510,1928-UNIMOD:510,1942-UNIMOD:21,1944-UNIMOD:21	0.01	24.0	3	2	1
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	455-UNIMOD:510,462-UNIMOD:21,459-UNIMOD:21	0.05	24.0	2	1	0
PRT	sp|Q9BTA9-5|WAC_HUMAN	Isoform 4 of WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	420-UNIMOD:510,420-UNIMOD:21	0.05	24.0	1	1	0
PRT	sp|Q3KQU3-2|MA7D1_HUMAN	Isoform 2 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	112-UNIMOD:510,116-UNIMOD:21,129-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	439-UNIMOD:510,443-UNIMOD:21,456-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	193-UNIMOD:510,195-UNIMOD:21,199-UNIMOD:21,205-UNIMOD:4	0.05	24.0	2	1	0
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	278-UNIMOD:510,285-UNIMOD:21,298-UNIMOD:510	0.07	24.0	1	1	0
PRT	sp|Q9BTA9|WAC_HUMAN	WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	523-UNIMOD:510,525-UNIMOD:21	0.04	24.0	1	1	0
PRT	sp|O76080|ZFAN5_HUMAN	AN1-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=ZFAND5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	41-UNIMOD:510,50-UNIMOD:35,52-UNIMOD:21	0.14	24.0	1	1	1
PRT	sp|O14545|TRAD1_HUMAN	TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	317-UNIMOD:510,327-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|O15160-2|RPAC1_HUMAN	Isoform 2 of DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	256-UNIMOD:510,256-UNIMOD:4,258-UNIMOD:21,270-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	217-UNIMOD:510,221-UNIMOD:21,223-UNIMOD:4,238-UNIMOD:510	0.10	23.0	1	1	1
PRT	sp|Q96PC5-6|MIA2_HUMAN	Isoform 5 of Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	477-UNIMOD:510,479-UNIMOD:21,484-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|O95359-2|TACC2_HUMAN	Isoform 2 of Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	210-UNIMOD:510,212-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	222-UNIMOD:510,225-UNIMOD:21,233-UNIMOD:510,61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510	0.05	23.0	2	2	2
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	11-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	16-UNIMOD:510,18-UNIMOD:21,31-UNIMOD:510	0.09	23.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	80-UNIMOD:510,82-UNIMOD:21,92-UNIMOD:510,67-UNIMOD:510	0.05	23.0	2	2	2
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	100-UNIMOD:510,105-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	264-UNIMOD:510,267-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	82-UNIMOD:510,92-UNIMOD:510	0.07	23.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	26-UNIMOD:510,38-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	298-UNIMOD:510,303-UNIMOD:21,313-UNIMOD:35,317-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|P34932-2|HSP74_HUMAN	Isoform 2 of Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	20-UNIMOD:510	0.10	22.0	1	1	1
PRT	sp|P46379-5|BAG6_HUMAN	Isoform 5 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	957-UNIMOD:510,967-UNIMOD:21,978-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q5H9R7-4|PP6R3_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	764-UNIMOD:510,764-UNIMOD:4,771-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P15559-3|NQO1_HUMAN	Isoform 3 of NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	78-UNIMOD:510,82-UNIMOD:21,90-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	74-UNIMOD:510	0.11	22.0	1	1	1
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	41-UNIMOD:510,43-UNIMOD:21,48-UNIMOD:4,49-UNIMOD:21,52-UNIMOD:4,56-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	210-UNIMOD:510,211-UNIMOD:21,216-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	73-UNIMOD:510,79-UNIMOD:21,83-UNIMOD:35	0.20	22.0	1	1	1
PRT	sp|O15061-2|SYNEM_HUMAN	Isoform 2 of Synemin OS=Homo sapiens OX=9606 GN=SYNM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	1042-UNIMOD:510,1044-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q96E09|PBIR1_HUMAN	PPP2R1A-PPP2R2A-interacting phosphatase regulator 1 OS=Homo sapiens OX=9606 GN=PABIR1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	136-UNIMOD:510,143-UNIMOD:21,147-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	205-UNIMOD:510,209-UNIMOD:21,218-UNIMOD:35,208-UNIMOD:21	0.10	22.0	2	1	0
