MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100723_029CDK5-p35.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100723_029CDK5-p35.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	null	227-UNIMOD:510,247-UNIMOD:21	0.09	45.0	1	1	1
PRT	sp|O75369-7|FLNB_HUMAN	Isoform 7 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	null	1419-UNIMOD:510,1433-UNIMOD:21,1420-UNIMOD:35,2086-UNIMOD:510,2094-UNIMOD:21	0.02	44.0	3	2	1
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	677-UNIMOD:510,691-UNIMOD:21,695-UNIMOD:510	0.02	41.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	333-UNIMOD:510,336-UNIMOD:21	0.06	41.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	228-UNIMOD:510	0.09	40.0	4	1	0
PRT	sp|Q9H2D6-6|TARA_HUMAN	Isoform 6 of TRIO and F-actin-binding protein OS=Homo sapiens OX=9606 GN=TRIOBP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	228-UNIMOD:510,242-UNIMOD:21	0.04	40.0	1	1	1
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	119-UNIMOD:510,135-UNIMOD:21,134-UNIMOD:21	0.03	39.0	2	1	0
PRT	sp|Q92785|REQU_HUMAN	Zinc finger protein ubi-d4 OS=Homo sapiens OX=9606 GN=DPF2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	156-UNIMOD:510,176-UNIMOD:21,178-UNIMOD:510	0.06	39.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	207-UNIMOD:510,86-UNIMOD:510,91-UNIMOD:510,102-UNIMOD:21,218-UNIMOD:35	0.26	39.0	3	2	1
PRT	sp|P55809|SCOT1_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	147-UNIMOD:510,170-UNIMOD:21,173-UNIMOD:510,501-UNIMOD:510,504-UNIMOD:4,509-UNIMOD:21,511-UNIMOD:510	0.08	38.0	3	2	1
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	608-UNIMOD:510,621-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q9UPQ0-9|LIMC1_HUMAN	Isoform 9 of LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	344-UNIMOD:510,357-UNIMOD:21,360-UNIMOD:510	0.02	37.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	157-UNIMOD:510,164-UNIMOD:21	0.04	37.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	null	142-UNIMOD:510,175-UNIMOD:35,176-UNIMOD:510	0.05	37.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	1072-UNIMOD:510,1084-UNIMOD:21,2303-UNIMOD:510,2311-UNIMOD:21,1516-UNIMOD:510,1533-UNIMOD:21,1536-UNIMOD:510,2493-UNIMOD:510,2502-UNIMOD:21,2505-UNIMOD:510,1622-UNIMOD:510,1630-UNIMOD:21	0.03	36.0	6	5	4
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510	0.04	36.0	1	1	1
PRT	sp|P08651-4|NFIC_HUMAN	Isoform 3 of Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	279-UNIMOD:510,290-UNIMOD:21,293-UNIMOD:510,284-UNIMOD:35,300-UNIMOD:510,310-UNIMOD:21	0.07	36.0	3	2	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	230-UNIMOD:510,232-UNIMOD:21,230-UNIMOD:21	0.04	36.0	3	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	428-UNIMOD:510,435-UNIMOD:21,442-UNIMOD:510	0.01	35.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|O75794|CD123_HUMAN	Cell division cycle protein 123 homolog OS=Homo sapiens OX=9606 GN=CDC123 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	289-UNIMOD:510,289-UNIMOD:4,299-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q9UBK8|MTRR_HUMAN	Methionine synthase reductase OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	159-UNIMOD:510,171-UNIMOD:21,175-UNIMOD:21	0.03	34.0	2	1	0
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=POLR1G PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	271-UNIMOD:510,285-UNIMOD:21,288-UNIMOD:510,289-UNIMOD:510	0.04	34.0	2	2	2
PRT	sp|Q92576-2|PHF3_HUMAN	Isoform 2 of PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	1507-UNIMOD:510,1526-UNIMOD:21,1528-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	63-UNIMOD:510,74-UNIMOD:21,62-UNIMOD:510,76-UNIMOD:21	0.08	33.0	4	4	4
PRT	sp|Q9BX68|HINT2_HUMAN	Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	43-UNIMOD:510,47-UNIMOD:21	0.10	33.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	29-UNIMOD:510,41-UNIMOD:21,172-UNIMOD:510,177-UNIMOD:21,181-UNIMOD:510	0.00	33.0	3	2	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	374-UNIMOD:510,400-UNIMOD:21,398-UNIMOD:21,395-UNIMOD:21,1644-UNIMOD:510,1658-UNIMOD:21,1664-UNIMOD:510	0.02	33.0	4	2	1
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	1473-UNIMOD:510,1478-UNIMOD:4,1490-UNIMOD:4,1493-UNIMOD:21,1496-UNIMOD:510	0.02	33.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510,595-UNIMOD:21,598-UNIMOD:510	0.02	32.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	32.0	1	1	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	52-UNIMOD:510,62-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P17544-5|ATF7_HUMAN	Isoform 5 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	42-UNIMOD:510,53-UNIMOD:21	0.14	32.0	1	1	0
PRT	sp|Q7Z6M1-2|RABEK_HUMAN	Isoform 2 of Rab9 effector protein with kelch motifs OS=Homo sapiens OX=9606 GN=RABEPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	74-UNIMOD:510,86-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	null	108-UNIMOD:510,113-UNIMOD:21	0.10	32.0	1	1	1
PRT	sp|O95297-4|MPZL1_HUMAN	Isoform 4 of Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	75-UNIMOD:510,79-UNIMOD:4,86-UNIMOD:21,89-UNIMOD:510	0.11	31.0	1	1	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	549-UNIMOD:510,559-UNIMOD:21,563-UNIMOD:510	0.02	31.0	2	1	0
PRT	sp|P18858-2|DNLI1_HUMAN	Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	41-UNIMOD:510,51-UNIMOD:21,54-UNIMOD:510	0.02	31.0	1	1	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	239-UNIMOD:510,242-UNIMOD:4,243-UNIMOD:35,250-UNIMOD:21,253-UNIMOD:510	0.06	31.0	1	1	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	606-UNIMOD:510,612-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q4V328-3|GRAP1_HUMAN	Isoform 3 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	533-UNIMOD:510,545-UNIMOD:21	0.03	31.0	2	1	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	9-UNIMOD:510,16-UNIMOD:21,27-UNIMOD:510,31-UNIMOD:510	0.03	30.0	1	1	1
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	27-UNIMOD:510,39-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9UBF8-2|PI4KB_HUMAN	Isoform 2 of Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	253-UNIMOD:510,266-UNIMOD:21,269-UNIMOD:510	0.02	30.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	42-UNIMOD:510,53-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,96-UNIMOD:510,104-UNIMOD:21,107-UNIMOD:510,492-UNIMOD:510	0.07	29.0	4	4	4
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	63-UNIMOD:510,71-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P46087-2|NOP2_HUMAN	Isoform 2 of Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	718-UNIMOD:510,728-UNIMOD:21,731-UNIMOD:510	0.02	29.0	1	1	0
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	29.0	1	1	1
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	124-UNIMOD:510,133-UNIMOD:21,135-UNIMOD:35	0.05	29.0	1	1	0
PRT	sp|Q9BQE9|BCL7B_HUMAN	B-cell CLL/lymphoma 7 protein family member B OS=Homo sapiens OX=9606 GN=BCL7B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	105-UNIMOD:510,122-UNIMOD:21	0.13	29.0	1	1	0
PRT	sp|Q6H8Q1|ABLM2_HUMAN	Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	278-UNIMOD:510,294-UNIMOD:21,296-UNIMOD:21	0.03	29.0	2	1	0
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	43-UNIMOD:510,57-UNIMOD:510,158-UNIMOD:510,163-UNIMOD:4	0.12	28.0	2	2	2
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	871-UNIMOD:510,886-UNIMOD:21,902-UNIMOD:510	0.02	28.0	2	2	2
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	4-UNIMOD:510,14-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|Q9BQE9-2|BCL7B_HUMAN	Isoform 2 of B-cell CLL/lymphoma 7 protein family member B OS=Homo sapiens OX=9606 GN=BCL7B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	45-UNIMOD:510,58-UNIMOD:21	0.19	28.0	1	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	61-UNIMOD:510,67-UNIMOD:21,72-UNIMOD:510,70-UNIMOD:21,222-UNIMOD:510,225-UNIMOD:21,233-UNIMOD:510	0.05	28.0	4	2	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	6-UNIMOD:510,28-UNIMOD:21,14-UNIMOD:35	0.09	27.0	5	1	0
PRT	sp|Q8NEN9|PDZD8_HUMAN	PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	970-UNIMOD:510,985-UNIMOD:4,989-UNIMOD:21,992-UNIMOD:510,991-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|P41236|IPP2_HUMAN	Protein phosphatase inhibitor 2 OS=Homo sapiens OX=9606 GN=PPP1R2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	68-UNIMOD:510,73-UNIMOD:21,86-UNIMOD:4,75-UNIMOD:21	0.18	27.0	2	1	0
