MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100712_016PKN2.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100712_016PKN2.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	46.0	null	228-UNIMOD:510	0.09	46.0	7	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	44.0	null	203-UNIMOD:510,221-UNIMOD:510	0.05	44.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	204-UNIMOD:510,213-UNIMOD:35,222-UNIMOD:510	0.09	41.0	2	1	0
PRT	sp|Q16513|PKN2_HUMAN	Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	595-UNIMOD:510,603-UNIMOD:21,620-UNIMOD:510,620-UNIMOD:21,625-UNIMOD:510,628-UNIMOD:21,631-UNIMOD:21,581-UNIMOD:510,582-UNIMOD:21,624-UNIMOD:21,590-UNIMOD:21,636-UNIMOD:21,351-UNIMOD:510,360-UNIMOD:21,362-UNIMOD:21,366-UNIMOD:21,369-UNIMOD:35,615-UNIMOD:21,619-UNIMOD:510	0.09	40.0	10	5	2
PRT	sp|Q15185-4|TEBP_HUMAN	Isoform 4 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	108-UNIMOD:510,117-UNIMOD:35	0.12	39.0	1	1	0
PRT	sp|Q16513-3|PKN2_HUMAN	Isoform 3 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	572-UNIMOD:510,572-UNIMOD:21,577-UNIMOD:510,580-UNIMOD:21,533-UNIMOD:510,535-UNIMOD:21,574-UNIMOD:21,583-UNIMOD:21,588-UNIMOD:21,542-UNIMOD:21,291-UNIMOD:510,302-UNIMOD:21,306-UNIMOD:21,309-UNIMOD:510,310-UNIMOD:21,311-UNIMOD:35,323-UNIMOD:510,172-UNIMOD:510,175-UNIMOD:21,184-UNIMOD:510,21-UNIMOD:510,29-UNIMOD:21,33-UNIMOD:510,891-UNIMOD:510,910-UNIMOD:21,34-UNIMOD:510,37-UNIMOD:21,44-UNIMOD:510,518-UNIMOD:510,534-UNIMOD:21,39-UNIMOD:21,100-UNIMOD:510,110-UNIMOD:21,118-UNIMOD:4,121-UNIMOD:21,124-UNIMOD:21,351-UNIMOD:510,353-UNIMOD:21,364-UNIMOD:21,367-UNIMOD:21,369-UNIMOD:35,40-UNIMOD:35	0.22	38.0	20	11	6
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	38.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	221-UNIMOD:510,37-UNIMOD:510	0.06	37.0	3	2	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	36.0	1	1	0
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	36.0	null	144-UNIMOD:510,147-UNIMOD:21,169-UNIMOD:510	0.10	36.0	1	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	34.0	1	1	0
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	299-UNIMOD:510,302-UNIMOD:510,314-UNIMOD:21,323-UNIMOD:510	0.04	33.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	33.0	2	1	0
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	14-UNIMOD:510	0.06	33.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	323-UNIMOD:510	0.06	33.0	1	1	1
PRT	sp|P00338-5|LDHA_HUMAN	Isoform 5 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	43-UNIMOD:510,57-UNIMOD:510,158-UNIMOD:510,163-UNIMOD:4	0.12	32.0	2	2	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	28-UNIMOD:510	0.06	32.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	292-UNIMOD:510,306-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,187-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,492-UNIMOD:510,613-UNIMOD:510,623-UNIMOD:510,551-UNIMOD:510	0.11	31.0	7	7	7
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	228-UNIMOD:510	0.08	30.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	325-UNIMOD:510,336-UNIMOD:510,330-UNIMOD:35	0.03	30.0	2	1	0
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	108-UNIMOD:510,113-UNIMOD:21,118-UNIMOD:21	0.10	30.0	2	1	0
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	29.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	129-UNIMOD:510,139-UNIMOD:21,140-UNIMOD:21,126-UNIMOD:510	0.11	29.0	3	2	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	188-UNIMOD:510,200-UNIMOD:4,201-UNIMOD:510	0.02	29.0	1	1	1
PRT	sp|Q9UQ35-2|SRRM2_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	846-UNIMOD:510,848-UNIMOD:21	0.01	29.0	1	1	0
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	79-UNIMOD:510,96-UNIMOD:510,106-UNIMOD:21,116-UNIMOD:510,140-UNIMOD:510,141-UNIMOD:21,147-UNIMOD:510,155-UNIMOD:35,157-UNIMOD:510,140-UNIMOD:21	0.26	29.0	3	2	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	null	846-UNIMOD:510,854-UNIMOD:21	0.01	29.0	1	1	0
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510	0.03	28.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	239-UNIMOD:510,360-UNIMOD:510	0.08	28.0	2	2	2
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	28.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510	0.02	27.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	119-UNIMOD:510,136-UNIMOD:21,137-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	8-UNIMOD:510,23-UNIMOD:510	0.05	27.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	70-UNIMOD:510,75-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,37-UNIMOD:21	0.04	27.0	3	1	0
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	69-UNIMOD:510,75-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4,74-UNIMOD:21	0.20	26.0	2	1	0
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	77-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:510,7-UNIMOD:21	0.21	26.0	2	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510,82-UNIMOD:510,92-UNIMOD:510	0.15	26.0	2	2	2
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	542-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	50-UNIMOD:510,82-UNIMOD:510,96-UNIMOD:510	0.04	26.0	2	2	2
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	241-UNIMOD:510,243-UNIMOD:21,273-UNIMOD:510	0.08	26.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	81-UNIMOD:510,83-UNIMOD:21,91-UNIMOD:35,93-UNIMOD:510,86-UNIMOD:21	0.09	25.0	2	1	0