PRT	sp|Q9C0F1|CEP44_HUMAN	Centrosomal protein of 44 kDa OS=Homo sapiens OX=9606 GN=CEP44 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	324-UNIMOD:510,331-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q13247-3|SRSF6_HUMAN	Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	301-UNIMOD:510,303-UNIMOD:21,311-UNIMOD:510,297-UNIMOD:510,299-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	305-UNIMOD:510,307-UNIMOD:21,318-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P37275-3|ZEB1_HUMAN	Isoform 3 of Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	633-UNIMOD:510,635-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	257-UNIMOD:510,270-UNIMOD:4,272-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	71-UNIMOD:510,76-UNIMOD:21,81-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	741-UNIMOD:510,748-UNIMOD:21,750-UNIMOD:35,754-UNIMOD:4,758-UNIMOD:21	0.03	22.0	1	1	0
PRT	sp|Q86VR2|RETR3_HUMAN	Reticulophagy regulator 3 OS=Homo sapiens OX=9606 GN=RETREG3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	305-UNIMOD:510,307-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	428-UNIMOD:510,445-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	644-UNIMOD:510,646-UNIMOD:21,647-UNIMOD:21,669-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|Q7Z5K2|WAPL_HUMAN	Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	218-UNIMOD:510,221-UNIMOD:21,229-UNIMOD:510	0.01	22.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	SSGSPYGGGYGSGGGSGGYGSR	1	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	47.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1812	25.611	2	2023.8121	2023.8121	R	R	333	355
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	2	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	46.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3029	34.976	2	2487.0381	2487.0381	R	R	42	68
PSM	TESPATAAETASEELDNR	3	sp|Q9NTJ3-2|SMC4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4131	44.422	2	2004.8737	2004.8737	R	S	39	57
PSM	ATTPADGEEPAPEAEALAAAR	4	sp|Q96S44|PRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3853	41.865	2	2150.9945	2150.9945	R	E	6	27
PSM	DNLTLWTSDQQDDDGGEGNN	5	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:510	ms_run[1]:scan=4862	51.941143333333336	2	2226.932972	2226.936145	R	-	228	248
PSM	SQSPAASDCSSSSSSASLPSSGR	6	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=1422	22.654	2	2312.964	2312.9640	R	S	171	194
PSM	SSSPAPADIAQTVQEDLR	7	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=5141	55.29253166666666	2	1997.9498	1997.9514	K	T	230	248
PSM	DNLTLWTSDQQDDDGGEGNN	8	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=5129	55.183	2	2226.9361	2226.9361	R	-	228	248
PSM	INSSGESGDESDEFLQSR	9	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3284	36.985	2	2069.8639	2069.8639	R	K	180	198
PSM	SPSDSSTASTPVAEQIER	10	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2285	29.163	2	1974.8996	1974.8996	R	A	337	355
PSM	VTAEADSSSPTGILATSESK	11	sp|A0MZ66-7|SHOT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,9-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=3426	38.146	2	2098.0355	2098.0355	K	S	74	94
PSM	SPSDSSTASTPVAEQIER	12	sp|Q16643|DREB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=2285	29.162733333333332	2	1974.894097	1974.899563	R	A	337	355
PSM	SSSPAPADIAQTVQEDLR	13	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=5141	55.29253166666666	2	1997.950371	1997.951933	K	T	230	248
PSM	DNLTLWTSDMQGDGEEQNK	14	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4631	49.443	2	2248.059	2248.0590	R	E	204	223
PSM	DNLTLWTSDQQDDDGGEGNN	15	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=5046	54.166	2	2226.9361	2226.9361	R	-	228	248
PSM	VYNDGYDDDNYDYIVK	16	sp|Q13627-2|DYR1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4127	44.391	2	2117.9143	2117.9143	K	N	126	142
PSM	DNLTLWTSDQQDDDGGEGNN	17	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510	ms_run[2]:scan=4950	52.961	2	2226.9361	2226.9361	R	-	228	248
PSM	VWLDPNETNEIANANSR	18	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=4290	45.836	2	2055.9475	2055.9475	K	Q	22	39
PSM	SCGSSTPDEFPTDIPGTK	19	sp|P41091|IF2G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,2-UNIMOD:4,6-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3859	41.926	2	2042.918	2042.9180	R	G	104	122
PSM	TDASSASSFLDSDELER	20	sp|Q14498-3|RBM39_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4650	49.639	2	1942.8257	1942.8257	R	T	308	325
PSM	DNLTLWTSDQQDDDGGEGNN	21	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:510	ms_run[1]:scan=4771	50.92879666666667	2	2226.9324	2226.9356	R	-	228	248