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	107-UNIMOD:510,119-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q96E09|PBIR1_HUMAN	PPP2R1A-PPP2R2A-interacting phosphatase regulator 1 OS=Homo sapiens OX=9606 GN=PABIR1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	136-UNIMOD:510,143-UNIMOD:21,147-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	227-UNIMOD:510,237-UNIMOD:4,238-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null		0.18	27.0	1	1	1
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	85-UNIMOD:510,95-UNIMOD:21,99-UNIMOD:21,102-UNIMOD:510	0.08	26.0	1	1	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	292-UNIMOD:510,292-UNIMOD:4,304-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|O43237-2|DC1L2_HUMAN	Isoform 2 of Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	103-UNIMOD:510,114-UNIMOD:4,117-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	894-UNIMOD:510,900-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	175-UNIMOD:510,181-UNIMOD:21	0.00	26.0	1	1	1
PRT	sp|O95425-2|SVIL_HUMAN	Isoform 2 of Supervillin OS=Homo sapiens OX=9606 GN=SVIL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	485-UNIMOD:510,494-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	449-UNIMOD:510,456-UNIMOD:21,460-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	120-UNIMOD:510,123-UNIMOD:21,145-UNIMOD:510,100-UNIMOD:510,109-UNIMOD:21,119-UNIMOD:510	0.18	26.0	4	3	1
PRT	sp|Q13045-2|FLII_HUMAN	Isoform 2 of Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	794-UNIMOD:510,801-UNIMOD:21,807-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	142-UNIMOD:510,149-UNIMOD:21,154-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	239-UNIMOD:510,316-UNIMOD:510,324-UNIMOD:21,326-UNIMOD:510	0.08	26.0	2	2	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	26.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	195-UNIMOD:510,203-UNIMOD:21,208-UNIMOD:510,205-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|Q99576-3|T22D3_HUMAN	Isoform 2 of TSC22 domain family protein 3 OS=Homo sapiens OX=9606 GN=TSC22D3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	32-UNIMOD:510,42-UNIMOD:21,46-UNIMOD:21	0.10	26.0	2	1	0
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	1203-UNIMOD:510,1211-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	1311-UNIMOD:510,1321-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|P17544|ATF7_HUMAN	Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	null	42-UNIMOD:510,51-UNIMOD:21	0.03	26.0	1	1	0
PRT	sp|Q9Y446|PKP3_HUMAN	Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	226-UNIMOD:510,238-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P11137-2|MTAP2_HUMAN	Isoform 2 of Microtubule-associated protein 2 OS=Homo sapiens OX=9606 GN=MAP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	414-UNIMOD:510,426-UNIMOD:21	0.04	25.0	1	1	0
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	187-UNIMOD:510,195-UNIMOD:21,197-UNIMOD:510,492-UNIMOD:510,506-UNIMOD:21	0.06	25.0	2	2	2
PRT	sp|Q9NXC5|MIO_HUMAN	GATOR complex protein MIOS OS=Homo sapiens OX=9606 GN=MIOS PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	757-UNIMOD:510,766-UNIMOD:21,769-UNIMOD:510,768-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	107-UNIMOD:510,111-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,466-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|P15336-3|ATF2_HUMAN	Isoform 3 of Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	60-UNIMOD:510,71-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|Q13033-2|STRN3_HUMAN	Isoform Alpha of Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	219-UNIMOD:510,229-UNIMOD:21,231-UNIMOD:510	0.02	25.0	1	1	1
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	469-UNIMOD:510,495-UNIMOD:21,498-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	123-UNIMOD:510,130-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q6H8Q1-4|ABLM2_HUMAN	Isoform 4 of Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	35-UNIMOD:510,48-UNIMOD:21	0.06	25.0	1	1	0
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	1909-UNIMOD:510,1913-UNIMOD:21,1920-UNIMOD:21,1922-UNIMOD:510,1888-UNIMOD:510,1889-UNIMOD:21,1899-UNIMOD:21,1906-UNIMOD:21,1908-UNIMOD:510,1898-UNIMOD:21,1874-UNIMOD:510,1878-UNIMOD:21,1885-UNIMOD:21,1887-UNIMOD:510	0.03	25.0	4	3	2
PRT	sp|P16278|BGAL_HUMAN	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	420-UNIMOD:510,426-UNIMOD:4,434-UNIMOD:21	0.04	25.0	1	1	0
PRT	sp|P46087|NOP2_HUMAN	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	null	722-UNIMOD:510,734-UNIMOD:21,735-UNIMOD:510	0.02	25.0	1	1	0
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	466-UNIMOD:510,475-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	561-UNIMOD:510,571-UNIMOD:21,574-UNIMOD:510	0.01	24.0	1	1	1
PRT	sp|Q9UI10-3|EI2BD_HUMAN	Isoform 3 of Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	75-UNIMOD:510,85-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	20-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	77-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	401-UNIMOD:510,409-UNIMOD:21,413-UNIMOD:510	0.01	24.0	1	1	1
PRT	sp|Q08AD1-2|CAMP2_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	1284-UNIMOD:510,1292-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	292-UNIMOD:510,304-UNIMOD:21	0.04	24.0	1	1	0
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	68-UNIMOD:510,76-UNIMOD:21	0.08	24.0	1	1	0
PRT	sp|O94806|KPCD3_HUMAN	Serine/threonine-protein kinase D3 OS=Homo sapiens OX=9606 GN=PRKD3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	735-UNIMOD:510,735-UNIMOD:21,739-UNIMOD:21,742-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q9BS40|LXN_HUMAN	Latexin OS=Homo sapiens OX=9606 GN=LXN PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	13-UNIMOD:510,27-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|Q04760-2|LGUL_HUMAN	Isoform 2 of Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	29-UNIMOD:510,35-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	701-UNIMOD:510,722-UNIMOD:21,724-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|Q9H488|OFUT1_HUMAN	GDP-fucose protein O-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POFUT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	254-UNIMOD:510,264-UNIMOD:21,267-UNIMOD:4,262-UNIMOD:35	0.05	23.0	2	1	0
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	233-UNIMOD:510,259-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q8N556|AFAP1_HUMAN	Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	246-UNIMOD:510,251-UNIMOD:4,259-UNIMOD:4,265-UNIMOD:21,269-UNIMOD:510,661-UNIMOD:510,668-UNIMOD:21	0.05	23.0	2	2	2
PRT	sp|Q96RT1-7|ERBIN_HUMAN	Isoform 7 of Erbin OS=Homo sapiens OX=9606 GN=ERBIN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	639-UNIMOD:510,658-UNIMOD:4,660-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	194-UNIMOD:510,203-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	251-UNIMOD:510,262-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	37-UNIMOD:510,46-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q8WX93-6|PALLD_HUMAN	Isoform 6 of Palladin OS=Homo sapiens OX=9606 GN=PALLD	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	477-UNIMOD:510,484-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P85037-2|FOXK1_HUMAN	Isoform 2 of Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	253-UNIMOD:510,257-UNIMOD:21,265-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:510,17-UNIMOD:510,18-UNIMOD:21,21-UNIMOD:510	0.10	23.0	1	1	1
PRT	sp|Q69YH5|CDCA2_HUMAN	Cell division cycle-associated protein 2 OS=Homo sapiens OX=9606 GN=CDCA2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	120-UNIMOD:510,131-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	155-UNIMOD:510,165-UNIMOD:21,174-UNIMOD:510	0.07	23.0	1	1	1
