MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100726_001AMP-activated-protein-kinase.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100726_001AMP-activated-protein-kinase.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	null	228-UNIMOD:510	0.09	45.0	5	1	0
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	null	321-UNIMOD:510,323-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|P25054-2|APC_HUMAN	Isoform 2 of Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	1758-UNIMOD:510,1760-UNIMOD:21,1286-UNIMOD:510,1286-UNIMOD:4,1288-UNIMOD:21	0.01	42.0	2	2	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	239-UNIMOD:510,19-UNIMOD:510,197-UNIMOD:510,360-UNIMOD:510	0.14	41.0	4	4	4
PRT	sp|O60664-2|PLIN3_HUMAN	Isoform 2 of Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	31-UNIMOD:510,33-UNIMOD:21	0.07	40.0	1	1	1
PRT	sp|Q9Y4E1-5|WAC2C_HUMAN	Isoform 5 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	452-UNIMOD:510,454-UNIMOD:21,468-UNIMOD:510	0.01	39.0	2	1	0
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	610-UNIMOD:510,612-UNIMOD:21,625-UNIMOD:510,609-UNIMOD:510	0.02	38.0	2	2	0
PRT	sp|Q15021|CND1_HUMAN	Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	1325-UNIMOD:510,1333-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|Q96PC5-6|MIA2_HUMAN	Isoform 5 of Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	99-UNIMOD:510,101-UNIMOD:21,109-UNIMOD:4,112-UNIMOD:510	0.02	36.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	null	716-UNIMOD:510,717-UNIMOD:21,731-UNIMOD:510,715-UNIMOD:510,719-UNIMOD:21	0.02	35.0	2	2	0
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,36-UNIMOD:21,37-UNIMOD:21	0.04	34.0	4	1	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	4-UNIMOD:510,6-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q16513-5|PKN2_HUMAN	Isoform 5 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	255-UNIMOD:510,257-UNIMOD:21,613-UNIMOD:510,632-UNIMOD:21	0.06	33.0	2	2	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	871-UNIMOD:510,885-UNIMOD:21,886-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|Q8WUI4-10|HDAC7_HUMAN	Isoform 10 of Histone deacetylase 7 OS=Homo sapiens OX=9606 GN=HDAC7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	64-UNIMOD:510,67-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	41-UNIMOD:510,48-UNIMOD:21,60-UNIMOD:510,113-UNIMOD:510	0.07	33.0	2	2	2
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	35-UNIMOD:510,37-UNIMOD:21,49-UNIMOD:510,36-UNIMOD:35	0.04	33.0	2	1	0
PRT	sp|Q15185-4|TEBP_HUMAN	Isoform 4 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	108-UNIMOD:510,113-UNIMOD:21,117-UNIMOD:35	0.12	32.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	2207-UNIMOD:510,2215-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	32.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	230-UNIMOD:510,232-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	392-UNIMOD:510,394-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	204-UNIMOD:510,206-UNIMOD:21,210-UNIMOD:35,215-UNIMOD:35,182-UNIMOD:510,184-UNIMOD:21,192-UNIMOD:510	0.12	31.0	5	2	1
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	41-UNIMOD:510,43-UNIMOD:21,48-UNIMOD:4,52-UNIMOD:4,56-UNIMOD:510	0.03	31.0	1	1	1
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	9-UNIMOD:510,14-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	99-UNIMOD:510,109-UNIMOD:35,105-UNIMOD:21,102-UNIMOD:21	0.16	31.0	7	1	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	120-UNIMOD:510,138-UNIMOD:21,145-UNIMOD:510,123-UNIMOD:21	0.11	31.0	3	1	0
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	31.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	439-UNIMOD:510,442-UNIMOD:21,456-UNIMOD:510,103-UNIMOD:510,104-UNIMOD:21,114-UNIMOD:510	0.05	31.0	2	2	2
PRT	sp|Q9HCN8|SDF2L_HUMAN	Stromal cell-derived factor 2-like protein 1 OS=Homo sapiens OX=9606 GN=SDF2L1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	31-UNIMOD:510,38-UNIMOD:4,40-UNIMOD:21,43-UNIMOD:510	0.06	31.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	379-UNIMOD:510,391-UNIMOD:21,539-UNIMOD:510,550-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,48-UNIMOD:21,187-UNIMOD:510,54-UNIMOD:510,64-UNIMOD:510,492-UNIMOD:510	0.10	31.0	7	6	5
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	39-UNIMOD:510,40-UNIMOD:21	0.09	30.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	1928-UNIMOD:510,1944-UNIMOD:21,1942-UNIMOD:21,2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	30.0	3	2	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	14-UNIMOD:510,17-UNIMOD:21	0.14	30.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	28-UNIMOD:510,223-UNIMOD:510	0.16	30.0	2	2	2
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	323-UNIMOD:510	0.06	30.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	193-UNIMOD:510,195-UNIMOD:21,199-UNIMOD:21,205-UNIMOD:4	0.05	30.0	7	1	0
PRT	sp|Q16513|PKN2_HUMAN	Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	null	581-UNIMOD:510,582-UNIMOD:21	0.02	30.0	1	1	0
PRT	sp|Q9NPD3|EXOS4_HUMAN	Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	70-UNIMOD:510,74-UNIMOD:4,77-UNIMOD:21,82-UNIMOD:21	0.07	30.0	2	1	0
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	843-UNIMOD:510,852-UNIMOD:21,857-UNIMOD:510	0.02	29.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	134-UNIMOD:510,138-UNIMOD:21,141-UNIMOD:21,139-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|Q7Z460-2|CLAP1_HUMAN	Isoform 2 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	542-UNIMOD:510,545-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q9UBK8|MTRR_HUMAN	Methionine synthase reductase OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	182-UNIMOD:510,189-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	81-UNIMOD:510,83-UNIMOD:21,91-UNIMOD:35,93-UNIMOD:510,86-UNIMOD:21	0.09	28.0	4	1	0
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	172-UNIMOD:510,176-UNIMOD:21,186-UNIMOD:510	0.01	28.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	47-UNIMOD:510,52-UNIMOD:21,58-UNIMOD:510	0.02	28.0	1	1	0
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	549-UNIMOD:510,551-UNIMOD:21,561-UNIMOD:510	0.01	28.0	1	1	1
PRT	sp|O94888|UBXN7_HUMAN	UBX domain-containing protein 7 OS=Homo sapiens OX=9606 GN=UBXN7 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	278-UNIMOD:510,278-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	28.0	1	1	1
PRT	sp|Q9HAU0-3|PKHA5_HUMAN	Isoform 3 of Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	408-UNIMOD:510,410-UNIMOD:21,411-UNIMOD:35,419-UNIMOD:510	0.02	28.0	2	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	142-UNIMOD:510,152-UNIMOD:21,153-UNIMOD:4,157-UNIMOD:510,11-UNIMOD:510,14-UNIMOD:21	0.11	28.0	2	2	2
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	1369-UNIMOD:510,1375-UNIMOD:21,1376-UNIMOD:4,1381-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|Q9P260|RELCH_HUMAN	RAB11-binding protein RELCH OS=Homo sapiens OX=9606 GN=RELCH PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	178-UNIMOD:510,180-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q08209-4|PP2BA_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP3CA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	256-UNIMOD:510,258-UNIMOD:35,260-UNIMOD:21,269-UNIMOD:510	0.05	27.0	2	1	0
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	43-UNIMOD:510,57-UNIMOD:510,100-UNIMOD:510,105-UNIMOD:21,158-UNIMOD:510,161-UNIMOD:21,163-UNIMOD:4	0.13	27.0	3	3	3
PRT	sp|Q96EY7-2|PTCD3_HUMAN	Isoform 2 of Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	252-UNIMOD:510,266-UNIMOD:21,280-UNIMOD:510	0.11	27.0	1	1	0
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	7-UNIMOD:510,8-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	661-UNIMOD:510,663-UNIMOD:21,673-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	221-UNIMOD:510,37-UNIMOD:510,40-UNIMOD:21	0.06	27.0	3	2	1
PRT	sp|Q8IVT5-4|KSR1_HUMAN	Isoform 4 of Kinase suppressor of Ras 1 OS=Homo sapiens OX=9606 GN=KSR1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	267-UNIMOD:510,269-UNIMOD:21,266-UNIMOD:510	0.02	27.0	2	2	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	241-UNIMOD:510,243-UNIMOD:21,246-UNIMOD:4,253-UNIMOD:510	0.02	27.0	1	1	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	null	47-UNIMOD:510,50-UNIMOD:21,58-UNIMOD:510	0.04	27.0	1	1	0
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	null	661-UNIMOD:510,677-UNIMOD:21,689-UNIMOD:510	0.04	27.0	1	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	26.0	1	1	1
PRT	sp|P49454|CENPF_HUMAN	Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	240-UNIMOD:510,242-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	228-UNIMOD:510	0.08	26.0	1	1	1
PRT	sp|Q9H3Q1-2|BORG4_HUMAN	Isoform 2 of Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	236-UNIMOD:510,242-UNIMOD:21,243-UNIMOD:4	0.06	26.0	1	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510,20-UNIMOD:510,40-UNIMOD:21	0.09	26.0	2	2	2