PSM	TDASSASSFLDSDELER	22	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[1]:scan=4650	49.638866666666665	2	1942.8234	1942.8252	R	T	330	347
PSM	DWEDDSDEDMSNFDR	23	sp|Q15185-2|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=3143	35.885	2	1924.7117	1924.7117	K	F	75	90
PSM	TQTPPVSPAPQPTEER	24	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=1891	26.206	2	1927.8542	1927.8542	K	L	362	378
PSM	DATNVGDEGGFAPNILENK	25	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4498	48.007	2	2028.0436	2028.0436	K	E	203	222
PSM	GPPQSPVFEGVYNNSR	26	sp|Q8WWM7-7|ATX2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3654	40.022	2	1860.862	1860.8620	K	M	107	123
PSM	NPDDITQEEYGEFYK	27	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3959	42.897	2	1914.916	1914.9160	R	S	292	307
PSM	SANQSPQSVGSSGVDSGVESTSDGLR	28	sp|Q14693|LPIN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2950	34.294	3	2621.1666	2621.1666	R	D	434	460
PSM	STAGDTHLGGEDFDNR	29	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=1643	24.338	2	1724.7814	1724.7814	K	M	221	237
PSM	TPEELDDSDFETEDFDVR	30	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4907	52.516	2	2271.9157	2271.9157	R	S	264	282
PSM	TQSPGGCSAEAVLAR	31	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2600	31.574	2	1616.7442	1616.7442	R	K	74	89
PSM	FSEGVLQSPSQDQEK	32	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2829	33.375	2	1825.8772	1825.8772	R	L	428	443
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	33	sp|P29692-4|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,19-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4105	44.22	3	3090.3451	3090.3451	K	E	125	151
PSM	SSGPYGGGGQYFAK	34	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2904	33.944	2	1522.713	1522.7130	R	P	232	246
PSM	TLSPTPSAEGYQDVR	35	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2765	32.851	2	1733.8086	1733.8086	R	D	87	102
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	36	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4,32-UNIMOD:510	ms_run[2]:scan=4842	51.731	4	4015.8382	4015.8382	R	I	250	282
PSM	ATESGAQSAPLPMEGVDISPK	37	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=4358	46.466	2	2232.1021	2232.1022	K	Q	8	29
PSM	DVDASPSPLSVQDLK	38	sp|Q8IWZ8|SUGP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4415	47.13	2	1717.8812	1717.8812	R	G	405	420
PSM	GASQAGMTGYGMPR	39	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=1868	26.034	2	1512.6315	1512.6315	R	Q	204	218
PSM	MNVSPDVNYEELAR	40	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4327	46.191	2	1749.7857	1749.7857	K	C	373	387
PSM	RSASPDDDLGSSNWEAADLGNEER	41	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3840	41.763	3	2704.1462	2704.1462	K	K	14	38
PSM	SSDEENGPPSSPDLDR	42	sp|Q96B36-2|AKTS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1746	25.114	2	1814.742	1814.7420	R	I	72	88
PSM	SSTPLPTISSSAENTR	43	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2626	31.771	2	1760.8406	1760.8406	R	Q	158	174
PSM	TTPSVVAFTADGER	44	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,2-UNIMOD:21,4-UNIMOD:21	ms_run[2]:scan=4308	45.988	2	1643.7058	1643.7058	R	L	86	100
PSM	AFGPGLQGGSAGSPAR	45	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2468	30.569	2	1542.7404	1542.7404	K	F	1072	1088
PSM	AFLAELEQNSPK	46	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4135	44.453	2	1493.7803	1493.7803	K	I	2424	2436
PSM	AGEEDEGEEDSDSDYEISAK	47	sp|A2RRP1-2|NBAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2477	30.635	2	2321.9221	2321.9221	R	A	463	483
PSM	EVDEQMLNVQNK	48	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1679	24.612	2	1529.8032	1529.8032	K	N	325	337
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	49	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2640	31.876	3	2810.1902	2810.1902	R	E	418	442
PSM	NDSPTQIPVSSDVCR	50	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=2813	33.238	2	1787.7973	1787.7973	R	L	656	671
PSM	NQYDNDVTVWSPQGR	51	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3650	39.99	2	1891.8314	1891.8314	R	I	4	19
PSM	SGSPAPETTNESVPFAQHSSLDSR	52	sp|O15047|SET1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3063	35.236	3	2614.1761	2614.1761	R	I	468	492
PSM	TVEEPSNPEASSSTSVTPDVSDNEPDHYR	53	sp|P60484|PTEN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=2822	33.32	3	3259.389	3259.3890	K	Y	350	379