PRT	sp|Q9BTC0-1|DIDO1_HUMAN	Isoform 1 of Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1024-UNIMOD:510,1030-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9BTE3-2|MCMBP_HUMAN	Isoform 2 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	102-UNIMOD:510,108-UNIMOD:4,118-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	1676-UNIMOD:510,1693-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	30-UNIMOD:510,38-UNIMOD:21,41-UNIMOD:510	0.09	23.0	2	1	0
PRT	sp|O60291-4|MGRN1_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase MGRN1 OS=Homo sapiens OX=9606 GN=MGRN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	491-UNIMOD:510,501-UNIMOD:21,506-UNIMOD:4	0.04	22.0	1	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	151-UNIMOD:510,158-UNIMOD:21,160-UNIMOD:510,163-UNIMOD:510	0.06	22.0	2	2	2
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	203-UNIMOD:510,221-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	223-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	165-UNIMOD:510,176-UNIMOD:21,178-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	239-UNIMOD:510,245-UNIMOD:21,247-UNIMOD:4,248-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|Q14847-3|LASP1_HUMAN	Isoform 3 of LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	41-UNIMOD:510,48-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	61-UNIMOD:510,69-UNIMOD:21,50-UNIMOD:510	0.04	22.0	2	2	2
PRT	sp|Q9ULD2-4|MTUS1_HUMAN	Isoform 4 of Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	330-UNIMOD:510,336-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	2698-UNIMOD:510,2708-UNIMOD:21,2710-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	362-UNIMOD:510,368-UNIMOD:21,378-UNIMOD:510,381-UNIMOD:21,391-UNIMOD:510	0.06	22.0	2	2	2
PRT	sp|P16278-2|BGAL_HUMAN	Isoform 2 of Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	289-UNIMOD:510,295-UNIMOD:4,302-UNIMOD:21	0.04	22.0	1	1	0
PRT	sp|O60291|MGRN1_HUMAN	E3 ubiquitin-protein ligase MGRN1 OS=Homo sapiens OX=9606 GN=MGRN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	513-UNIMOD:510,524-UNIMOD:21,528-UNIMOD:4	0.03	22.0	1	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	21.0	1	1	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	193-UNIMOD:510,207-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	138-UNIMOD:510,143-UNIMOD:4,147-UNIMOD:4,148-UNIMOD:21,150-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	12-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|Q9H910-2|JUPI2_HUMAN	Isoform 2 of Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	52-UNIMOD:510,59-UNIMOD:21,75-UNIMOD:510,81-UNIMOD:21	0.17	21.0	2	2	1
PRT	sp|O75376-3|NCOR1_HUMAN	Isoform 3 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	44-UNIMOD:510,56-UNIMOD:4,63-UNIMOD:21,66-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	109-UNIMOD:510,122-UNIMOD:21,124-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q8IWV7-2|UBR1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR1 OS=Homo sapiens OX=9606 GN=UBR1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	12-UNIMOD:510,21-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	700-UNIMOD:510,715-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|O14497-2|ARI1A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	357-UNIMOD:510,362-UNIMOD:35,363-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9H2U2-4|IPYR2_HUMAN	Isoform 4 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	143-UNIMOD:510,150-UNIMOD:21,154-UNIMOD:510	0.08	21.0	1	1	0
PRT	sp|Q6VN20-2|RBP10_HUMAN	Isoform 2 of Ran-binding protein 10 OS=Homo sapiens OX=9606 GN=RANBP10	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	241-UNIMOD:510,252-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9UHR4|BI2L1_HUMAN	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 OS=Homo sapiens OX=9606 GN=BAIAP2L1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	248-UNIMOD:510,261-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	74-UNIMOD:510,76-UNIMOD:21,80-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|O95456-2|PSMG1_HUMAN	Isoform 2 of Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	156-UNIMOD:510,165-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P53634|CATC_HUMAN	Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	310-UNIMOD:510,321-UNIMOD:4,329-UNIMOD:21,331-UNIMOD:4,332-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q9UJU6-5|DBNL_HUMAN	Isoform 5 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	121-UNIMOD:510,129-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	309-UNIMOD:510,317-UNIMOD:21,320-UNIMOD:510	0.04	21.0	1	1	0
PRT	sp|Q9BY44|EIF2A_HUMAN	Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	506-UNIMOD:510,517-UNIMOD:21	0.03	21.0	1	1	0
PRT	sp|P11137|MTAP2_HUMAN	Microtubule-associated protein 2 OS=Homo sapiens OX=9606 GN=MAP2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	1770-UNIMOD:510,1780-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|Q9BRP1|PDD2L_HUMAN	Programmed cell death protein 2-like OS=Homo sapiens OX=9606 GN=PDCD2L PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	14-UNIMOD:510,20-UNIMOD:21,31-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	55-UNIMOD:510,70-UNIMOD:21,73-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|Q9Y2L1-2|RRP44_HUMAN	Isoform 2 of Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	598-UNIMOD:510,604-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	221-UNIMOD:510,234-UNIMOD:21,236-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	99-UNIMOD:510,100-UNIMOD:21	0.04	20.0	1	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	121-UNIMOD:510,127-UNIMOD:4,135-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	210-UNIMOD:510,211-UNIMOD:4,216-UNIMOD:21,220-UNIMOD:510,223-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	129-UNIMOD:510,139-UNIMOD:21,126-UNIMOD:510,133-UNIMOD:21	0.11	20.0	2	2	2
PRT	sp|Q9BVR0|HRC23_HUMAN	Putative HERC2-like protein 3 OS=Homo sapiens OX=9606 GN=HERC2P3 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	299-UNIMOD:510,310-UNIMOD:4,315-UNIMOD:21,321-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	230-UNIMOD:510,238-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q13685|AAMP_HUMAN	Angio-associated migratory cell protein OS=Homo sapiens OX=9606 GN=AAMP PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	246-UNIMOD:510,248-UNIMOD:21,254-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q8IWE5-2|PKHM2_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family M member 2 OS=Homo sapiens OX=9606 GN=PLEKHM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	249-UNIMOD:510,266-UNIMOD:21,275-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q15154-3|PCM1_HUMAN	Isoform 3 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	59-UNIMOD:510,69-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	1140-UNIMOD:510,1144-UNIMOD:21,1152-UNIMOD:510	0.00	20.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	2146-UNIMOD:510,2155-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	86-UNIMOD:510,87-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9H2M9|RBGPR_HUMAN	Rab3 GTPase-activating protein non-catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	368-UNIMOD:510,372-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	72-UNIMOD:510,81-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q16762|THTR_HUMAN	Thiosulfate sulfurtransferase OS=Homo sapiens OX=9606 GN=TST PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	31-UNIMOD:510,38-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	173-UNIMOD:510,177-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	318-UNIMOD:510,325-UNIMOD:21,328-UNIMOD:510	0.03	20.0	1	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	99-UNIMOD:510,104-UNIMOD:21	0.04	20.0	1	1	0
PRT	sp|Q8NFF5-2|FAD1_HUMAN	Isoform 2 of FAD synthase OS=Homo sapiens OX=9606 GN=FLAD1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	464-UNIMOD:510,464-UNIMOD:4,466-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q9Y673-2|ALG5_HUMAN	Isoform 2 of Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	54-UNIMOD:510,62-UNIMOD:21,65-UNIMOD:510	0.04	19.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	295-UNIMOD:510,305-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	381-UNIMOD:510,385-UNIMOD:21,396-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	36-UNIMOD:510,41-UNIMOD:21	0.09	19.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	436-UNIMOD:510,439-UNIMOD:21,456-UNIMOD:510	0.04	19.0	1	1	1