PRT	sp|P61081|UBC12_HUMAN	NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	170-UNIMOD:510,175-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	17-UNIMOD:510,22-UNIMOD:4,23-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q01813-2|PFKAP_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	376-UNIMOD:510,378-UNIMOD:21,387-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|Q8N8S7-3|ENAH_HUMAN	Isoform 3 of Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	123-UNIMOD:510,125-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	376-UNIMOD:510,386-UNIMOD:21,395-UNIMOD:510,385-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|P52298-3|NCBP2_HUMAN	Isoform 3 of Nuclear cap-binding protein subunit 2 OS=Homo sapiens OX=9606 GN=NCBP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	11-UNIMOD:510,13-UNIMOD:21,8-UNIMOD:510	0.15	26.0	2	2	2
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	619-UNIMOD:510,621-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	456-UNIMOD:510,458-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	698-UNIMOD:510,702-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	49-UNIMOD:510,59-UNIMOD:4,60-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	409-UNIMOD:510,411-UNIMOD:21,419-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|Q6GYQ0-3|RGPA1_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	842-UNIMOD:510,843-UNIMOD:21,905-UNIMOD:510,907-UNIMOD:21,916-UNIMOD:510	0.03	25.0	2	2	1
PRT	sp|O43852-9|CALU_HUMAN	Isoform 9 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	60-UNIMOD:510,69-UNIMOD:21,70-UNIMOD:510	0.08	25.0	1	1	1
PRT	sp|Q99832-2|TCPH_HUMAN	Isoform 2 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	15-UNIMOD:510,17-UNIMOD:21,26-UNIMOD:510	0.04	25.0	1	1	0
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	72-UNIMOD:510,73-UNIMOD:21,77-UNIMOD:510	0.07	25.0	2	2	2
PRT	sp|Q15751|HERC1_HUMAN	Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	1510-UNIMOD:510,1510-UNIMOD:21,1514-UNIMOD:21	0.00	25.0	2	1	0
PRT	sp|O95155|UBE4B_HUMAN	Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	103-UNIMOD:510,105-UNIMOD:21,106-UNIMOD:35,113-UNIMOD:4,115-UNIMOD:510	0.01	25.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	175-UNIMOD:510,177-UNIMOD:21,181-UNIMOD:35	0.04	24.0	2	1	0
PRT	sp|Q5JSL3|DOC11_HUMAN	Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	1235-UNIMOD:510,1237-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q8WWH5|TRUB1_HUMAN	Probable tRNA pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	265-UNIMOD:510,268-UNIMOD:21,269-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	169-UNIMOD:510,172-UNIMOD:21,181-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	542-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	14-UNIMOD:510	0.06	24.0	1	1	1
PRT	sp|O75822-2|EIF3J_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	122-UNIMOD:510,127-UNIMOD:21,133-UNIMOD:510	0.06	24.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	172-UNIMOD:510,187-UNIMOD:21	0.09	24.0	2	1	0
PRT	sp|Q13625-2|ASPP2_HUMAN	Isoform 2 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	589-UNIMOD:510,591-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q99618|CDCA3_HUMAN	Cell division cycle-associated protein 3 OS=Homo sapiens OX=9606 GN=CDCA3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	92-UNIMOD:510,94-UNIMOD:21,103-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|Q15172|2A5A_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	470-UNIMOD:510,472-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	23-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:4,181-UNIMOD:510,187-UNIMOD:21	0.05	24.0	2	2	2
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510	0.03	24.0	1	1	1
PRT	sp|Q96L92-3|SNX27_HUMAN	Isoform 2 of Sorting nexin-27 OS=Homo sapiens OX=9606 GN=SNX27	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	49-UNIMOD:510,51-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	108-UNIMOD:510,110-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q01433-3|AMPD2_HUMAN	Isoform Ex1A-3 of AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	69-UNIMOD:510,71-UNIMOD:21,79-UNIMOD:510	0.02	24.0	1	1	0
PRT	sp|P42694|HELZ_HUMAN	Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	1736-UNIMOD:510,1738-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9P035|HACD3_HUMAN	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	110-UNIMOD:510,114-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P00568|KAD1_HUMAN	Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	32-UNIMOD:510,39-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	235-UNIMOD:510,241-UNIMOD:21,247-UNIMOD:4	0.04	24.0	1	1	0
PRT	sp|Q9NYB9-2|ABI2_HUMAN	Isoform 2 of Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	18-UNIMOD:510,22-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	237-UNIMOD:510,239-UNIMOD:21,257-UNIMOD:510,240-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	254-UNIMOD:510,256-UNIMOD:21,263-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	229-UNIMOD:510,258-UNIMOD:510	0.08	23.0	1	1	1
PRT	sp|P42765|THIM_HUMAN	3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	26-UNIMOD:510,28-UNIMOD:21,38-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	108-UNIMOD:510,121-UNIMOD:21,132-UNIMOD:510	0.07	23.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|P31327-3|CPSM_HUMAN	Isoform 3 of Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	899-UNIMOD:510,905-UNIMOD:35,906-UNIMOD:21,911-UNIMOD:510	0.01	23.0	1	1	0
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 3 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	125-UNIMOD:510,135-UNIMOD:21,136-UNIMOD:4,137-UNIMOD:510	0.08	23.0	1	1	1
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	291-UNIMOD:510,294-UNIMOD:21,301-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	65-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510,66-UNIMOD:510	0.09	23.0	2	2	2
PRT	sp|A0MZ66-7|SHOT1_HUMAN	Isoform 7 of Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	55-UNIMOD:510,61-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q5VWQ8-3|DAB2P_HUMAN	Isoform 3 of Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	552-UNIMOD:510,554-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	207-UNIMOD:510,218-UNIMOD:35	0.14	23.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	356-UNIMOD:510,358-UNIMOD:21,369-UNIMOD:510,821-UNIMOD:510,823-UNIMOD:21	0.03	23.0	2	2	2
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	639-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|Q6GYQ0|RGPA1_HUMAN	Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	795-UNIMOD:510,795-UNIMOD:21	0.01	23.0	1	1	0
PRT	sp|Q9H3Q1|BORG4_HUMAN	Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	306-UNIMOD:510,313-UNIMOD:4,314-UNIMOD:21,307-UNIMOD:21	0.05	23.0	2	1	0
PRT	sp|P34932-2|HSP74_HUMAN	Isoform 2 of Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	74-UNIMOD:510,76-UNIMOD:21,84-UNIMOD:510	0.08	22.0	1	1	1
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	346-UNIMOD:510,351-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	25-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	112-UNIMOD:510,116-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|Q3MII6|TBC25_HUMAN	TBC1 domain family member 25 OS=Homo sapiens OX=9606 GN=TBC1D25 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	504-UNIMOD:510,506-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	75-UNIMOD:510,80-UNIMOD:21,99-UNIMOD:510,83-UNIMOD:21	0.10	22.0	2	1	0
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	383-UNIMOD:510,386-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	320-UNIMOD:510,323-UNIMOD:21,329-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q86WR7-2|PRSR2_HUMAN	Isoform 2 of Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	41-UNIMOD:510,43-UNIMOD:21,52-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	240-UNIMOD:510,242-UNIMOD:21,238-UNIMOD:510,238-UNIMOD:21,240-UNIMOD:21	0.07	22.0	3	2	1
PRT	sp|P46937-4|YAP1_HUMAN	Isoform 4 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	198-UNIMOD:510,203-UNIMOD:21,199-UNIMOD:35,204-UNIMOD:21	0.06	22.0	2	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	102-UNIMOD:510,107-UNIMOD:21,113-UNIMOD:510,50-UNIMOD:510,448-UNIMOD:510,448-UNIMOD:21,464-UNIMOD:510,61-UNIMOD:510,64-UNIMOD:21	0.09	22.0	4	4	4
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	395-UNIMOD:510,398-UNIMOD:21,86-UNIMOD:510,89-UNIMOD:21	0.04	22.0	2	2	2
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1039-UNIMOD:510,1042-UNIMOD:21,1048-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	701-UNIMOD:510,722-UNIMOD:21,724-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	74-UNIMOD:510	0.11	21.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	15-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|Q8NBJ7-2|SUMF2_HUMAN	Isoform 2 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	166-UNIMOD:510,168-UNIMOD:21	0.08	21.0	2	1	0