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	54	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,6-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=2840	33.46	3	3127.3403	3127.3403	R	-	502	532
PSM	ELSPDFYQPGPDYVK	55	sp|Q9HDC5|JPH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4537	48.37	2	1901.9125	1901.9125	R	Q	411	426
PSM	QGADREESPMTGVCVQQSPVASS	56	sp|Q13627-2|DYR1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:4,18-UNIMOD:21,22-UNIMOD:21	ms_run[2]:scan=3761	40.947	2	2693.0365	2693.0365	R	-	732	755
PSM	SRSAMDSPVPASMFAPEPSSPGAAR	57	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4348	46.386	3	2696.1589	2696.1589	R	A	6	31
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	58	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=3115	35.676	3	2528.1522	2528.1522	R	L	815	839
PSM	SVTEQGAELSNEER	59	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=1505	23.293	2	1581.7695	1581.7695	K	N	28	42
PSM	SVVTGGVQSVMGSR	60	sp|O60664-4|PLIN3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3121	35.72	2	1476.722	1476.7220	K	L	155	169
PSM	TDYNASVSVPDSSGPER	61	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2697	32.303	2	1893.8206	1893.8206	R	I	70	87
PSM	TQPDGTSVPGEPASPISQR	62	sp|Q14980-5|NUMA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2582	31.438	2	2036.9628	2036.9628	R	L	608	627
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	63	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=3115	35.67581833333333	3	2528.1489	2528.1517	R	L	815	839
PSM	TQPDGTSVPGEPASPISQR	64	sp|Q14980|NUMA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[1]:scan=2582	31.437503333333332	2	2036.957178	2036.962832	R	L	1744	1763
PSM	ASPAGGPLEDVVIER	65	sp|Q96AY3|FKB10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4484	47.858	2	1622.8129	1622.8129	R	Y	34	49
PSM	DNLTLWTSDTQGDEAEAGEGGEN	66	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=4923	52.656	3	2442.0519	2442.0519	R	-	223	246
PSM	EVNVSPCPTQPCQLSK	67	sp|P61916-2|NPC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2673	32.125	2	1990.953	1990.9530	K	G	36	52
PSM	GPSPSSPTPPAAAAPAEQAPR	68	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=2492	30.748	2	2149.9659	2149.9659	R	A	103	124
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	69	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,20-UNIMOD:21,32-UNIMOD:4,33-UNIMOD:510	ms_run[2]:scan=4026	43.461	3	3881.5895	3881.5895	R	G	16	49
PSM	IGRIEDVTPIPSDSTR	70	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2850	33.536	2	1868.9457	1868.9457	K	R	126	142
PSM	KPVTVSPTTPTSPTEGEAS	71	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=1933	26.518	2	2033.0242	2033.0242	R	-	505	524
PSM	RSASPDDDLGSSNWEAADLGNEERK	72	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3352	37.514	3	2866.3043	2866.3043	K	Q	14	39
PSM	RSEACPCQPDSGSPLPAEEEK	73	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=1636	24.286	3	2491.1033	2491.1033	R	R	411	432
PSM	SSVFELQVADTPDGEK	74	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4452	47.473	2	1868.9081	1868.9081	R	Q	241	257
PSM	SYELPDGQVITIGNER	75	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=4735	50.619	2	1823.9478	1823.9478	K	F	239	255
PSM	FSEGVLQSPSQDQEK	76	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=2829	33.374945000000004	2	1825.873301	1825.877160	R	L	428	443
PSM	ASAPSPNAQVACDHCLK	77	sp|Q14258|TRI25_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:4,15-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=1699	24.762	3	1972.9173	1972.9173	R	E	96	113
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	78	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=3348	37.471	3	3112.2782	3112.2782	K	L	595	622
PSM	EAAFSPGQQDWSR	79	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3457	38.384	2	1591.6881	1591.6881	R	D	1099	1112
PSM	GGNFGGRSSGPYGGGGQYFAK	80	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,9-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=2874	33.717	3	2168.0113	2168.0113	K	P	225	246
PSM	IVRGDQPAASGDSDDDEPPPLPR	81	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2478	30.643	3	2517.1597	2517.1597	K	L	45	68
PSM	NQSPVDQGATGASQGLLDR	82	sp|P18827|SDC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3131	35.793	2	2026.9533	2026.9533	R	K	231	250
PSM	NSDVLQSPLDSAARDEL	83	sp|Q8NBJ5|GT251_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4753	50.787	2	1942.9097	1942.9097	K	-	606	623
PSM	NSVERPAEPVAGAATPSLVEQQK	84	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,15-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=2747	32.699	3	2525.3163	2525.3163	R	M	1455	1478