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	172-UNIMOD:510,181-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	52-UNIMOD:510,58-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q4KMP7|TB10B_HUMAN	TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	135-UNIMOD:510,152-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	240-UNIMOD:510,252-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|P49589-2|SYCC_HUMAN	Isoform 2 of Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	14-UNIMOD:510,19-UNIMOD:21,27-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q6P1L8|RM14_HUMAN	39S ribosomal protein L14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL14 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	40-UNIMOD:510,49-UNIMOD:21	0.10	19.0	1	1	1
PRT	sp|Q04726-2|TLE3_HUMAN	Isoform 2 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	238-UNIMOD:510,244-UNIMOD:510,259-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q14693|LPIN1_HUMAN	Phosphatidate phosphatase LPIN1 OS=Homo sapiens OX=9606 GN=LPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	130-UNIMOD:510,135-UNIMOD:21,145-UNIMOD:21,147-UNIMOD:21,153-UNIMOD:510,154-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P09234|RU1C_HUMAN	U1 small nuclear ribonucleoprotein C OS=Homo sapiens OX=9606 GN=SNRPC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	4-UNIMOD:510,6-UNIMOD:4,9-UNIMOD:4,17-UNIMOD:21,22-UNIMOD:510	0.13	19.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	215-UNIMOD:510,223-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	2061-UNIMOD:510,2073-UNIMOD:21,2077-UNIMOD:21	0.01	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	1	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=3979	41.753	2	2608.0617	2608.0617	R	G	227	255
PSM	YMIGVTYGGDDIPLSPYR	2	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=5267	54.114	2	2129.9957	2129.9957	R	I	1419	1437
PSM	QGAIVAVTGDGVNDSPALK	3	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,15-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3513	38.019	2	1959.0351	1959.0351	R	K	677	696
PSM	SSGSPYGGGYGSGGGSGGYGSR	4	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1736	24.618	2	2023.8121	2023.8121	R	R	333	355
PSM	DNLTLWTSDQQDDDGGEGNN	5	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=4611	47.428	2	2226.9361	2226.9361	R	-	228	248
PSM	QALDYVELSPLTQASPQR	6	sp|Q9H2D6-6|TARA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=4980	50.854	2	2129.0618	2129.0618	R	A	228	246
PSM	LTPSPDIIVLSDNEASSPR	7	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=4792	49.066	2	2124.0564	2124.0564	R	S	119	138
PSM	RILEPDDFLDDLDDEDYEEDTPK	8	sp|Q92785|REQU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,21-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=5802	61.143	3	2944.3063	2944.3063	K	R	156	179
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	9	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=4641	47.729	3	3490.5054	3490.5054	R	-	207	238
PSM	AGGAGVPAFYTPTGYGTLVQEGGSPIK	10	sp|P55809|SCOT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,24-UNIMOD:21,27-UNIMOD:510	ms_run[2]:scan=5150	52.722	3	2742.3942	2742.3942	R	Y	147	174
PSM	TQPDGTSVPGEPASPISQR	11	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2422	29.744	2	2036.9628	2036.9628	R	L	608	627
PSM	YMIGVTYGGDDIPLSPYR	12	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,2-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=4936	50.442	2	2145.9906	2145.9906	R	I	1419	1437
PSM	ASVLDTSMSAGSGSPSK	13	sp|Q9UPQ0-9|LIMC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,14-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=2682	31.685	2	1728.8278	1728.8278	R	T	344	361
PSM	LAVEALSSLDGDLAGR	14	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=5216	53.482	2	1699.8606	1699.8606	K	Y	157	173
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	15	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:510,34-UNIMOD:35,35-UNIMOD:510	ms_run[1]:scan=2254	28.490516666666668	3	4238.624045	4236.619974	K	A	142	177
PSM	AFGPGLQGGSAGSPAR	16	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2368	29.351	2	1542.7404	1542.7404	K	F	1072	1088
PSM	GILAADESTGSIAK	17	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2700	31.821	2	1479.7858	1479.7858	K	R	29	43
PSM	NWTEDMEGGISSPVK	18	sp|P08651-4|NFIC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,12-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3963	41.631	2	1796.8329	1796.8329	R	K	279	294
PSM	SSSPAPADIAQTVQEDLR	19	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5133	52.504	2	1997.9519	1997.9519	K	T	230	248
PSM	LTPSPDIIVLSDNEASSPR	20	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=4792	49.06605833333333	2	2124.052046	2124.056398	R	S	119	138
PSM	FSEGVLQSPSQDQEK	21	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2694	31.777	2	1825.8772	1825.8772	R	L	428	443
PSM	TPEELDDSDFETEDFDVR	22	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4818	49.299	2	2271.9157	2271.9157	R	S	264	282
PSM	CTNSEVTVQPSPYLSYR	23	sp|O75794|CD123_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,1-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=3697	39.52	2	2113.9604	2113.9604	R	L	289	306
PSM	GQEEISGALPVASPASSR	24	sp|Q9UBK8|MTRR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3124	35.025	2	1868.9093	1868.9093	R	T	159	177
PSM	QEQINTEPLEDTVLSPTK	25	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,15-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4280	44.249	2	2189.1141	2189.1141	K	K	271	289
PSM	RQLQEDQENNLQDNQTSNSSPCR	26	sp|Q92576-2|PHF3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,20-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=1235	20.84	3	2874.2412	2874.2412	K	S	1507	1530
PSM	ADLNQGIGEPQSPSR	27	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2097	27.313	2	1681.7885	1681.7885	R	R	63	78
PSM	AQQATPGGAAPTIFSR	28	sp|Q9BX68|HINT2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3293	36.309	2	1685.8351	1685.8351	K	I	43	59
PSM	DDGVFVQEVTQNSPAAR	29	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4085	42.589	2	1945.8995	1945.8995	R	T	29	46
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	30	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,27-UNIMOD:21	ms_run[2]:scan=3235	35.87	3	2965.4395	2965.4395	R	D	374	402
PSM	IYHPSCYEDYQNTSSFDCTPSPSK	31	sp|O94913|PCF11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,6-UNIMOD:4,18-UNIMOD:4,21-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=3186	35.496	3	3030.2725	3030.2725	K	T	1473	1497
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	32	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,25-UNIMOD:21	ms_run[1]:scan=3235	35.869725	3	2965.4292	2965.4392	R	D	374	402
PSM	ETVSEESNVLCLSKSPNK	33	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510,15-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3088	34.755	2	2202.134	2202.1340	R	H	581	599
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	34	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=4248	43.959	3	3461.4719	3461.4719	K	F	86	114
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	35	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2060	27.036	3	2826.1852	2826.1852	R	E	418	442
PSM	NVSSFPDDATSPLQENR	36	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3435	37.42	2	1989.8893	1989.8893	R	N	52	69
PSM	TDSVIIADQTPTPTR	37	sp|P17544-5|ATF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2776	32.39	2	1727.8555	1727.8555	R	F	42	57
PSM	TWTTPEVTSPPPSPR	38	sp|Q7Z6M1-2|RABEK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3309	36.43	2	1765.85	1765.8500	R	T	74	89
PSM	DWEDDSDEDMSNFDR	39	sp|Q15185|TEBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=4281	44.256751666666666	2	1989.6822	1988.6822	K	F	108	123
PSM	DNLTLWTSDQQDDDGGEGNN	40	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=4724	48.436	2	2226.9361	2226.9361	R	-	228	248
PSM	DYTGCSTSESLSPVK	41	sp|O95297-4|MPZL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:4,12-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2658	31.506	2	1777.8118	1777.8118	R	Q	75	90