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	650-UNIMOD:510,652-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P39748-2|FEN1_HUMAN	Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	269-UNIMOD:510,271-UNIMOD:21,272-UNIMOD:21,281-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|Q16531-2|DDB1_HUMAN	Isoform 2 of DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	433-UNIMOD:510,436-UNIMOD:21,442-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|Q9Y580|RBM7_HUMAN	RNA-binding protein 7 OS=Homo sapiens OX=9606 GN=RBM7 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	134-UNIMOD:510,136-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q96N67-2|DOCK7_HUMAN	Isoform 2 of Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	1421-UNIMOD:510,1423-UNIMOD:21,927-UNIMOD:510,929-UNIMOD:21,937-UNIMOD:510	0.01	21.0	2	2	2
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	19-UNIMOD:510,19-UNIMOD:21,33-UNIMOD:4,34-UNIMOD:510	0.10	21.0	1	1	1
PRT	sp|Q13155|AIMP2_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Homo sapiens OX=9606 GN=AIMP2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	34-UNIMOD:510,48-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	741-UNIMOD:510,742-UNIMOD:4,744-UNIMOD:21,750-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	71-UNIMOD:510,80-UNIMOD:21,81-UNIMOD:510,271-UNIMOD:510	0.09	21.0	2	2	2
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	109-UNIMOD:510,111-UNIMOD:21,121-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|P25054|APC_HUMAN	Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	1387-UNIMOD:510,1387-UNIMOD:4,1388-UNIMOD:21	0.00	21.0	1	1	0
PRT	sp|Q6PCE3|PGM2L_HUMAN	Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	166-UNIMOD:510,175-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	373-UNIMOD:510,373-UNIMOD:4,375-UNIMOD:21,378-UNIMOD:4,381-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	96-UNIMOD:510	0.09	20.0	1	1	1
PRT	sp|Q9Y4X5|ARI1_HUMAN	E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	512-UNIMOD:510,514-UNIMOD:21,522-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q86VP6-2|CAND1_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	1050-UNIMOD:510,1051-UNIMOD:21,1059-UNIMOD:35	0.01	20.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	223-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	10-UNIMOD:510,12-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|P60891|PRPS1_HUMAN	Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	6-UNIMOD:510,11-UNIMOD:21,18-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|P06753-3|TPM3_HUMAN	Isoform 3 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	56-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|P23381-2|SYWC_HUMAN	Isoform 2 of Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	309-UNIMOD:510,316-UNIMOD:21,325-UNIMOD:510	0.04	20.0	1	1	1
PRT	sp|Q15276-2|RABE1_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	404-UNIMOD:510,407-UNIMOD:21,420-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q14671-4|PUM1_HUMAN	Isoform 4 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	648-UNIMOD:510,650-UNIMOD:21,659-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|Q08AD1-2|CAMP2_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	435-UNIMOD:510,437-UNIMOD:21,450-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	131-UNIMOD:510,139-UNIMOD:21,138-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|O60749|SNX2_HUMAN	Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	117-UNIMOD:510,118-UNIMOD:35,119-UNIMOD:21	0.02	20.0	2	1	0
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	286-UNIMOD:510,287-UNIMOD:21,294-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	357-UNIMOD:510,359-UNIMOD:21,362-UNIMOD:4,363-UNIMOD:35,364-UNIMOD:4,368-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|O43488|ARK72_HUMAN	Aflatoxin B1 aldehyde reductase member 2 OS=Homo sapiens OX=9606 GN=AKR7A2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	38-UNIMOD:510,40-UNIMOD:21,47-UNIMOD:35,45-UNIMOD:35	0.04	20.0	2	1	0
PRT	sp|P05388-2|RLA0_HUMAN	Isoform 2 of 60S acidic ribosomal protein P0 OS=Homo sapiens OX=9606 GN=RPLP0	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	236-UNIMOD:510,239-UNIMOD:510,242-UNIMOD:21,245-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null	230-UNIMOD:510,237-UNIMOD:21,241-UNIMOD:510,239-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|Q99832|TCPH_HUMAN	T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	219-UNIMOD:510,219-UNIMOD:21,230-UNIMOD:510	0.02	20.0	1	1	0
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	773-UNIMOD:510,773-UNIMOD:4,775-UNIMOD:21,780-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	24-UNIMOD:510,25-UNIMOD:4,29-UNIMOD:21,33-UNIMOD:4,37-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P10696|PPBN_HUMAN	Alkaline phosphatase, germ cell type OS=Homo sapiens OX=9606 GN=ALPG PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	107-UNIMOD:510,114-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510	0.03	19.0	1	1	0
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	334-UNIMOD:510,342-UNIMOD:21,348-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|Q9UKV8-2|AGO2_HUMAN	Isoform 2 of Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	385-UNIMOD:510,387-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q8N7R7-3|CCYL1_HUMAN	Isoform 3 of Cyclin-Y-like protein 1 OS=Homo sapiens OX=9606 GN=CCNYL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	272-UNIMOD:510,274-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P06756-3|ITAV_HUMAN	Isoform 3 of Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	906-UNIMOD:510,909-UNIMOD:21,918-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	225-UNIMOD:510,226-UNIMOD:21,242-UNIMOD:510,227-UNIMOD:21	0.05	19.0	2	1	0
PRT	sp|Q15054-3|DPOD3_HUMAN	Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	298-UNIMOD:510,304-UNIMOD:4,305-UNIMOD:21,313-UNIMOD:35,314-UNIMOD:510	0.05	19.0	1	1	0
PRT	sp|Q8IVT5|KSR1_HUMAN	Kinase suppressor of Ras 1 OS=Homo sapiens OX=9606 GN=KSR1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	403-UNIMOD:510,404-UNIMOD:21	0.02	19.0	1	1	0
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	591-UNIMOD:510,593-UNIMOD:21,599-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|P60484|PTEN_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	379-UNIMOD:510,382-UNIMOD:21,383-UNIMOD:21,402-UNIMOD:510	0.06	19.0	1	1	1
PRT	sp|Q01433|AMPD2_HUMAN	AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	null	188-UNIMOD:510,192-UNIMOD:21,198-UNIMOD:510	0.01	19.0	1	1	0
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	null	183-UNIMOD:510,190-UNIMOD:21,194-UNIMOD:35	0.08	19.0	1	1	0
PRT	sp|Q8ND30|LIPB2_HUMAN	Liprin-beta-2 OS=Homo sapiens OX=9606 GN=PPFIBP2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	75-UNIMOD:21,81-UNIMOD:21,84-UNIMOD:21,86-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	223-UNIMOD:510	0.05	18.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q9UPQ0-9|LIMC1_HUMAN	Isoform 9 of LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	42-UNIMOD:510,47-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	44-UNIMOD:510	0.12	18.0	1	1	1
PRT	sp|Q10471|GALT2_HUMAN	Polypeptide N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=GALNT2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	533-UNIMOD:510,536-UNIMOD:21,539-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q13596-2|SNX1_HUMAN	Isoform 1A of Sorting nexin-1 OS=Homo sapiens OX=9606 GN=SNX1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	237-UNIMOD:510,240-UNIMOD:21,247-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|Q15052-2|ARHG6_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	333-UNIMOD:510,334-UNIMOD:21,341-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	263-UNIMOD:510,266-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|O95453-4|PARN_HUMAN	Isoform 4 of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	380-UNIMOD:510,382-UNIMOD:21,391-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|P33527-8|MRP1_HUMAN	Isoform 8 of Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	798-UNIMOD:510,803-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9Y2I7-2|FYV1_HUMAN	Isoform 2 of 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	208-UNIMOD:510,210-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q8TEV9-2|SMCR8_HUMAN	Isoform 2 of Guanine nucleotide exchange protein SMCR8 OS=Homo sapiens OX=9606 GN=SMCR8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	487-UNIMOD:510,487-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null	171-UNIMOD:21,177-UNIMOD:510,169-UNIMOD:510,172-UNIMOD:21	0.01	18.0	3	1	0
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	80-UNIMOD:510,82-UNIMOD:21,92-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	140-UNIMOD:510,141-UNIMOD:21,147-UNIMOD:510,155-UNIMOD:35,157-UNIMOD:510	0.08	18.0	1	1	1