PSM	RADNCSPVAEEETTGSAESTLPK	85	sp|Q9C0D5-2|TANC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:4,6-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=2366	29.775	3	2596.2	2596.2000	R	A	159	182
PSM	SGSPSDNSGAEEMEVSLAK	86	sp|P31749-2|AKT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3667	40.121	2	2041.9188	2041.9188	R	P	60	79
PSM	SVTEQGAELSNEER	87	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1950	26.65	2	1661.7358	1661.7358	K	N	28	42
PSM	VAAAPDEDLDGDDEDDAEDENNIDNR	88	sp|Q9BXV9|GON7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=2849	33.529	3	2865.1757	2865.1757	R	T	60	86
PSM	ERPTPSLNNNCTTSEDSLVLYNR	89	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=3630	39.79387833333333	3	2793.2815	2793.2848	K	V	734	757
PSM	ASTASPCNNNINAATAVALQEPR	90	sp|Q71RC2-6|LARP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=3941	42.755	3	2483.1688	2483.1688	R	K	522	545
PSM	DMGSVALDAGTAK	91	sp|Q9HCN4-3|GPN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3585	39.377	2	1382.6789	1382.6789	K	D	203	216
PSM	DVTPPPETEVVLIK	92	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4765	50.884	2	1683.9372	1683.9372	K	N	519	533
PSM	EQVANSAFVER	93	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1697	24.748	2	1282.673	1282.6730	K	V	492	503
PSM	ERPTPSLNNNCTTSEDSLVLYNR	94	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3630	39.794	3	2793.2853	2793.2853	K	V	734	757
PSM	GASQAGMTGYGMPR	95	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=2043	27.355	2	1512.6315	1512.6315	R	Q	204	218
PSM	GASQAGMTGYGMPR	96	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2876	33.731	2	1496.6366	1496.6366	R	Q	204	218
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	97	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2176	28.344	3	2826.1852	2826.1852	R	E	418	442
PSM	NFSDNQLQEGK	98	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2282	29.141	2	1426.6766	1426.6766	R	N	182	193
PSM	NLVSPAYCTQESR	99	sp|Q9NUQ3|TXLNG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=2675	32.139	2	1637.7333	1637.7333	R	E	94	107
PSM	QGADREESPMTGVCVQQSPVASS	100	sp|Q13627-2|DYR1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:35,14-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=2407	30.095	3	2629.0651	2629.0651	R	-	732	755
PSM	SGAMSPMSWNSDASTSEAS	101	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=3716	40.547	2	2031.7651	2031.7651	R	-	190	209
PSM	SPDLAPTPAPQSTPR	102	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2000	27.031	2	1647.8082	1647.8082	K	N	292	307
PSM	SQSPAASDCSSSSSSASLPSSGR	103	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=1420	22.64	3	2312.964	2312.9640	R	S	171	194
PSM	SSSPVQVEEEPVR	104	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2029	27.252	2	1555.7343	1555.7343	R	L	100	113
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	105	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,18-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=1362	22.197	3	2679.212	2679.2120	K	L	453	478
PSM	SVVTGGVQSVMGSR	106	sp|O60664-4|PLIN3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=1759	25.214	2	1492.7169	1492.7169	K	L	155	169
PSM	VEIIANDQGNRITPSYVAFTPEGER	107	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=4787	51.054	3	2969.3785	2969.3786	R	L	50	75
PSM	EQFLDGDGWTSR	108	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=4220	45.20956666666667	2	1523.648896	1523.650606	K	W	25	37
PSM	ASSPSPLTIGTPESQR	109	sp|Q9NPI6-2|DCP1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2911	33.997	2	1740.8508	1740.8508	K	K	483	499
PSM	CVSVQTDPTDEIPTK	110	sp|P18583-8|SON_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3226	36.543	2	1836.8853	1836.8853	R	K	92	107
PSM	DFTPVCTTELGR	111	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=3980	43.059	2	1508.6795	1508.6795	R	A	42	54
PSM	DNLTLWTSDQQDDDGGEGNN	112	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=5268	57.236	2	2226.9361	2226.9361	R	-	228	248
PSM	DQGTYEDYVEGLR	113	sp|P60660-2|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=4299	45.905	2	1577.7422	1577.7422	K	V	82	95
PSM	EDQTEYLEER	114	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1913	26.369	2	1344.6258	1344.6258	K	R	192	202
PSM	ELISNSSDALDK	115	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2205	28.56	2	1358.7566	1358.7566	R	I	47	59