PSM	EQGPYETYEGSPVSK	42	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2216	28.207	2	1817.8397	1817.8397	K	G	549	564
PSM	EWNGVVSESDSPVK	43	sp|P18858-2|DNLI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2996	34.061	2	1679.808	1679.8080	K	R	41	55
PSM	GISCMNTTLSESPFK	44	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,4-UNIMOD:4,5-UNIMOD:35,12-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3354	36.77	2	1834.8519	1834.8519	K	C	239	254
PSM	NSDVLQSPLDSAARDEL	45	sp|Q8NBJ5|GT251_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4673	47.989	2	1942.9097	1942.9097	K	-	606	623
PSM	RADLNQGIGEPQSPSR	46	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=1539	23.143	2	1837.8896	1837.8896	R	R	62	78
PSM	SGLEELVLSEMNSPSR	47	sp|Q4V328-3|GRAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=5572	58.276	2	1860.8753	1860.8753	R	T	533	549
PSM	APVQPQQSPAAAPGGTDEKPSGK	48	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,8-UNIMOD:21,19-UNIMOD:510,23-UNIMOD:510	ms_run[2]:scan=1119	19.951	3	2399.2583	2399.2583	K	E	9	32
PSM	DGLNDDDFEPYLSPQAR	49	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4949	50.561	2	2064.889	2064.8890	K	P	27	44
PSM	ELPSLSPAPDTGLSPSK	50	sp|Q9UBF8-2|PI4KB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,14-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4234	43.85	2	1842.9652	1842.9652	R	R	253	270
PSM	FNEEHIPDSPFVVPVASPSGDAR	51	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4522	46.622	3	2580.211	2580.2110	K	R	2303	2326
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	52	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:510,22-UNIMOD:21	ms_run[1]:scan=3235	35.869725	3	2965.429076	2965.439498	R	D	374	402
PSM	ELISNASDALDK	53	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2677	31.648	2	1342.7616	1342.7616	R	I	42	54
PSM	ELSDQATASPIVAR	54	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2331	29.069	2	1570.7816	1570.7816	K	T	63	77
PSM	GTDTQTPAVLSPSK	55	sp|P46087-2|NOP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1974	26.398	2	1548.8073	1548.8073	K	T	718	732
PSM	KEESEESDDDMGFGLFD	56	sp|P05386-2|RLA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4332	44.787	2	2032.8732	2032.8732	K	-	73	90
PSM	ATAPQTQHVSPMR	57	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=772	17.11764666666667	2	1552.7241	1552.7276	R	Q	124	137
PSM	VDSSTNSSPSPQQSESLSPAHTSDFR	58	sp|Q9BQE9|BCL7B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=2343	29.159868333333335	3	2861.2462	2861.2562	K	T	105	131
PSM	TSSESIISVPASSTSGSPSR	59	sp|Q6H8Q1|ABLM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[1]:scan=3082	34.70845666666666	2	2049.961615	2049.967977	R	V	278	298
PSM	DLADELALVDVIEDK	60	sp|P00338-5|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6217	67.963	2	1724.972	1724.9720	K	L	43	58
PSM	EYIPGQPPLSQSSDSSPTR	61	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3196	35.57	2	2158.9996	2158.9996	K	N	871	890
PSM	NQYDNDVTVWSPQGR	62	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3482	37.781	2	1891.8314	1891.8314	R	I	4	19
PSM	VDSSTNSSPSPQQSESLSPAHTSDFR	63	sp|Q9BQE9-2|BCL7B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2343	29.16	3	2861.2565	2861.2565	K	T	45	71
PSM	TSSESIISVPASSTSGSPSR	64	sp|Q6H8Q1|ABLM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,19-UNIMOD:21	ms_run[1]:scan=3082	34.70845666666666	2	2049.9611	2049.9675	R	V	278	298
PSM	TVIIEQSWGSPK	65	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=3804	40.36824333333333	2	1491.798996	1491.801081	R	V	61	73
PSM	GQEEISGALPVASPASSR	66	sp|Q9UBK8|MTRR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[1]:scan=3124	35.02536	2	1868.904432	1868.909340	R	T	159	177
PSM	EGHALGGGMEADGPASLQELPPSPR	67	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,23-UNIMOD:21	ms_run[2]:scan=3692	39.482	3	2586.1998	2586.1998	R	S	6	31
PSM	HTPNTSDNEGSDTEVCGPNSPSK	68	sp|Q8NEN9|PDZD8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,16-UNIMOD:4,20-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=1063	19.518	3	2577.0963	2577.0963	K	R	970	993
PSM	IDEPSTPYHSMMGDDEDACSDTEATEAMAPDILAR	69	sp|P41236|IPP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=5151	52.73	3	3954.6041	3954.6041	K	K	68	103
PSM	QASTDAGTAGALTPQHVR	70	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=1362	21.803	3	1893.9158	1893.9158	R	A	107	125
PSM	RIDFIPVSPAPSPTR	71	sp|Q96E09|PBIR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=4596	47.312	2	1845.9004	1845.9004	K	G	136	151
PSM	TVDSQGPTPVCTPTFLER	72	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=4181	43.388	2	2117.9917	2117.9917	K	R	227	245
PSM	TVIIEQSWGSPK	73	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3804	40.368	2	1491.8011	1491.8011	R	V	61	73
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	74	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=2995	34.053015	3	3225.2262	3223.2302	K	-	122	148
PSM	HTPNTSDNEGSDTEVCGPNSPSK	75	sp|Q8NEN9|PDZD8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,16-UNIMOD:4,22-UNIMOD:21,23-UNIMOD:510	ms_run[1]:scan=1063	19.517713333333333	3	2577.088889	2577.096290	K	R	970	993
PSM	AGGSPAPGPETPAISPSK	76	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2075	27.15	2	1847.8744	1847.8744	K	R	85	103
PSM	CELLSDDSLAVSSPR	77	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=4027	42.147	2	1761.8068	1761.8068	K	L	292	307
PSM	DFQDYMEPEEGCQGSPQR	78	sp|O43237-2|DC1L2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=4233	43.842	2	2285.8819	2285.8819	K	R	103	121
PSM	EFVSISSPAHVAT	79	sp|P22681|CBL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3651	39.169	2	1457.7016	1457.7016	R	-	894	907
PSM	ELASPVSPELR	80	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3166	35.344	2	1310.6695	1310.6696	K	Q	175	186
PSM	FSSSIENSDSPVR	81	sp|O95425-2|SVIL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2006	26.64	2	1537.6874	1537.6874	K	S	485	498
PSM	GFPTIYFSPANK	82	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4868	49.782	2	1488.7691	1488.7691	R	K	449	461
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	83	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4083	42.574	3	3090.3451	3090.3451	K	E	120	146
PSM	NAEAVLQSPGLSGK	84	sp|Q13045-2|FLII_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2782	32.435	2	1517.8127	1517.8127	R	V	794	808
PSM	NNAYLAQSPQLYK	85	sp|P14868-2|SYDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3188	35.51	2	1656.8549	1656.8549	K	Q	142	155
PSM	SYELPDGQVITIGNER	86	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4714	48.357	2	1823.9478	1823.9478	K	F	239	255
PSM	TAFQEALDAAGDK	87	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3201	35.608	2	1403.7569	1403.7569	K	L	9	22
PSM	YLLGDAPVSPSSQK	88	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3349	36.733	2	1608.8437	1608.8437	K	L	195	209
PSM	STGCDFAVSPK	89	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,4-UNIMOD:4,9-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2107	27.387125	2	1315.614644	1315.615589	K	L	501	512
PSM	IDEPSTPYHSMMGDDEDACSDTEATEAMAPDILAR	90	sp|P41236|IPP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,8-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=5151	52.72984833333333	3	3954.5852	3954.6032	K	K	68	103
PSM	GSSGENNNPGSPTVSNFR	91	sp|Q99576-3|T22D3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=1942	26.153266666666667	2	1934.8342	1933.8372	R	Q	32	50
PSM	SATSSSPGSPLHSLETSL	92	sp|P20020|AT2B1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=4874	49.846576666666664	2	1870.8748	1870.8768	K	-	1203	1221
PSM	SESVEGFLSPSR	93	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=3740	39.86591166666666	2	1407.6484	1407.6490	R	C	1311	1323
PSM	TDSVIIADQTPTPTR	94	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=2776	32.389934999999994	2	1727.852320	1727.855513	R	F	42	57
PSM	AGGLDWPEATEVSPSR	95	sp|Q9Y446|PKP3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4193	43.495	2	1784.8195	1784.8195	R	T	226	242
PSM	ARVDHGAEIITQSPGR	96	sp|P11137-2|MTAP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=1401	22.097	3	1819.9154	1819.9154	K	S	414	430
PSM	EDFDSLLQSAK	97	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4519	46.585	2	1399.6909	1399.6909	K	K	187	198
PSM	EGPYSISVLYGDEEVPRSPFK	98	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,18-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=5005	51.1	3	2516.2513	2516.2513	R	V	1516	1537