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	1270-UNIMOD:510,1270-UNIMOD:21,1289-UNIMOD:510	0.01	18.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	494-UNIMOD:510,495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21,521-UNIMOD:510	0.05	18.0	1	1	1
PRT	sp|Q99961-3|SH3G1_HUMAN	Isoform 3 of Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	54-UNIMOD:510,64-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	262-UNIMOD:510,267-UNIMOD:21,264-UNIMOD:510	0.05	18.0	2	2	2
PRT	sp|P05556-2|ITB1_HUMAN	Isoform 2 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	673-UNIMOD:510,675-UNIMOD:21,678-UNIMOD:510,691-UNIMOD:4,692-UNIMOD:510	0.03	18.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	103-UNIMOD:510,106-UNIMOD:4,107-UNIMOD:21,108-UNIMOD:4,112-UNIMOD:510	0.08	18.0	1	1	1
PRT	sp|Q68DH5|LMBD2_HUMAN	G-protein coupled receptor-associated protein LMBRD2 OS=Homo sapiens OX=9606 GN=LMBRD2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	683-UNIMOD:510,689-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q15054|DPOD3_HUMAN	DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	404-UNIMOD:510,407-UNIMOD:21,410-UNIMOD:4,419-UNIMOD:35,420-UNIMOD:510	0.04	18.0	1	1	0
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	null	110-UNIMOD:510,114-UNIMOD:21,123-UNIMOD:4,126-UNIMOD:510	0.03	18.0	1	1	0
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	null	893-UNIMOD:510,899-UNIMOD:35,903-UNIMOD:21,905-UNIMOD:510	0.01	18.0	1	1	0
PRT	sp|Q9UNL4-4|ING4_HUMAN	Isoform 4 of Inhibitor of growth protein 4 OS=Homo sapiens OX=9606 GN=ING4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	null	118-UNIMOD:21,119-UNIMOD:21,121-UNIMOD:21,124-UNIMOD:21,127-UNIMOD:510	0.07	18.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510	ms_run[2]:scan=4694	48.035	2	2226.9361	2226.9361	R	-	228	248
PSM	VDSEGDFSENDDAAGDFR	2	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3254	36.382	2	2058.7904	2058.7904	R	S	321	339
PSM	NDSLSSLDFDDDDVDLSR	3	sp|P25054-2|APC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5067	51.587	2	2140.8898	2140.8898	R	E	1758	1776
PSM	SYELPDGQVITIGNER	4	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510	ms_run[2]:scan=4705	48.121	2	1823.9478	1823.9478	K	F	239	255
PSM	DNLTLWTSDQQDDDGGEGNN	5	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=4580	47.034	2	2226.9361	2226.9361	R	-	228	248
PSM	IATSLDGFDVASVQQQR	6	sp|O60664-2|PLIN3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4584	47.065	2	1947.9515	1947.9515	R	Q	31	48
PSM	VQSTADIFGDEEGDLFK	7	sp|Q9Y4E1-5|WAC2C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=5496	56.911	2	2017.9558	2017.9558	K	E	452	469
PSM	SYSSPDITQAIQEEEK	8	sp|P40818-2|UBP8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4284	44.517	2	1971.9351	1971.9351	R	R	610	626
PSM	YQPLASTASDNDFVTPEPR	9	sp|Q15021|CND1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3976	42.096	2	2221.0153	2221.0153	R	R	1325	1344
PSM	SNSELEDEILCLEK	10	sp|Q96PC5-6|MIA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=5492	56.881	2	1825.8693	1825.8693	R	E	99	113
PSM	TPEELDDSDFETEDFDVR	11	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4794	48.882	2	2271.9157	2271.9157	R	S	264	282
PSM	SYSSPDITQAIQEEEK	12	sp|P40818|UBP8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=4284	44.51744166666667	2	1971.9317	1971.9345	R	R	716	732
PSM	GILAADESTGSIAK	13	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2612	31.574	2	1479.7858	1479.7858	K	R	29	43
PSM	NGSEADIDEGLYSR	14	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2875	33.542	2	1638.6987	1638.6987	K	Q	4	18
PSM	ASSLGEIDESSELR	15	sp|Q16513-5|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3189	35.899	2	1605.7347	1605.7347	R	V	255	269
PSM	EYIPGQPPLSQSSDSSPTR	16	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3155	35.642	2	2158.9996	2158.9996	K	N	871	890
PSM	QIPSAEDLETDGGGPGQVVDDGLEHR	17	sp|Q8WUI4-10|HDAC7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4398	45.475	3	2804.2714	2804.2714	R	E	64	90
PSM	TIGGGDDSFNTFFSETGAGK	18	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,8-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5212	53.199	2	2154.9783	2154.9783	K	H	41	61
PSM	TMSEVGGSVEDLIAK	19	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4988	50.783	2	1682.8474	1682.8474	R	G	35	50
PSM	EYIPGQPPLSQSSDSSPTR	20	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=3155	35.64230833333333	2	2158.9929	2158.9991	K	N	871	890
PSM	DWEDDSDEDMSNFDR	21	sp|Q15185-4|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=3843	41.045	2	1908.7168	1908.7168	K	F	108	123
PSM	EDGLAQQQTQLNLR	22	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2775	32.797	2	1726.8463	1726.8463	K	S	2207	2221
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	23	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=1972	26.814	3	2826.1852	2826.1852	R	E	418	442
PSM	SSSPAPADIAQTVQEDLR	24	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=5141	52.371	2	1997.9519	1997.9519	K	T	230	248
PSM	ALSSDSILSPAPDAR	25	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3585	38.966	2	1612.7922	1612.7922	R	A	392	407
PSM	DNLTLWTSDQQDDDGGEGNN	26	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=4934	50.256	2	2226.9361	2226.9361	R	-	228	248
PSM	DWEDDSDEDMSNFDR	27	sp|Q15185-4|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3148	35.588	2	2004.6781	2004.6781	K	F	108	123
PSM	GASQAGMTGYGMPR	28	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=1062	19.946	2	1528.6264	1528.6264	R	Q	204	218
PSM	GGSVLVTCSTSCDQPK	29	sp|P05362|ICAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2038	27.303	2	1842.8529	1842.8529	R	L	41	57
PSM	ILGADTSVDLEETGR	30	sp|P25705-2|ATPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3392	37.441	2	1688.8082	1688.8082	R	V	9	24
PSM	KEESEESDDDMGFGLFD	31	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4261	44.337	2	2032.8732	2032.8732	K	-	99	116
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	32	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,19-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3879	41.322	3	3090.3451	3090.3451	K	E	120	146
PSM	RVSVCAETYNPDEEEEDTDPR	33	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2455	30.403	3	2624.0798	2624.0798	R	V	97	118
PSM	SVPTSTVFYPSDGVATEK	34	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,4-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3968	42.034	2	2032.0078	2032.0078	R	A	439	457
PSM	TGAELVTCGSVLK	35	sp|Q9HCN8|SDF2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:4,10-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3272	36.519	2	1481.7837	1481.7837	K	L	31	44
PSM	GVVDSEDLPLNISR	36	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=4317	44.818508333333334	2	1626.8055	1626.8073	R	E	379	393
PSM	DSSTSPGDYVLSVSENSR	37	sp|P46108-2|CRK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4436	45.786	2	2012.8788	2012.8788	R	V	39	57
PSM	GASQAGMTGYGMPR	38	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2658	31.917	2	1496.6366	1496.6366	R	Q	204	218
PSM	GILAADESTGSIAK	39	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2793	32.933	2	1479.7858	1479.7858	K	R	29	43
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	40	sp|O95714|HERC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=3188	35.891	3	3088.3094	3088.3094	K	N	1928	1956
PSM	RSASPDDDLGSSNWEAADLGNEER	41	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3617	39.242	3	2704.1462	2704.1462	K	K	14	38
PSM	SVTEQGAELSNEER	42	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=1387	22.441	2	1581.7695	1581.7695	K	N	28	42
PSM	TAENATSGETLEENEAGD	43	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=1678	24.611	2	1870.8128	1870.8128	K	-	323	341
PSM	TMSEVGGSVEDLIAK	44	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:35,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4308	44.732	2	1698.8424	1698.8424	R	G	35	50
PSM	VPTANVSVVDLTCR	45	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4578	47.019	2	1723.783	1723.7830	R	L	193	207
PSM	ASSLGEIDESSELR	46	sp|Q16513|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3189	35.899148333333336	2	1605.7327	1605.7342	R	V	581	595
PSM	ALVNCQYSSATFSTGER	47	sp|Q9NPD3|EXOS4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=3232	36.217823333333335	2	2004.8892	2003.8862	R	K	70	87
PSM	DGSLASNPYSGDLTK	48	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3211	36.062	2	1671.8029	1671.8029	R	F	843	858
PSM	LYGPSSVSFADDFVR	49	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=5929	62.675	2	1852.7898	1852.7898	R	S	134	149
PSM	NSDSIVSLPQSDR	50	sp|Q7Z460-2|CLAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2778	32.819	2	1530.7139	1530.7139	K	S	542	555
PSM	SELLHIESQVELLR	51	sp|Q9UBK8|MTRR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=5237	53.504	2	1778.9392	1778.9392	K	F	182	196
PSM	VPTANVSVVDLTCR	52	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3878	41.315	2	1643.8166	1643.8166	R	L	193	207