PSM	HSTSPSLDSEYNEELNEDDSQSDEK	116	sp|P35251-2|RFC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=2958	34.355	3	3002.2462	3002.2462	R	D	1084	1109
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	117	sp|P29692-4|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,26-UNIMOD:510	ms_run[2]:scan=3766	40.985	3	3010.3787	3010.3787	K	E	125	151
PSM	SSSPVTELASR	118	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2246	28.87	2	1246.6019	1246.6019	R	S	1101	1112
PSM	TQTPPVSPAPQPTEER	119	sp|Q14247-3|SRC8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1814	25.628	2	1847.8879	1847.8879	K	L	362	378
PSM	YFEADPPGQVAASPDPTT	120	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3792	41.235	2	1975.8665	1975.8665	R	-	157	175
PSM	YRQRSPSPAPAPAPAAAAGPPTR	121	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=1467	23.003	3	2480.1939	2480.1939	R	K	494	517
PSM	DNLTLWTSDQQDDDGGEGNN	122	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510	ms_run[1]:scan=4867	51.994906666666665	3	2226.9352	2226.9356	R	-	228	248
PSM	HSTSPSLDSEYNEELNEDDSQSDEK	123	sp|P35251|RFC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=2958	34.355325	3	3002.2385	3002.2457	R	D	1085	1110
PSM	SGAMSPMSWNSDASTSEAS	124	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=4557	48.55244833333333	2	2015.7676	2015.7697	R	-	190	209
PSM	ATTPPNQGRPDSPVYANLQELK	125	sp|Q8IWW6|RHG12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=4176	44.811373333333336	3	2623.2687	2623.2716	R	I	229	251
PSM	TVEEPSNPEASSSTSVTPDVSDNEPDHYR	126	sp|P60484|PTEN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=2822	33.32049666666667	3	3259.379832	3259.389038	K	Y	350	379
PSM	AGFAGDDAPR	127	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1050	19.691	2	1009.5041	1009.5041	K	A	19	29
PSM	ALINSPEGAVGR	128	sp|O00115-2|DNS2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2732	32.571	2	1296.6651	1296.6651	R	S	66	78
PSM	APVSSTESVIQSNTPTPPPSQPLNETAEEESR	129	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3839	41.755	4	3492.6357	3492.6357	K	I	884	916
PSM	DNLTLWTSDMQGDGEEQNK	130	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3964	42.935	2	2264.0539	2264.0539	R	E	204	223
PSM	ECPSDECGAGVFMASHFDR	131	sp|P62979|RS27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:4,4-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=4279	45.71	3	2284.8801	2284.8801	R	H	120	139
PSM	EGLELPEDEEEK	132	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2864	33.644	2	1483.7566	1483.7566	K	K	547	559
PSM	ELEREESGAAESPALVTPDSEK	133	sp|Q96EK9|KTI12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=2488	30.718	3	2491.2003	2491.2003	K	S	173	195
PSM	ELISNASDALDK	134	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2764	32.844	2	1342.7616	1342.7616	R	I	42	54
PSM	GDRSEDFGVNEDLADSDAR	135	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2895	33.875	3	2100.9408	2100.9408	K	A	186	205
PSM	IMNTFSVVPSPK	136	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4541	48.4	2	1546.7544	1546.7544	R	V	163	175
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	137	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4971	53.172	3	2995.386	2995.3860	R	G	2913	2938
PSM	NVNIYRDSAIPVESDTDDEGAPR	138	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3605	39.56	3	2646.2023	2646.2023	K	I	455	478
PSM	QSPASPPPLGGGAPVR	139	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2641	31.884	2	1600.8187	1600.8187	R	T	1363	1379
PSM	SPSPGPNHTSNSSNASNATVVPQNSSAR	140	sp|Q9BTA9-5|WAC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1180	20.769	3	2878.3055	2878.3055	R	S	420	448
PSM	SSQPSPTAVPASDSPPTK	141	sp|Q3KQU3-2|MA7D1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=1728	24.977	2	1900.9456	1900.9456	R	Q	112	130
PSM	SVPTSTVFYPSDGVATEK	142	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4211	45.139	2	2032.0078	2032.0078	R	A	439	457
PSM	TTPSVVAFTADGER	143	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3988	43.122	2	1563.7394	1563.7394	R	L	86	100
PSM	VPTANVSVVDLTCR	144	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4428	47.232	2	1723.783	1723.7830	R	L	193	207
PSM	YFEADPPGQVAASPDPTT	145	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3796	41.266	3	1975.8665	1975.8665	R	-	157	175
PSM	GGNFGGRSSGPYGGGGQYFAK	146	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,8-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=2874	33.71669	3	2168.0086	2168.0108	K	P	278	299