PSM	GFSQYGVSGSPTK	99	sp|Q9NXC5|MIO_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2524	30.5	2	1461.7177	1461.7177	R	S	757	770
PSM	GPPQSPVFEGVYNNSR	100	sp|Q8WWM7-6|ATX2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3564	38.435	2	1860.862	1860.8620	K	M	107	123
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	101	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=1763	24.823	3	2863.2161	2863.2161	K	M	445	470
PSM	NDSVIVADQTPTPTR	102	sp|P15336-3|ATF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2289	28.751	2	1726.8351	1726.8351	R	F	60	75
PSM	NLEQILNGGESPK	103	sp|Q13033-2|STRN3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4359	45.076	2	1545.8076	1545.8076	K	Q	219	232
PSM	RPTPNDDTLDEGVGLVHSNIATEHIPSPAK	104	sp|Q01581|HMCS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	ms_run[2]:scan=4026	42.139	4	3327.6773	3327.6773	R	K	469	499
PSM	SAMPFTASPASSTTAR	105	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2999	34.083	2	1695.7752	1695.7752	R	V	123	139
PSM	TSSESIISVPASSTSGSPSR	106	sp|Q6H8Q1-4|ABLM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=3082	34.708	2	2049.968	2049.9680	R	V	35	55
PSM	TVIIEQSWGSPK	107	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3930	41.373	2	1491.8011	1491.8011	R	V	61	73
PSM	YSPTSPTYSPTSPK	108	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2593	31.014	2	1739.7733	1739.7733	K	Y	1909	1923
PSM	TTLPQDCSNPAPLSSPLNGVHDR	109	sp|P16278|BGAL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,7-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=3368	36.87616166666666	3	2589.2044	2589.2102	R	A	420	443
PSM	GTDTQTPAVLSPSK	110	sp|P46087|NOP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,13-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=1974	26.39833333333333	2	1548.805477	1548.807289	K	T	722	736
PSM	AEEDEILNRSPR	111	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1768	24.861	2	1541.7299	1541.7299	K	N	466	478
PSM	DGVLTLANNVTPAK	112	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3813	40.453	2	1559.8597	1559.8597	K	D	561	575
PSM	EGLELPEDEEEK	113	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2781	32.428	2	1483.7566	1483.7566	K	K	539	551
PSM	ELPESGIQLGTPR	114	sp|Q9UI10-3|EI2BD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3668	39.298	2	1509.7652	1509.7652	R	E	75	88
PSM	EVYELLDSPGK	115	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3750	39.944	2	1396.7163	1396.7163	K	V	20	31
PSM	GRGPSPEGSSSTESSPEHPPK	116	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,15-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=781	17.191	3	2254.054	2254.0540	K	S	1644	1665
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	117	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,26-UNIMOD:510	ms_run[2]:scan=3672	39.328	3	3010.3787	3010.3787	K	E	120	146
PSM	LEDGQTADGQTEEAAEPGEQLQTQK	118	sp|Q96G46-2|DUS3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,23-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=2320	28.983	3	2820.2975	2820.2975	R	R	77	102
PSM	NPSDSAVHSPFTK	119	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1493	22.798	2	1533.7501	1533.7501	K	R	401	414
PSM	SESVEGFLSPSR	120	sp|Q08AD1-2|CAMP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3755	39.98	2	1407.6495	1407.6495	R	C	1284	1296
PSM	SPDLAPTPAPQSTPR	121	sp|Q9BY44-2|EIF2A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=1985	26.482	2	1647.8082	1647.8082	K	N	292	307
PSM	GSGIFDESTPVQTR	122	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=3083	34.716186666666665	2	1606.7423	1606.7447	K	Q	68	82
PSM	SVVGTPAYLAPEVLR	123	sp|O94806|KPCD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=5737	60.255648333333326	2	1844.8312	1844.8335	R	S	735	750
PSM	YSPTSPTYSPTSPVYTPTSPK	124	sp|P24928|RPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:21,19-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=4422	45.694028333333335	2	2565.0922	2565.1042	K	Y	1888	1909
PSM	AALVAQNYINYQQGTPHR	125	sp|Q9BS40|LXN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3273	36.159	3	2157.0581	2157.0581	R	V	13	31
PSM	ATAPQTQHVSPMR	126	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1062	19.511	2	1536.7332	1536.7332	R	Q	100	113
PSM	DFLLQQTMLR	127	sp|Q04760-2|LGUL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=5198	53.295	2	1377.694	1377.6940	K	V	29	39
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	128	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,22-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=4578	47.162	3	2949.2212	2949.2212	K	T	701	725
PSM	DGTAGSHFMASPQCVGYSR	129	sp|Q9H488|OFUT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=2969	33.856	3	2140.892	2140.8920	K	S	254	273
PSM	DNSDFDLLTVSETANEPPQDEGNSFNSPR	130	sp|O15371-2|EIF3D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,27-UNIMOD:21	ms_run[2]:scan=5538	57.882	3	3308.4207	3308.4207	R	N	233	262
PSM	EAYSGCSGPVDSECPPPPSSPVHK	131	sp|Q8N556|AFAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:4,20-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=1964	26.321	3	2688.1874	2688.1874	K	A	246	270
PSM	EITALAPSTMK	132	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2940	33.638	2	1308.7037	1308.7037	K	I	316	327
PSM	ETDSLSDEVTHNSNQNNSNCSSPSR	133	sp|Q96RT1-7|ERBIN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,20-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=1759	24.793	3	2892.1678	2892.1678	K	M	639	664
PSM	ETIDNNSVSSPLQSLQQR	134	sp|P60228|EIF3E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3798	40.322	2	2129.0214	2129.0214	K	T	194	212
PSM	FNDEHIPESPYLVPVIAPSDDAR	135	sp|O75369-7|FLNB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4927	50.373	3	2694.2791	2694.2791	K	R	2086	2109
PSM	GHLSRPEAQSLSPYTTSANR	136	sp|O94776-2|MTA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2003	26.618	3	2285.1014	2285.1014	R	A	251	271
PSM	LDDDDEGVPSSALR	137	sp|Q00535-2|CDK5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2826	32.768	2	1601.7034	1601.7034	R	E	37	51
PSM	QEQINTEPLEDTVLSPTKK	138	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,15-UNIMOD:21,18-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3765	40.058	3	2351.2722	2351.2722	K	R	271	290
PSM	QGSEIQDSPDFR	139	sp|Q8WX93-6|PALLD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2139	27.632	2	1491.6455	1491.6455	R	I	477	489
PSM	RADLNQGIGEPQSPSRR	140	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:21	ms_run[2]:scan=1190	20.498	3	1959.9276	1959.9276	R	V	62	79
PSM	SAPASPTHPGLMSPR	141	sp|P85037-2|FOXK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=2241	28.394	2	1698.7414	1698.7414	R	S	253	268
PSM	SETAPAAPAAPAPAEKTPVK	142	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,16-UNIMOD:510,17-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=1511	22.937	3	2085.1608	2085.1608	M	K	2	22
PSM	SPLAQDSPSQGSPALYR	143	sp|Q69YH5|CDCA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2705	31.858	2	1886.8988	1886.8988	K	N	120	137
PSM	VEEQEPELTSTPNFVVEVIK	144	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5482	57.092	3	2434.2557	2434.2557	K	N	155	175
PSM	YLSVPPSPNISTSESR	145	sp|Q9BTC0-1|DIDO1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3108	34.906	2	1846.8926	1846.8926	R	S	1024	1040
PSM	YRDVAECGPQQELDLNSPR	146	sp|Q9BTE3-2|MCMBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=3013	34.192	3	2360.068	2360.0680	K	N	102	121
PSM	HSTPSNSSNPSGPPSPNSPHR	147	sp|Q9Y5S2|MRCKB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[1]:scan=722	16.484181666666665	3	2253.9918	2253.9971	K	S	1676	1697
PSM	ESVPEFPLSPPK	148	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=4487	46.252889999999994	2	1473.7784	1473.7788	K	K	30	42
PSM	SESVEGFLSPSR	149	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=3745	39.903835	2	1407.648918	1407.649543	R	C	1311	1323
PSM	YLLGDAPVSPSSQK	150	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=3349	36.73285333333333	2	1608.841873	1608.843674	K	L	195	209
PSM	AASIENVLQDSSPEHCGR	151	sp|O60291-4|MGRN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=3240	35.909	3	2082.9254	2082.9254	R	G	491	509
PSM	ADLINNLGTIAK	152	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4176	43.351	2	1389.7905	1389.7905	K	S	96	108