PSM	AITGASLADIMAK	53	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:35,13-UNIMOD:510	ms_run[2]:scan=3612	39.176	2	1424.7623	1424.7623	R	R	81	94
PSM	DNLTLWTSDTQGDEAEAGEGGEN	54	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=4767	48.657	3	2442.0519	2442.0519	R	-	223	246
PSM	EELQSQVELLNSFEK	55	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=5439	56.177	2	1939.9816	1939.9816	K	K	172	187
PSM	ELISNSSDALDK	56	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2480	30.589	2	1438.7229	1438.7229	R	I	47	59
PSM	GASQAGMTGYGMPR	57	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=1686	24.675	2	1512.6315	1512.6315	R	Q	204	218
PSM	KEESEESDDDMGFGLFD	58	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4886	49.792	2	2112.8395	2112.8395	K	-	99	116
PSM	KEESEESDDDMGFGLFD	59	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=6094	65.206	2	2176.8109	2176.8109	K	-	99	116
PSM	QESTSVLLQQSEK	60	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2568	31.244	2	1623.8393	1623.8393	R	K	549	562
PSM	SESLIDASEDSQLEAAIR	61	sp|O94888|UBXN7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4802	48.943	2	2046.9571	2046.9571	R	A	278	296
PSM	TAFQEALDAAGDK	62	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3091	35.16	2	1403.7569	1403.7569	K	L	9	22
PSM	TNSMQQLEQWIK	63	sp|Q9HAU0-3|PKHA5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=4250	44.251	2	1668.8219	1668.8219	R	I	408	420
PSM	TNSMQQLEQWIK	64	sp|Q9HAU0-3|PKHA5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5172	52.734	2	1652.827	1652.8270	R	I	408	420
PSM	VPTANVSVVDLTCR	65	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3744	40.276	2	1643.8166	1643.8166	R	L	193	207
PSM	YADLTEDQLPSCESLK	66	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=3889	41.398	2	2015.9435	2015.9435	R	D	142	158
PSM	AELFTQSCADLDK	67	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=3610	39.161	2	1644.7743	1644.7743	K	W	1369	1382
PSM	AGSISTLDSLDFAR	68	sp|Q9P260|RELCH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4929	50.218	2	1565.7551	1565.7551	R	Y	178	192
PSM	DAMPSDANLNSINK	69	sp|Q08209-4|PP2BA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:35,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2174	28.326	2	1652.7753	1652.7753	R	A	256	270
PSM	DLADELALVDVIEDK	70	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6290	68.119	2	1724.972	1724.9720	K	L	43	58
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	71	sp|Q96EY7-2|PTCD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,15-UNIMOD:21,29-UNIMOD:510	ms_run[2]:scan=4266	44.378	3	3082.3147	3082.3147	K	-	252	281
PSM	EGLELPEDEEEK	72	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2670	32.007	2	1483.7566	1483.7566	K	K	539	551
PSM	GILAADESTGSIAK	73	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,9-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3297	36.706	2	1559.7522	1559.7522	K	R	29	43
PSM	GTVTDFPGFDER	74	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4144	43.394	2	1453.6339	1453.6339	R	A	7	19
PSM	SPSFASEWDEIEK	75	sp|Q92625|ANS1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4933	50.248	2	1671.7706	1671.7706	K	I	661	674
PSM	STAGDTHLGGEDFDNR	76	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=1535	23.547	2	1724.7814	1724.7814	K	M	221	237
PSM	TESVPSDINNPVDR	77	sp|Q8IVT5-4|KSR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2510	30.812	2	1655.7616	1655.7616	R	A	267	281
PSM	VDSTTCLFPVEEK	78	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=4174	43.639	2	1671.8103	1671.8103	R	A	241	254
PSM	VPTANVSVVDLTCR	79	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3785	40.579	2	1643.8166	1643.8166	R	L	193	207
PSM	VPTANVSVVDLTCR	80	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4339	44.986	2	1723.783	1723.7830	R	L	193	207
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	81	sp|O95714|HERC2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[1]:scan=3188	35.89140666666667	3	3088.2996	3088.3089	K	N	1928	1956
PSM	GILAADESTGSIAK	82	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=3297	36.70583	2	1559.7492	1559.7516	K	R	29	43
PSM	ELISNSSDALDK	83	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2480	30.589254999999998	2	1438.721556	1438.722891	R	I	47	59
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	84	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,17-UNIMOD:21,29-UNIMOD:510	ms_run[1]:scan=4266	44.377755	3	3082.307775	3082.314718	K	-	661	690
PSM	AFLAELEQNSPK	85	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3966	42.019	2	1493.7803	1493.7803	K	I	2424	2436
PSM	DFSASYFSGEQEVTPSR	86	sp|P49454|CENPF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4465	46.037	2	2019.8675	2019.8675	R	S	240	257
PSM	DNLTLWTSDQQDEEAGEGN	87	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4647	47.656	2	2154.9402	2154.9402	R	-	228	247
PSM	DSSSLSSCTSGILEER	88	sp|Q9H3Q1-2|BORG4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=3817	40.818	2	1840.7974	1840.7974	R	S	236	252
PSM	EVDEQMLNVQNK	89	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1582	23.898	2	1529.8032	1529.8032	K	N	325	337
PSM	GASQAGMTGYGMPR	90	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=1849	25.898	2	1512.6315	1512.6315	R	Q	204	218
PSM	GGYIGSTYFER	91	sp|P61081|UBC12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3814	40.796	2	1362.6069	1362.6069	R	C	170	181
PSM	GLPWSCSADEVQR	92	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=3827	40.894	2	1617.7071	1617.7071	R	F	17	30
PSM	GRSFAGNLNTYK	93	sp|Q01813-2|PFKAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2062	27.483	2	1474.7606	1474.7606	R	R	376	388
PSM	KEESEESDDDMGFGLFD	94	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=5543	57.472	2	2192.8058	2192.8058	K	-	99	116
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	95	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,26-UNIMOD:510	ms_run[2]:scan=3567	38.807	3	3010.3787	3010.3787	K	E	120	146
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	96	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,19-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4352	45.114	3	3170.3114	3170.3114	K	E	120	146
PSM	LYGPSSVSFADDFVR	97	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=5425	55.961	2	1772.8235	1772.8235	R	S	134	149
PSM	QNSQLPAQVQNGPSQEELEIQR	98	sp|Q8N8S7-3|ENAH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3532	38.539	3	2606.255	2606.2550	R	R	123	145
PSM	RTGSNISGASSDISLDEQYK	99	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2591	31.414	3	2275.1006	2275.1006	K	H	376	396
PSM	SDSYVELSQYR	100	sp|P52298-3|NCBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3268	36.489	2	1459.6445	1459.6445	R	D	11	22
PSM	SQSFSEAEPQLPPAPVR	101	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3681	39.799	2	1952.9457	1952.9457	R	G	619	636
PSM	TLSFGSDLNYATR	102	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4516	46.503	2	1557.7289	1557.7289	R	E	456	469
PSM	VPTANVSVVDLTCR	103	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4209	43.908	2	1723.783	1723.7830	R	L	193	207
PSM	ADVQSIIGLQR	104	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4553	46.798	2	1312.6964	1312.6964	K	F	698	709
PSM	AITGASLADIMAK	105	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4907	49.977	2	1408.7673	1408.7673	R	R	81	94
PSM	AITGASLADIMAK	106	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5263	53.781	2	1488.7337	1488.7337	R	R	81	94
PSM	DAMPSDANLNSINK	107	sp|Q08209-4|PP2BA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3072	35.017	2	1636.7804	1636.7804	R	A	256	270
PSM	GLELIASENFCSR	108	sp|P34897-3|GLYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=4550	46.774	2	1608.7431	1608.7431	R	A	49	62
PSM	RLSQSDEDVIR	109	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1603	24.055	2	1430.6979	1430.6979	K	L	119	130
PSM	SSSGLLEWESK	110	sp|P14866-2|HNRPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4136	43.331	2	1369.6803	1369.6803	R	S	409	420
PSM	SSSTSDILEPFTVER	111	sp|Q6GYQ0-3|RGPA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=5011	51.024	2	1780.8344	1780.8344	R	A	842	857
PSM	TFDQLTPEESK	112	sp|O43852-9|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2709	32.3	2	1441.7014	1441.7014	K	E	60	71
PSM	TFSYAGFEMQPK	113	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4631	47.476	2	1552.731	1552.7310	K	K	15	27
PSM	VTSFRDLIHDQDEDEEEEEGQR	114	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3603	39.105	3	2789.1878	2789.1878	R	F	72	94
PSM	SRSESDLSQPESDEEGYALSGR	115	sp|Q15751|HERC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=2606	31.528093333333334	3	2512.0747	2512.0810	K	R	1510	1532
PSM	SQSMDIDGVSCEK	116	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:35,11-UNIMOD:4,13-UNIMOD:510	ms_run[1]:scan=1549	23.65268	2	1619.6872	1618.6882	R	S	103	116
PSM	ALSRQEMQEVQSSR	117	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1610	24.107	3	1761.8293	1761.8293	K	S	175	189