PSM	SPSPGPNHTSNSSNASNATVVPQNSSAR	147	sp|Q9BTA9|WAC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1180	20.768623333333334	3	2878.2971	2878.3050	R	S	523	551
PSM	QQNSGRMSPMGTASGSNSPTSDSASVQR	148	sp|O76080|ZFAN5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,10-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1222	21.117361666666667	3	2954.2603	2954.2703	R	A	41	69
PSM	ALPSLNTGSSSPR	149	sp|O14545|TRAD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2912	34.004	2	1399.6921	1399.6921	R	G	317	330
PSM	CFSPGVIEVQEVQGK	150	sp|O15160-2|RPAC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4446	47.413	2	1823.9165	1823.9165	R	K	256	271
PSM	DNLTLWTSDMQGDGEEQNK	151	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4629	49.428	3	2248.059	2248.0590	R	E	204	223
PSM	EEFASTCPDDEEIELAYEQVAK	152	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4,22-UNIMOD:510	ms_run[2]:scan=5533	61.353	3	2720.2089	2720.2089	R	A	217	239
PSM	EHSPYGPSPLGWPSSETR	153	sp|Q96PC5-6|MIA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4114	44.29	3	2176.908	2176.9080	R	A	477	495
PSM	ELISNASDALDK	154	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3755	40.901	2	1422.728	1422.7280	R	I	42	54
PSM	EQFLDGDGWTSR	155	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=4220	45.21	2	1523.6506	1523.6506	K	W	25	37
PSM	FSSPTEELDYR	156	sp|O95359-2|TACC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3323	37.277	2	1456.6336	1456.6336	K	N	210	221
PSM	GYISPYFINTSK	157	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4632	49.451	2	1536.7902	1536.7902	R	G	222	234
PSM	HGESAWNLENR	158	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1572	23.793	2	1345.6587	1345.6587	R	F	11	22
PSM	MPQTFRDPATAPLR	159	sp|Q13627-2|DYR1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=3548	39.097	2	1793.8149	1793.8149	R	K	72	86
PSM	QYTSPEEIDAQLQAEK	160	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4143	44.514	2	1996.9667	1996.9667	R	Q	16	32
PSM	SPSPEPIYNSEGK	161	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1965	26.767	2	1551.7494	1551.7494	R	R	80	93
PSM	TVIIEQSWGSPK	162	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3930	42.598	2	1491.8011	1491.8011	R	V	61	73
PSM	VIGSGCNLDSAR	163	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1334	21.986	2	1281.656	1281.6560	R	F	100	112
PSM	VPTANVSVVDLTCR	164	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4138	44.476	2	1643.8166	1643.8166	R	L	193	207
PSM	VTDSSVSVQLRE	165	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3024	34.939	2	1432.7023	1432.7023	R	-	264	276
PSM	YALYDATYETK	166	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3042	35.074	2	1404.7449	1404.7449	R	E	82	93
PSM	VEIIANDQGNRTTPSYVAFTDTER	167	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=4182	44.85784833333334	3	2810.3296	2810.3331	K	L	26	50
PSM	DGGRSSPGGQDEGGFMAQGK	168	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:35,20-UNIMOD:510	ms_run[1]:scan=1254	21.35999	3	2100.9172	2100.9203	R	T	298	318
PSM	NVNIYRDSAIPVESDTDDEGAPR	169	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=3605	39.560295	3	2646.1994	2646.2018	K	I	455	478
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	170	sp|Q08J23-3|NSUN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=3077	35.355	3	3207.3066	3207.3066	R	-	502	532
PSM	AGGIETIANEYSDR	171	sp|P34932-2|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3336	37.377	2	1528.7582	1528.7582	R	C	20	34
PSM	AQTPPGPSLSGSKSPCPQEK	172	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,13-UNIMOD:510,14-UNIMOD:21,16-UNIMOD:4,20-UNIMOD:510	ms_run[2]:scan=1544	23.587	3	2234.1503	2234.1503	K	S	1001	1021
PSM	ASPEPQRENASPAPGTTAEEAMSR	173	sp|P46379-5|BAG6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=1241	21.261	3	2613.159	2613.1590	R	G	957	981
PSM	CAAPRPPSSSPEQR	174	sp|Q5H9R7-4|PP6R3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=967	18.855	2	1652.7554	1652.7554	K	T	764	778
PSM	EGHLSPDIVAEQK	175	sp|P15559-3|NQO1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2335	29.543	2	1569.8076	1569.8076	K	K	78	91
PSM	EGMNIVEAMER	176	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3995	43.175	2	1311.6375	1311.6375	K	F	74	85
PSM	EVDEQMLNVQNK	177	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2707	32.38	2	1513.8083	1513.8083	K	N	325	337
PSM	GGSVLVTCSTSCDQPK	178	sp|P05362|ICAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:4,9-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2536	31.087	2	1922.8193	1922.8193	R	L	41	57