PSM	ADLNQGIGEPQSPSRR	153	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=1665	24.088	3	1837.8896	1837.8896	R	V	63	79
PSM	AGDLLEDSPKRPK	154	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=1318	21.464	2	1606.918	1606.9180	R	E	151	164
PSM	DATNVGDEGGFAPNILENK	155	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4423	45.702	2	2028.0436	2028.0436	K	E	203	222
PSM	DDGVFVQEVTQNSPAAR	156	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4079	42.542	3	1945.8995	1945.8995	R	T	29	46
PSM	DNLTLWTSDQQDDDGGEGNN	157	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4901	50.08	2	2226.9361	2226.9361	R	-	228	248
PSM	EALQDVEDENQ	158	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2096	27.306	2	1322.605	1322.6050	K	-	223	234
PSM	GAVDGGLSIPHSTK	159	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2243	28.409	2	1485.7865	1485.7865	K	R	165	179
PSM	GDTVSASPCSAPLAR	160	sp|Q15477|SKIV2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2071	27.119	2	1601.7333	1601.7333	R	A	239	254
PSM	GFSVVADTPELQR	161	sp|Q14847-3|LASP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3627	38.985	2	1531.7496	1531.7496	K	I	41	54
PSM	ITPSYVAFTPEGER	162	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3841	40.663	2	1679.802	1679.8020	R	L	61	75
PSM	NSGSFPSPSISPR	163	sp|Q9ULD2-4|MTUS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2816	32.692	2	1445.6764	1445.6764	R	-	330	343
PSM	SESVEGFLSPSR	164	sp|Q08AD1-2|CAMP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3745	39.904	2	1407.6495	1407.6495	R	C	1284	1296
PSM	SGSLDSELSVSPK	165	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2924	33.512	2	1452.7385	1452.7385	K	R	2698	2711
PSM	TQTPPVSPAPQPTEER	166	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1603	23.623	2	1847.8879	1847.8879	K	L	362	378
PSM	TTLPQDCSNPAPLSSPLNGVHDR	167	sp|P16278-2|BGAL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=3368	36.876	3	2589.2107	2589.2107	R	A	289	312
PSM	YGGPYHIGGSPFK	168	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3145	35.185	2	1526.7595	1526.7596	K	A	2493	2506
PSM	YSPTSPTYSPTSPVYTPTSPK	169	sp|P24928|RPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,11-UNIMOD:21,19-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=4422	45.694	2	2565.1043	2565.1043	K	Y	1888	1909
PSM	YSPTSPTYSPTTPK	170	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2633	31.317	2	1753.7889	1753.7889	K	Y	1874	1888
PSM	VEIIANDQGNR	171	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510	ms_run[1]:scan=1518	22.990058333333334	2	1261.6826	1261.6834	R	I	50	61
PSM	AASIENVLQDSSPEHCGR	172	sp|O60291|MGRN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,12-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=3240	35.909081666666665	3	2082.9221	2082.9249	R	G	513	531
PSM	GFSQYGVSGSPTK	173	sp|Q9NXC5|MIO_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=2524	30.500396666666667	2	1461.7155	1461.7172	R	S	757	770
PSM	GSSGENNNPGSPTVSNFR	174	sp|Q99576-3|T22D3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[1]:scan=1942	26.153266666666667	2	1934.835249	1933.837966	R	Q	32	50
PSM	AFLAELEQNSPK	175	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4062	42.413	2	1493.7803	1493.7803	K	I	2424	2436
PSM	AGDLLEDSPK	176	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2127	27.539	2	1191.6061	1191.6061	R	R	151	161
PSM	DFQEYVEPGEDFPASPQRR	177	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=4316	44.662	2	2380.0585	2380.0585	R	N	193	212
PSM	EGHALGGGMEADGPASLQELPPSPR	178	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:35,23-UNIMOD:21	ms_run[2]:scan=3405	37.162	3	2602.1947	2602.1947	R	S	6	31
PSM	EGHALGGGMEADGPASLQELPPSPR	179	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,23-UNIMOD:21	ms_run[2]:scan=3947	41.508	3	2586.1998	2586.1998	R	S	6	31
PSM	GDLNDCFIPCTPK	180	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3937	41.427	2	1683.7674	1683.7674	R	G	138	151
PSM	GEAAAERPGEAAVASSPSK	181	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,16-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=1034	19.295	3	1931.9626	1931.9626	K	A	12	31
PSM	GSGIFDESTPVQTR	182	sp|Q9H910-2|JUPI2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3083	34.716	2	1606.7452	1606.7452	K	Q	52	66
PSM	GYISPYFINTSK	183	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4546	46.855	2	1536.7902	1536.7902	R	G	222	234
PSM	HEAPSSPISGQPCGDDQNASPSK	184	sp|O75376-3|NCOR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:4,20-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=1392	22.027	3	2513.1166	2513.1166	K	L	44	67
PSM	KYEQGFITDPVVLSPK	185	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,14-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4186	43.439	3	2002.1277	2002.1277	K	D	109	125
PSM	MEISAELPQTPQR	186	sp|Q8IWV7-2|UBR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3507	37.971	2	1612.7744	1612.7744	R	L	12	25
PSM	RISHSLYSGIEGLDESPSR	187	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3327	36.565	3	2216.0687	2216.0687	R	N	700	719
PSM	SGTSSPQSPVFR	188	sp|Q8N556|AFAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=1727	24.55	2	1362.6393	1362.6393	K	H	661	673
PSM	SHHAPMSPGSSGGGGQPLAR	189	sp|O14497-2|ARI1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=778	17.167	3	2016.9049	2016.9049	R	T	357	377
PSM	SLVESVSSSPNK	190	sp|Q9H2U2-4|IPYR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1829	25.306	2	1380.7174	1380.7174	R	E	143	155
PSM	SQDSYPGSPSLSPR	191	sp|Q6VN20-2|RBP10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2299	28.826	2	1590.7139	1590.7139	K	H	241	255
PSM	SVVGTPAYLAPEVLR	192	sp|O94806|KPCD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=5652	59.175	2	1844.834	1844.8340	R	S	735	750
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	193	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:35	ms_run[2]:scan=4221	43.75	3	3506.5004	3506.5004	R	-	207	238
PSM	TPASTPVSGTPQASPMIER	194	sp|Q9UHR4|BI2L1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2582	30.933	2	2039.9811	2039.9811	K	S	248	267
PSM	TQSPGGCSAEAVLAR	195	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2505	30.355	2	1616.7442	1616.7442	R	K	74	89
PSM	TSESTGSLPSPFLR	196	sp|O95456-2|PSMG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=4127	42.963	2	1591.7707	1591.7707	K	A	156	170
PSM	YAQDFGLVEEACFPYTGTDSPCK	197	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:4,20-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:510	ms_run[2]:scan=5411	56.116	3	2802.2231	2802.2231	K	M	310	333
PSM	YGGDEIPFSPYR	198	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4229	43.811	2	1513.6703	1513.6703	K	V	1622	1634
PSM	YQEQGGEASPQRTWEQQQEVVSR	199	sp|Q9UJU6-5|DBNL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2834	32.829	3	2833.2881	2833.2881	R	N	121	144
PSM	EYIPGQPPLSQSSDSSPTRNSEPAGLETPEAK	200	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,16-UNIMOD:21,32-UNIMOD:510	ms_run[1]:scan=3731	39.78226333333333	3	3516.6802	3516.6932	K	V	871	903
PSM	EQGPYETYEGSPVSK	201	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3099	34.83627166666667	2	1817.8262	1817.8392	K	G	549	564
PSM	SLVESVSSSPNK	202	sp|Q9H2U2|IPYR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=1829	25.305568333333333	2	1380.7140	1380.7169	R	E	309	321
PSM	SPDLAPTPAPQSTPR	203	sp|Q9BY44|EIF2A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[1]:scan=1985	26.481523333333335	2	1647.805770	1647.808169	K	N	506	521
PSM	ARVDHGAEIITQSPGR	204	sp|P11137|MTAP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=1401	22.096556666666665	3	1819.913000	1819.915428	K	S	1770	1786
PSM	AFGPGLQGGSAGSPAR	205	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	13-UNIMOD:21	ms_run[2]:scan=2293	28.781	2	1508.6773	1508.6773	K	F	1072	1088
PSM	DAPVHGSPTGPGAWTASK	206	sp|Q9BRP1|PDD2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2515	30.432	3	1882.9251	1882.9251	R	L	14	32
PSM	DELHIVEAEAMNYEGSPIK	207	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,16-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=5206	53.387	3	2292.1021	2292.1022	K	V	55	74
PSM	GALTLSSPEVR	208	sp|Q9Y2L1-2|RRP44_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2811	32.655	2	1242.6433	1242.6433	K	F	598	609