PSM	CTSVSSLDSFESR	118	sp|P25054-2|APC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=3427	37.707	2	1587.67	1587.6700	R	S	1286	1299
PSM	EDSRGSLIPEGATGFPDQGNTGENTR	119	sp|Q5JSL3|DOC11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3658	39.593	3	2818.2619	2818.2619	R	Q	1235	1261
PSM	ELSSCANVLELTR	120	sp|Q8WWH5|TRUB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=4495	46.297	2	1604.7693	1604.7693	K	T	265	278
PSM	FSASGELGNGNIK	121	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2935	33.986	2	1440.7286	1440.7286	K	L	169	182
PSM	HGSYEDAVHSGALND	122	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1595	23.997	2	1604.7279	1604.7279	K	-	542	557
PSM	IQALQQQADEAEDR	123	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1749	25.159	2	1647.8276	1647.8276	K	A	14	28
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	124	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4912	50.014	3	2995.386	2995.3860	R	G	2913	2938
PSM	KLQEESDLELAK	125	sp|O75822-2|EIF3J_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2403	30.018	2	1583.8908	1583.8908	K	E	122	134
PSM	LATQSNEITIPVTFESR	126	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=4786	48.819	2	2019.0138	2019.0138	K	A	172	189
PSM	NQSDADLEALR	127	sp|Q13625-2|ASPP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2643	31.807	2	1344.6135	1344.6135	R	K	589	600
PSM	QLSEVFETEDSK	128	sp|Q99618|CDCA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3574	38.862	2	1558.744	1558.7440	K	S	92	104
PSM	QNSAYNMHSILSNTSAE	129	sp|Q15172|2A5A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3890	41.405	2	1979.8508	1979.8508	K	-	470	487
PSM	QPALSAACLGPEVTTQYGGQYR	130	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=4315	44.803	3	2480.1619	2480.1619	R	T	23	45
PSM	QQEGESRLNLVQR	131	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1973	26.821	2	1669.8361	1669.8361	R	N	100	113
PSM	QVPDSAATATAYLCGVK	132	sp|P09923|PPBI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=4264	44.36	2	1898.9485	1898.9486	R	A	107	124
PSM	SESGYGFNVR	133	sp|Q96L92-3|SNX27_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2705	32.271	2	1228.5338	1228.5338	K	G	49	59
PSM	SRSESDLSQPESDEEGYALSGR	134	sp|Q15751|HERC1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2606	31.528	3	2512.0815	2512.0815	K	R	1510	1532
PSM	STSQGSINSPVYSR	135	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1841	25.838	2	1595.7405	1595.7405	R	H	108	122
PSM	TDSDSDLQLYK	136	sp|Q01433-3|AMPD2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2828	33.197	2	1431.6807	1431.6807	K	E	69	80
PSM	TVSSSSLPSLEEYEPR	137	sp|P42694|HELZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4543	46.716	2	1893.8821	1893.8821	R	G	1736	1752
PSM	WLDESDAEMELR	138	sp|Q9P035|HACD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4511	46.462	2	1606.6799	1606.6799	R	A	110	122
PSM	YGYTHLSTGDLLR	139	sp|P00568|KAD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3855	41.136	2	1608.7761	1608.7761	K	S	32	45
PSM	VPTANVSVVDLTCR	140	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=3924	41.696083333333334	2	1643.8138	1643.8161	R	L	235	249
PSM	ALVNCQYSSATFSTGER	141	sp|Q9NPD3|EXOS4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=3232	36.217823333333335	2	2004.890598	2003.887225	R	K	70	87
PSM	ALFDSYTNLER	142	sp|Q9NYB9-2|ABI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4406	45.537	2	1441.6703	1441.6703	R	V	18	29
PSM	AQSYPDNHQEFSDYDNPIFEK	143	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=4238	44.13	3	2691.1803	2691.1803	R	F	237	258
PSM	ASSLEDLVLK	144	sp|Q15477|SKIV2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4526	46.581	2	1221.6894	1221.6894	R	E	254	264
PSM	DELTDLDQSNVTEETPEGEEHHPVADTENK	145	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,30-UNIMOD:510	ms_run[2]:scan=2976	34.294	4	3445.5917	3445.5917	K	E	229	259
PSM	DFTATDLSEFAAK	146	sp|P42765|THIM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5108	52.049	2	1562.7542	1562.7542	K	A	26	39
PSM	DNLTLWTSDQQDDDGGEGNN	147	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=4823	49.15	2	2226.9361	2226.9361	R	-	228	248
PSM	EFITGDVEPTDAESEWHSENEEEEK	148	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,14-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=3916	41.633	3	3083.3081	3083.3081	R	L	108	133
PSM	ELISNASDALDK	149	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2582	31.348	2	1342.7616	1342.7616	R	I	42	54
PSM	FASENDLPEWK	150	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4212	43.932	2	1482.7068	1482.7068	R	E	58	69
PSM	GLNSESMTEETLK	151	sp|P31327-3|CPSM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:35,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1915	26.391	2	1601.7532	1601.7532	K	R	899	912
PSM	GPLQSVQVFGR	152	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3835	40.97	2	1300.6753	1300.6753	K	K	5	16
PSM	HGESAWNLENR	153	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2111	27.84	2	1425.6251	1425.6251	R	F	11	22
PSM	IIYGGSVTGATCK	154	sp|P60174-4|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2208	28.576	2	1473.7575	1473.7575	R	E	125	138
PSM	NFSDNQLQEGK	155	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2060	27.468	2	1426.6766	1426.6766	R	N	182	193
PSM	RAESMLQQADK	156	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1403	22.561	2	1423.7167	1423.7167	K	L	291	302
PSM	RNQSFCPTVNLDK	157	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2430	30.219	2	1725.8546	1725.8546	K	L	65	78
PSM	SLDPENSETELER	158	sp|A0MZ66-7|SHOT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2423	30.168	2	1631.714	1631.7140	K	I	55	68
PSM	SLSMVDLQDAR	159	sp|Q5VWQ8-3|DAB2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3981	42.134	2	1347.6318	1347.6318	K	T	552	563
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	160	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:35	ms_run[2]:scan=4123	43.232	3	3506.5004	3506.5004	R	-	207	238
PSM	TGSYGALAEITASK	161	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4116	43.179	2	1515.7858	1515.7858	K	E	356	370
PSM	YEWDVAEAR	162	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2838	33.27	2	1171.5722	1171.5722	K	K	639	648
PSM	SSSTSDILEPFTVER	163	sp|Q6GYQ0|RGPA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=5011	51.02433	2	1780.8324	1780.8339	R	A	795	810
PSM	DSSSLSSCTSGILEER	164	sp|Q9H3Q1|BORG4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=3817	40.81838	2	1840.7920	1840.7969	R	S	306	322
PSM	AFSDPFVEAEK	165	sp|P34932-2|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4347	45.059	2	1386.6745	1386.6745	R	S	74	85
PSM	AGFAGDDAPR	166	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1054	19.881	2	1009.5041	1009.5041	K	A	19	29
PSM	ALDVSASDDEIAR	167	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2843	33.308	2	1474.6765	1474.6765	K	L	181	194
PSM	DLGTESQIFISR	168	sp|P50395-2|GDIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4489	46.236	2	1478.723	1478.7230	K	T	346	358
PSM	DNLTLWTSDQQDDDGGEGNN	169	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=5050	51.398	2	2226.9361	2226.9361	R	-	228	248
PSM	ELISNASDALDK	170	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2934	33.979	2	1422.728	1422.7280	R	I	42	54
PSM	EQFLDGDGWTSR	171	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=3591	39.01	2	1443.6843	1443.6843	K	W	25	37
PSM	KEESEESDDDMGFGLFD	172	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4893	49.846	2	2112.8395	2112.8395	K	-	99	116
PSM	NGESSELDLQGIR	173	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3346	37.069	2	1530.7139	1530.7139	R	I	112	125
PSM	QASLDGLQQLR	174	sp|Q3MII6|TBC25_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3464	38.007	2	1341.6866	1341.6866	R	D	504	515
PSM	RLAENSASSDDLLVAEVGISDYGDK	175	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4941	50.309	3	2771.3539	2771.3539	K	L	75	100
PSM	RVYSLFLDESR	176	sp|Q9Y230-2|RUVB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3963	41.997	2	1497.7441	1497.7441	K	S	383	394
PSM	SADTLWDIQK	177	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4091	42.985	2	1323.6748	1323.6748	K	D	320	330
PSM	SRSFTLDDESLK	178	sp|Q86WR7-2|PRSR2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2809	33.053	2	1544.776	1544.7760	R	Y	41	53
PSM	THSTSSSLGSGESPFSR	179	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1977	26.851	2	1836.8104	1836.8104	R	S	240	257
PSM	TMTTNSSDPFLNSGTYHSR	180	sp|P46937-4|YAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2996	34.45	3	2228.9622	2228.9622	R	D	198	217
PSM	TVIIEQSWGSPK	181	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3747	40.298	2	1491.8011	1491.8011	R	V	61	73
PSM	TWNDPSVQQDIK	182	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2830	33.212	2	1577.7763	1577.7763	R	F	102	114
PSM	VQQTVQDLFGR	183	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3796	40.66	2	1403.7022	1403.7022	K	A	395	406
PSM	VQSTADIFGDEEGDLFK	184	sp|Q9Y4E1-5|WAC2C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=5485	56.811	3	2017.9558	2017.9558	K	E	452	469