PSM	GSPHYFSPFRPY	179	sp|Q13242|SRSF9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4951	52.969	2	1647.6737	1647.6737	R	-	210	222
PSM	ITITNDQNRLTPEEIER	180	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3344	37.439	2	2155.0734	2155.0734	K	M	524	541
PSM	KEESEESDDDMGFGLFD	181	sp|P05386-2|RLA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4998	53.51	2	2112.8395	2112.8395	K	-	73	90
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	182	sp|O95714|HERC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3475	38.52	3	3088.3094	3088.3094	K	N	1928	1956
PSM	LDSPPPSPITEASEAAEAAEAGNLAVSSR	183	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6017	69.971	3	3030.3684	3030.3684	R	E	492	521
PSM	MPQTFRDPATAPLR	184	sp|Q13627-2|DYR1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=3693	40.353	2	1793.8149	1793.8149	R	K	72	86
PSM	NELESYAYSLK	185	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3767	40.993	2	1383.7558	1383.7558	R	N	563	574
PSM	QGADREESPMTGVCVQQSPVASS	186	sp|Q13627-2|DYR1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:35,14-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=2411	30.124	2	2629.0651	2629.0651	R	-	732	755
PSM	QRSPAPGSPDEEGGAEAPAAGIR	187	sp|O15061-2|SYNEM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1765	25.26	3	2333.0861	2333.0861	R	F	1042	1065
PSM	RIDFIPVSPAPSPTR	188	sp|Q96E09|PBIR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=4665	49.816	2	1845.9004	1845.9004	K	G	136	151
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	189	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=1939	26.565	4	3352.5468	3352.5468	R	Q	205	235
PSM	SEVERPASIPLSSGYSTASSDSTPR	190	sp|Q9C0F1|CEP44_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3247	36.704	3	2694.2598	2694.2598	K	A	324	349
PSM	SGAMSPMSWNSDASTSEAS	191	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4557	48.552	2	2015.7702	2015.7702	R	-	190	209
PSM	SNSPLPVPPSK	192	sp|Q13247-3|SRSF6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1981	26.888	2	1269.7006	1269.7006	R	A	301	312
PSM	SQSRSNSPLPVPPSK	193	sp|Q13247-3|SRSF6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1892	26.214	2	1807.8907	1807.8907	R	A	297	312
PSM	SRSPESQVIGENTKQP	194	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1614	24.114	2	1903.9677	1903.9677	R	-	305	321
PSM	SSTPSPSPLNLSSSR	195	sp|P37275-3|ZEB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2992	34.692	2	1629.7823	1629.7823	R	N	633	648
PSM	SVTSNQSDGTQESCESPDVLDR	196	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,14-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=2500	30.811	3	2524.0485	2524.0485	R	H	257	279
PSM	TFDQLTPDESK	197	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2542	31.135	2	1427.6858	1427.6858	K	E	71	82
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	198	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,16-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3666	40.113	3	2913.407	2913.4070	R	R	67	93
PSM	TTPSVVAFTADGER	199	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3880	42.119	2	1563.7394	1563.7394	R	L	86	100
PSM	QGADREESPMTGVCVQQSPVASS	200	sp|Q13627|DYR1A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:35,14-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=2411	30.124445	2	2629.0532	2629.0642	R	-	741	764
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	201	sp|O95714|HERC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[1]:scan=3475	38.52037833333333	3	3088.3014	3088.3089	K	N	1928	1956
PSM	SRSAMDSPVPASMFAPEPSSPGAAR	202	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=3513	38.825865	3	2713.1542	2712.1532	R	A	6	31
PSM	GQTPLTEGSEDLDGHSDPEESFAR	203	sp|Q86VR2|RETR3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3831	41.623129999999996	3	2689.1482	2687.1442	R	D	305	329
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	204	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1939	26.565218333333334	4	3352.5398	3352.5463	R	Q	205	235
PSM	HIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHR	205	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,18-UNIMOD:510	ms_run[1]:scan=2156	28.19536666666667	5	4525.9552	4525.9672	K	M	428	468
PSM	RPSTSQTVSTPAPVPVIESTEAIEAK	206	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=4592	48.96862333333333	3	2922.4635	2922.4660	K	A	644	670
PSM	RPESPSEISPIK	207	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=1924	26.449695000000002	2	1486.805438	1486.806895	K	G	218	230