PSM	GEPNVSYICSR	209	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2280	28.685	2	1394.6114	1394.6114	R	Y	210	221
PSM	GPPSPPAPVMHSPSRK	210	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,14-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1320	21.479	3	1788.9383	1788.9383	R	M	221	237
PSM	HTGPNSPDTANDGFVR	211	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=1488	22.761	3	1797.7896	1797.7896	K	L	99	115
PSM	HYAHTDCPGHADYVK	212	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:4,15-UNIMOD:510	ms_run[2]:scan=967	18.779	4	1837.8842	1837.8842	R	N	121	136
PSM	ICEPGYSPTYKQDK	213	sp|P07858|CATB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:4,7-UNIMOD:21,11-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=1820	25.237	3	1866.9324	1866.9324	K	H	210	224
PSM	IEDVTPIPSDSTR	214	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2803	32.594	2	1542.7391	1542.7391	R	R	129	142
PSM	IGNEESDLEEACILPHSPINVDK	215	sp|Q9BVR0|HRC23_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,12-UNIMOD:4,17-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=4536	46.774	3	2726.3147	2726.3147	K	R	299	322
PSM	IGRIEDVTPIPSDSTR	216	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2732	32.061	3	1868.9457	1868.9457	K	R	126	142
PSM	LAIQGPEDSPSR	217	sp|Q15773|MLF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2260	28.537	2	1382.6655	1382.6655	R	Q	230	242
PSM	LPSSPVYEDAASFK	218	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3931	41.38	2	1657.8277	1657.8277	R	A	378	392
PSM	NWTEDMEGGISSPVK	219	sp|P08651-4|NFIC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2896	33.301	3	1812.8278	1812.8278	R	K	279	294
PSM	QGSPIHVLK	220	sp|Q13685|AAMP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=1623	23.774	2	1125.6584	1125.6584	K	G	246	255
PSM	QNPFNEEPAETVSSSDTTPVHTTSQEK	221	sp|Q8IWE5-2|PKHM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,18-UNIMOD:21,27-UNIMOD:510	ms_run[2]:scan=2805	32.608	3	3107.4245	3107.4245	R	E	249	276
PSM	RVTNDISPESSPGVGR	222	sp|Q15154-3|PCM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1466	22.597	3	1783.8678	1783.8678	K	R	59	75
PSM	SGLEELVLSEMNSPSR	223	sp|Q4V328-3|GRAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=5586	58.39	3	1860.8753	1860.8753	R	T	533	549
PSM	SPFNSPSPQDSPR	224	sp|P08651-4|NFIC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1791	25.02	2	1528.6772	1528.6772	K	L	300	313
PSM	SSSPAPADIAQTVQEDLR	225	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=5140	52.6	3	1997.9519	1997.9519	K	T	230	248
PSM	SVFGTPTLETANK	226	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3528	38.131	2	1511.7909	1511.7909	K	N	1140	1153
PSM	TDGFAEAIHSPQVAGVPR	227	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3594	38.703	3	1964.957	1964.9570	R	F	2146	2164
PSM	TTPSVVAFTADGER	228	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3839	40.649	2	1563.7394	1563.7394	R	L	86	100
PSM	VEPATPLAVR	229	sp|Q9H2M9|RBGPR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2163	27.813	2	1165.632	1165.6320	K	F	368	378
PSM	VFDLQFSTDSPR	230	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=4592	47.282	2	1524.7074	1524.7074	R	L	72	84
PSM	VIGSGCNLDSAR	231	sp|P00338-5|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1365	21.826	2	1281.656	1281.6560	R	F	158	170
PSM	VLDASWYSPGTR	232	sp|Q16762|THTR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3787	40.24	2	1464.6863	1464.6863	R	E	31	43
PSM	VQHASPAGTYAHTVNR	233	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1069	19.562	3	1821.8736	1821.8736	R	N	173	189
PSM	EITALAPSTMK	234	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2940	33.63775666666667	2	1308.702839	1308.703675	K	I	318	329
PSM	SSSPAPADIAQTVQEDLR	235	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=5140	52.59987333333333	3	1997.9508	1997.9514	K	T	230	248
PSM	HTGPNSPDTANDGFVR	236	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=1488	22.76052166666667	3	1797.7879	1797.7890	K	L	99	115
PSM	DGTAGSHFMASPQCVGYSR	237	sp|Q9H488|OFUT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,9-UNIMOD:35,11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=2251	28.467645	3	2157.8862	2156.8862	K	S	254	273
PSM	ADLLLSTQPGREEGSPLELER	238	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=4373	45.212	3	2423.2158	2423.2158	K	L	492	513
PSM	ATAPQTQHVSPMRQVEPPAK	239	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=1726	24.542	3	2320.2035	2320.2035	R	K	100	120
PSM	CLSPGGHPTYRPAYLLENEEEER	240	sp|Q8NFF5-2|FAD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=3553	38.35	4	2830.2846	2830.2846	K	N	464	487
PSM	DIDISSPEFK	241	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4029	42.163	2	1297.6479	1297.6479	K	I	172	182
PSM	DNLTLWTSDQQDDDGGEGNN	242	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4517	46.569	2	2192.873	2192.8730	R	-	228	248
PSM	EGHALGGGMEADGPASLQELPPSPR	243	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:35,23-UNIMOD:21	ms_run[2]:scan=3182	35.465	3	2602.1947	2602.1947	R	S	6	31
PSM	EGHALGGGMEADGPASLQELPPSPR	244	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,23-UNIMOD:21	ms_run[2]:scan=3818	40.491	3	2586.1998	2586.1998	R	S	6	31
PSM	EQVANSAFVER	245	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1711	24.43	2	1282.673	1282.6730	K	V	492	503
PSM	ETLPSIWDSPTK	246	sp|Q9Y673-2|ALG5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4447	45.892	2	1520.78	1520.7800	K	Q	54	66
PSM	GDLGIEIPAEK	247	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3492	37.859	2	1208.7289	1208.7289	R	V	295	306
PSM	GGLNTPLHESDFSGVTPQR	248	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=3559	38.396	3	2204.9717	2204.9717	K	Q	381	400
PSM	GNVVPSPLPTRR	249	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2029	26.808	2	1405.7655	1405.7655	R	T	36	48
PSM	LGGSPTSLGTWGSWIGPDHDK	250	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=5220	53.516	3	2315.126	2315.1260	K	F	436	457
PSM	SFSLASSSNSPISQR	251	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3132	35.087	2	1680.7932	1680.7932	R	R	172	187
PSM	SIRPGLSPYR	252	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2024	26.774	2	1258.6647	1258.6647	R	A	52	62
PSM	STGCDFAVSPK	253	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:4,9-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2072	27.126	2	1315.6156	1315.6156	K	L	501	512
PSM	TEEARPSPAPGPGTPTGTPTR	254	sp|Q4KMP7|TB10B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=1221	20.736	3	2190.053	2190.0530	K	T	135	156
PSM	THSTSSSLGSGESPFSR	255	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=1688	24.258	3	1836.8104	1836.8104	R	S	240	257
PSM	TSDIFGSPVTATSR	256	sp|Q9H910-2|JUPI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3547	38.292	2	1551.7394	1551.7394	K	L	75	89
PSM	VQPQWSPPAGTQPCR	257	sp|P49589-2|SYCC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=2993	34.037	2	1821.8446	1821.8446	R	L	14	29
PSM	VVDNSALGNSPYHR	258	sp|Q6P1L8|RM14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1507	22.907	3	1641.7725	1641.7725	R	A	40	54
PSM	YDSDGDKSDDLVVDVSNEDPATPR	259	sp|Q04726-2|TLE3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:510,22-UNIMOD:21	ms_run[2]:scan=3699	39.536	3	2756.2338	2756.2338	R	V	238	262
PSM	GLDPSTPAQVIAPSETPSSSSVVKK	260	sp|Q14693|LPIN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:21,24-UNIMOD:510,25-UNIMOD:510	ms_run[1]:scan=3926	41.34075	3	2823.3795	2823.3841	R	R	130	155
PSM	FYCDYCDTYLTHDSPSVRK	261	sp|P09234|RU1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:4,6-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=3106	34.890678333333334	3	2574.1172	2574.1228	K	T	4	23
PSM	ESVPEFPLSPPK	262	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=4376	45.236048333333336	2	1473.7784	1473.7788	K	K	30	42
PSM	LSSWDQAETPGHTPSLR	263	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=3034	34.34476333333333	3	1996.9352	1994.9302	K	W	215	232
PSM	QEAEDLSLSAPSSPEISPQSSPRPHRPNNDR	264	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,13-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=2755	32.230635	4	3591.6072	3591.6202	R	L	2061	2092
PSM	GDTVSASPCSAPLAR	265	sp|Q15477|SKIV2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,9-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=2071	27.11909166666667	2	1601.730634	1601.733290	R	A	239	254