PSM	RLAENSASSDDLLVAEVGISDYGDK	185	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,9-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=4941	50.308726666666665	3	2771.3499	2771.3534	K	L	75	100
PSM	RTGSNISGASSDISLDEQYK	186	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=2591	31.413775	3	2275.0964	2275.1000	K	H	376	396
PSM	DSSSLSSCTSGILEER	187	sp|Q9H3Q1|BORG4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=3817	40.81838	2	1840.792554	1840.797406	R	S	306	322
PSM	AALSEEELEK	188	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2262	28.976	2	1265.6428	1265.6428	K	K	1039	1049
PSM	AITGASLADIMAK	189	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,11-UNIMOD:35,13-UNIMOD:510	ms_run[2]:scan=3970	42.049	2	1504.7286	1504.7286	R	R	81	94
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	190	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,22-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=4564	46.912	3	2949.2212	2949.2212	K	T	701	725
PSM	DLIHDQDEDEEEEEGQR	191	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1786	25.438	3	2118.9038	2118.9038	R	F	77	94
PSM	EDQTEYLEER	192	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1756	25.213	2	1344.6258	1344.6258	K	R	187	197
PSM	EGMNIVEAMER	193	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3865	41.212	2	1311.6375	1311.6375	K	F	74	85
PSM	EQQEAIEHIDEVQNEIDR	194	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3456	37.944	3	2228.0769	2228.0769	K	L	15	33
PSM	GASWIDTADGSANHR	195	sp|Q8NBJ7-2|SUMF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2667	31.982	3	1670.7262	1670.7262	R	A	166	181
PSM	KEESEESDDDMGFGLFD	196	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=6160	66.28	2	2176.8109	2176.8109	K	-	99	116
PSM	NDSWGSFDLR	197	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4570	46.957	2	1309.5552	1309.5552	R	A	650	660
PSM	QGSTQGRLDDFFK	198	sp|P39748-2|FEN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4734	48.364	2	1725.7801	1725.7801	R	V	269	282
PSM	REATADDLIK	199	sp|Q16531-2|DDB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1518	23.421	2	1278.6857	1278.6857	K	V	433	443
PSM	RSYSSPDITQAIQEEEK	200	sp|P40818-2|UBP8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3458	37.961	3	2128.0362	2128.0362	K	R	609	626
PSM	SFSSPENFQR	201	sp|Q9Y580|RBM7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2668	31.99	2	1311.5709	1311.5709	R	Q	134	144
PSM	SPSGSAFGSQENLR	202	sp|Q96N67-2|DOCK7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2206	28.562	2	1549.6986	1549.6986	R	W	1421	1435
PSM	SSEHINEGETAMLVCK	203	sp|P35613-3|BASI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,15-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2750	32.612	3	1951.9057	1951.9057	K	S	19	35
PSM	SYGPAPGAGHVQEESNLSLQALESR	204	sp|Q13155|AIMP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3917	41.641	3	2710.2812	2710.2812	R	Q	34	59
PSM	TCHSFIINEK	205	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:4,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1903	26.302	2	1395.6894	1395.6894	K	M	741	751
PSM	TFDQLTPDESK	206	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2698	32.218	2	1427.6858	1427.6858	K	E	71	82
PSM	TPSSDVLVFDYTK	207	sp|Q09028-4|RBBP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4678	47.909	2	1618.8168	1618.8168	K	H	109	122
PSM	TTPSVVAFTADGER	208	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3513	38.392	2	1563.7394	1563.7394	R	L	86	100
PSM	VEIIANDQGNR	209	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=1435	22.80102833333333	2	1261.6827	1261.6834	R	I	50	61
PSM	RSYSSPDITQAIQEEEK	210	sp|P40818|UBP8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,17-UNIMOD:510	ms_run[1]:scan=3458	37.96109666666667	3	2128.0324	2128.0357	K	R	715	732
PSM	CTSVSSLDSFESR	211	sp|P25054|APC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=3427	37.70691166666666	2	1587.668279	1587.670021	R	S	1387	1400
PSM	ALRSDSYVELSQYR	212	sp|P52298-3|NCBP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3082	35.094	2	1799.8667	1799.8667	K	D	8	22
PSM	AVAGVMITASHNR	213	sp|Q6PCE3|PGM2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1765	25.28	3	1439.7169	1439.7169	K	K	166	179
PSM	CLSVACLDK	214	sp|Q00613-2|HSF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21,6-UNIMOD:4,9-UNIMOD:510	ms_run[2]:scan=3102	35.243	2	1212.592	1212.5920	K	N	373	382
PSM	DGNGYISAAELR	215	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2999	34.472	2	1298.6679	1298.6679	K	H	96	108
PSM	DISQDSLQDIK	216	sp|Q9Y4X5|ARI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3321	36.883	2	1408.7123	1408.7123	R	Q	512	523
PSM	DSSSTNLESMDTS	217	sp|Q86VP6-2|CAND1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=1321	21.936	2	1502.5544	1502.5544	K	-	1050	1063
PSM	EALQDVEDENQ	218	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2000	27.019	2	1322.605	1322.6050	K	-	223	234
PSM	GLSQSALPYR	219	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3028	34.683	2	1204.6066	1204.6066	K	R	10	20
PSM	HELQANCYEEVK	220	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1282	21.641	2	1586.8035	1586.8035	K	D	133	145
PSM	HWILPQDYDHAQAEAR	221	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2937	34	3	1982.9811	1982.9811	R	H	271	287
PSM	IFSGSSHQDLSQK	222	sp|P60891|PRPS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1292	21.715	2	1580.7872	1580.7872	K	I	6	19
PSM	IQLVEEELDR	223	sp|P06753-3|TPM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3301	36.735	2	1276.7087	1276.7087	R	A	56	66
PSM	MSASDPNSSIFLTDTAK	224	sp|P23381-2|SYWC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=4114	43.163	2	1931.9224	1931.9224	K	Q	309	326
PSM	RAQSTDSLGTSGSLQSK	225	sp|Q15276-2|RABE1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1188	20.913	3	1869.947	1869.9470	R	A	404	421
PSM	RDSLTGSSDLYK	226	sp|Q14671-4|PUM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1820	25.687	2	1488.7498	1488.7498	R	R	648	660
PSM	SISNEGLTLNNSHVSK	227	sp|Q08AD1-2|CAMP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2399	29.988	3	1846.9462	1846.9462	R	H	435	451
PSM	SLYESFVSSSDR	228	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3708	40.003	2	1489.655	1489.6550	K	L	131	143
PSM	SMSAPVIFDR	229	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=3142	35.544	2	1251.5783	1251.5783	K	S	117	127
PSM	SQIFSTASDNQPTVTIK	230	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3643	39.447	2	1984.0191	1984.0191	K	V	448	465
PSM	SRTHSTSSSLGSGESPFSR	231	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1540	23.584	3	2079.9435	2079.9435	R	S	238	257
PSM	STFVLDEFK	232	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=4917	50.068	2	1232.6366	1232.6366	K	R	286	295
PSM	TTPSYVAFTDTER	233	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3432	37.745	2	1600.7234	1600.7234	R	L	37	50
PSM	VASFSCMCPEGK	234	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,7-UNIMOD:35,8-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1747	25.144	2	1535.6496	1535.6496	R	A	357	369
PSM	VASVLGTMEMGR	235	sp|O43488|ARK72_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3387	37.404	2	1379.6402	1379.6402	R	R	38	50
PSM	VEAKEESEESDEDMGFGLFD	236	sp|P05388-2|RLA0_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6039	64.296	2	2489.9747	2489.9747	K	-	236	256
PSM	YLAPSGPSGTLK	237	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2185	28.408	2	1337.7269	1337.7269	R	A	230	242
PSM	TFSYAGFEMQPK	238	sp|Q99832|TCPH_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=4631	47.475955	2	1552.7295	1552.7304	K	K	219	231
PSM	SLYESFVSSSDR	239	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=3708	40.00334	2	1489.6529	1489.6545	K	L	131	143
PSM	YLAPSGPSGTLK	240	sp|Q16658|FSCN1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2185	28.40811333333333	2	1337.725761	1337.726854	R	A	230	242
PSM	AQSYPDNHQEFSDYDNPIFEK	241	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=4238	44.130228333333335	3	2691.175545	2691.180278	R	F	237	258
PSM	CLSVMEAK	242	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21,8-UNIMOD:510	ms_run[2]:scan=2434	30.252	2	1084.5334	1084.5334	K	V	773	781
PSM	ECTRGSAVWCQNVK	243	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:4,6-UNIMOD:21,10-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=1909	26.346	3	1841.859	1841.8590	K	T	24	38
PSM	EIIDLVLDR	244	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=4665	47.813	2	1118.6759	1118.6759	K	I	113	122
PSM	GASWIDTADGSANHR	245	sp|Q8NBJ7-2|SUMF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2671	32.014	2	1670.7262	1670.7262	R	A	166	181
PSM	GREDVSNFDDEFTSEAPILTPPREPR	246	sp|Q16513-5|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=4451	45.93	3	3087.4399	3087.4399	R	I	613	639
PSM	GYSFTTTAER	247	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1798	25.526	2	1165.5828	1165.5828	R	E	197	207
PSM	HVPDSGATATAYLCGVK	248	sp|P10696|PPBN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=3247	36.328	3	1893.9332	1893.9332	K	G	107	124
PSM	IRYESLTDPSK	249	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1817	25.665	3	1375.7984	1375.7984	K	L	54	65
PSM	ISSDLDGHPVPK	250	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1680	24.631	2	1411.7385	1411.7385	K	Q	103	115
PSM	QEYDESGPSIVHR	251	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1436	22.808	3	1549.7585	1549.7585	K	K	360	373
PSM	RGSSPGSLEIPK	252	sp|Q6GYQ0-3|RGPA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1884	26.161	2	1374.7545	1374.7545	R	D	905	917
PSM	RLVPGGGATEIELAK	253	sp|P50990-3|TCPQ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3084	35.108	3	1657.9441	1657.9441	K	Q	334	349
PSM	SASFNTDPYVR	254	sp|Q9UKV8-2|AGO2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2751	32.62	2	1369.6128	1369.6128	R	E	385	396
PSM	SFSADNFIGIQR	255	sp|Q8N7R7-3|CCYL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4720	48.238	2	1467.6972	1467.6972	R	S	272	284
PSM	SNSWVNTGGPK	256	sp|Q96N67-2|DOCK7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1867	26.034	2	1293.6391	1293.6391	R	A	927	938
PSM	SSASFNVIEFPYK	257	sp|P06756-3|ITAV_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5154	52.54	2	1635.8222	1635.8222	K	N	906	919
PSM	STTPPPAEPVSLPQEPPKPR	258	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2865	33.468	3	2272.2141	2272.2141	K	V	225	245
PSM	VASVLGTMEMGR	259	sp|O43488|ARK72_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=2642	31.8	2	1379.6402	1379.6402	R	R	38	50
PSM	VIGSGCNLDSAR	260	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=1784	25.424	2	1361.6223	1361.6223	R	F	158	170
PSM	VPTANVSVVDLTCR	261	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4459	45.992	2	1723.783	1723.7830	R	L	193	207
PSM	VYESESCTDSEEELNMK	262	sp|Q15054-3|DPOD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:35,17-UNIMOD:510	ms_run[2]:scan=2005	27.055	3	2212.9065	2212.9065	K	T	298	315
PSM	RTESVPSDINNPVDR	263	sp|Q8IVT5|KSR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=1908	26.338853333333333	3	1811.8610	1811.8622	R	A	403	418
PSM	NNSGEEFDCAFR	264	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=3251	36.358898333333336	2	1559.5982	1558.5962	R	L	591	603
PSM	YSDTTDSDPENEPFDEDQHTQITK	265	sp|P60484|PTEN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=3258	36.41279333333333	3	3040.2162	3039.2212	R	V	379	403
PSM	STTPPPAEPVSLPQEPPKPR	266	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=2865	33.467686666666665	3	2272.2110	2272.2136	K	V	225	245
PSM	TDSDSDLQLYK	267	sp|Q01433|AMPD2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2828	33.19728	2	1431.679418	1431.680691	K	E	188	199
PSM	GASQAGMTGYGMPR	268	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1686	24.675393333333332	2	1512.628497	1512.631468	R	Q	183	197
PSM	AALLSQIPGPTAAYIK	269	sp|Q8ND30|LIPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4255	44.289	2	1886.881	1886.8810	R	E	71	87
PSM	ALSRQEMQEVQSSR	270	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=978	19.28	3	1777.8242	1777.8242	K	S	175	189
PSM	ATAGDTHLGGEDFDNR	271	sp|P48741|HSP77_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=1567	23.787	3	1708.7865	1708.7865	K	L	223	239
PSM	EQVANSAFVER	272	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=1608	24.093	2	1282.673	1282.6730	K	V	492	503
PSM	FWEVISDEHGIDPTGTYHGDSDLQLDR	273	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=4864	49.59	4	3215.4297	3215.4297	K	I	20	47
PSM	GEPNVSYICSR	274	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2182	28.386	2	1394.6114	1394.6114	R	Y	210	221
PSM	HGRDDSFDSLDSFGSR	275	sp|Q9UPQ0-9|LIMC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2933	33.971	3	1910.8009	1910.8009	R	S	42	58
PSM	HGYIGEFEIIDDHR	276	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=3472	38.068	3	1733.8586	1733.8586	K	A	44	58
PSM	HVGSNLCLDSR	277	sp|Q10471|GALT2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=1708	24.847	2	1370.6226	1370.6226	R	T	533	544
PSM	ITPSYVAFTPEGER	278	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3989	42.194	2	1679.802	1679.8020	R	L	61	75
PSM	KEESEESDDDMGFGLFD	279	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=5025	51.189	2	2016.8783	2016.8783	K	-	99	116
PSM	LATQSNEITIPVTFESR	280	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=4780	48.772	3	2019.0138	2019.0138	K	A	172	189
PSM	MNESDIWFEEK	281	sp|Q13596-2|SNX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4773	48.705	2	1574.7	1574.7000	K	L	237	248
PSM	MSGFIYQGK	282	sp|Q15052-2|ARHG6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3341	37.032	2	1177.5879	1177.5879	R	I	333	342
PSM	MTISQQEFGR	283	sp|P55036|PSMD4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2752	32.627	2	1309.595	1309.5950	K	T	263	273
PSM	NNSFTAPSTVGK	284	sp|O95453-4|PARN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1890	26.207	2	1369.6915	1369.6915	R	R	380	392
PSM	NQSFCPTVNLDK	285	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=3221	36.135	2	1569.7535	1569.7535	R	L	66	78
PSM	QLSSSSSYSGDISR	286	sp|P33527-8|MRP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1852	25.921	2	1586.7038	1586.7038	R	H	798	812
PSM	RTESVPSDINNPVDR	287	sp|Q8IVT5-4|KSR1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1908	26.339	3	1811.8627	1811.8627	R	A	266	281
PSM	SASITNLSLDR	288	sp|Q9Y2I7-2|FYV1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3187	35.884	2	1289.6441	1289.6441	R	S	208	219
PSM	SDSQASLTVPLSPQVVR	289	sp|Q8TEV9-2|SMCR8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4312	44.777	2	1896.977	1896.9770	K	S	487	504
PSM	SGSYSYLEER	290	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2474	30.544	2	1303.5546	1303.5546	R	K	821	831
PSM	SGTSEFLNK	291	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=1943	26.595	2	1095.5062	1095.5062	K	M	169	178
PSM	SGTSEFLNK	292	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=1948	26.633	2	1129.5693	1129.5693	K	M	169	178
PSM	SMSAPVIFDR	293	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4121	43.216	2	1235.5834	1235.5834	K	S	117	127
PSM	SPSPEPIYNSEGK	294	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1865	26.019	2	1551.7494	1551.7494	R	R	80	93
PSM	SSILLDVKPWDDETDMAK	295	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,8-UNIMOD:510,16-UNIMOD:35,18-UNIMOD:510	ms_run[2]:scan=4799	48.919	3	2260.1435	2260.1435	K	L	140	158
PSM	SSSSPELQTLQDILGDPGDK	296	sp|P49815-7|TSC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=6065	64.731	3	2234.0992	2234.0992	K	A	1270	1290
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	297	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510	ms_run[2]:scan=1016	19.585	4	3246.2875	3246.2875	R	K	494	522
PSM	THSTSSSLGSGESPFSR	298	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1961	26.732	3	1836.8104	1836.8104	R	S	240	257
PSM	TIEYLQPNPASR	299	sp|Q99961-3|SH3G1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3019	34.615	2	1501.739	1501.7390	R	A	54	66
PSM	TMTTNSSDPFLNSGTYHSR	300	sp|P46937-4|YAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,2-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2518	30.871	3	2244.9571	2244.9571	R	D	198	217
PSM	TRVTDSSVSVQLRE	301	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2454	30.397	3	1689.8511	1689.8511	R	-	262	276
PSM	TTPSYVAFTDTER	302	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=3074	35.033	2	1520.7571	1520.7571	R	L	37	50
PSM	VESRDKLPQPVQPDPVSHCK	303	sp|P05556-2|ITB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:510,19-UNIMOD:4,20-UNIMOD:510	ms_run[2]:scan=1685	24.668	4	2497.3249	2497.3249	K	E	673	693
PSM	VTDSSVSVQLRE	304	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2813	33.082	2	1432.7023	1432.7023	R	-	264	276
PSM	VVGCSCVVVK	305	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,4-UNIMOD:4,5-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:510	ms_run[2]:scan=1911	26.362	2	1253.6549	1253.6550	K	D	103	113
PSM	YLSMSRSDIFNDV	306	sp|Q68DH5|LMBD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=5143	52.386	2	1659.7428	1659.7428	R	-	683	696
PSM	PGTETEESMGGGEGNHR	307	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0		ms_run[1]:scan=702	16.487485	3	1743.7086	1743.7113	D	A	2014	2031
PSM	VYESESCTDSEEELNMK	308	sp|Q15054|DPOD3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,16-UNIMOD:35,17-UNIMOD:510	ms_run[1]:scan=2005	27.05543333333333	3	2212.9040	2212.9060	K	T	404	421
PSM	HVPDSGATATAYLCGVK	309	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[1]:scan=3247	36.328295000000004	3	1893.9310	1893.9327	K	G	110	127
PSM	SGTSEFLNK	310	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:510	ms_run[1]:scan=1948	26.632815	2	1129.567772	1129.569290	K	M	169	178
PSM	GLNSESMTEETLK	311	sp|P31327|CPSM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,7-UNIMOD:35,11-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=1915	26.3907	2	1601.750748	1601.753205	K	R	893	906
PSM	QIESSDYDSSSSKGR	312	sp|Q9UNL4-4|ING4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,5-UNIMOD:21,7-UNIMOD:21,10-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=3179	35.824508333333334	2	1998.640312	1998.651164	K	T	115	130