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	45-UNIMOD:510,57-UNIMOD:21	0.17	25.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	186-UNIMOD:510,186-UNIMOD:35,190-UNIMOD:21,193-UNIMOD:21,204-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q9H788-2|SH24A_HUMAN	Isoform 2 of SH2 domain-containing protein 4A OS=Homo sapiens OX=9606 GN=SH2D4A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	268-UNIMOD:510,270-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510,465-UNIMOD:510,467-UNIMOD:21,468-UNIMOD:21,474-UNIMOD:35,478-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510,465-UNIMOD:21	0.07	24.0	4	3	2
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	14-UNIMOD:510	0.06	24.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	120-UNIMOD:510,145-UNIMOD:510,219-UNIMOD:510,223-UNIMOD:4,229-UNIMOD:510	0.15	24.0	2	2	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	522-UNIMOD:510,543-UNIMOD:510,20-UNIMOD:510	0.05	24.0	2	2	2
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	64-UNIMOD:510,68-UNIMOD:4,75-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	475-UNIMOD:510,479-UNIMOD:21,494-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	462-UNIMOD:510,468-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	null	155-UNIMOD:510,161-UNIMOD:4	0.07	24.0	1	1	1
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	424-UNIMOD:510,446-UNIMOD:21,447-UNIMOD:510	0.05	24.0	1	1	0
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	223-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	237-UNIMOD:510,241-UNIMOD:21,246-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	99-UNIMOD:510	0.16	23.0	1	1	0
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	65-UNIMOD:510,68-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:510	0.09	23.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	80-UNIMOD:510,82-UNIMOD:21,92-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	161-UNIMOD:510,171-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|Q13480-2|GAB1_HUMAN	Isoform 2 of GRB2-associated-binding protein 1 OS=Homo sapiens OX=9606 GN=GAB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	545-UNIMOD:510,547-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	207-UNIMOD:510,218-UNIMOD:35	0.14	22.0	1	1	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	172-UNIMOD:510,174-UNIMOD:21,175-UNIMOD:21,184-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	21.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	8-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	78-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	571-UNIMOD:510,583-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	186-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	11-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	220-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	172-UNIMOD:510,177-UNIMOD:4	0.07	21.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	301-UNIMOD:510,312-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P62316-2|SMD2_HUMAN	Isoform 2 of Small nuclear ribonucleoprotein Sm D2 OS=Homo sapiens OX=9606 GN=SNRPD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	28-UNIMOD:510,36-UNIMOD:4	0.10	21.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	48-UNIMOD:510,52-UNIMOD:21,62-UNIMOD:510	0.09	21.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	221-UNIMOD:510,223-UNIMOD:21,231-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	821-UNIMOD:510,823-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P61313-2|RL15_HUMAN	Isoform 2 of 60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	97-UNIMOD:510,100-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	192-UNIMOD:510,194-UNIMOD:21,207-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	98-UNIMOD:510,108-UNIMOD:35	0.16	21.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	46.0	1-UNIMOD:510	ms_run[1]:scan=4715	48.92734333333333	2	2226.933808	2226.936145	R	-	228	248
PSM	DATNVGDEGGFAPNILENK	2	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	44.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[1]:scan=4385	45.86945333333333	2	2028.042630	2028.043634	K	E	203	222
PSM	DNLTLWTSDMQGDGEEQNK	3	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3859	41.142	2	2264.0539	2264.0539	R	E	204	223
PSM	VLDIPGQDSETVFDIQNDR	4	sp|Q16513|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=5175	53.907893333333334	2	2274.061992	2274.062940	R	N	595	614
PSM	DNLTLWTSDMQGDGEEQNK	5	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4523	47.158	2	2248.059	2248.0590	R	E	204	223
PSM	DWEDDSDEDMSNFDR	6	sp|Q15185-4|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=3000	34.136	2	1924.7117	1924.7117	K	F	108	123
PSM	SQSEYKPDTPQSGLEYSGIQELEDR	7	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,1-UNIMOD:21,6-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4833	50.037	3	3083.3686	3083.3686	K	R	572	597
PSM	TPEELDDSDFETEDFDVR	8	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4794	49.647	2	2271.9157	2271.9157	R	S	264	282
PSM	STAGDTHLGGEDFDNR	9	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=1676	24.288	2	1724.7814	1724.7814	K	M	221	237
PSM	DSSTSPGDYVLSVSENSR	10	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4469	46.628	2	2012.8788	2012.8788	R	V	39	57
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	11	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=4046	42.729996666666665	3	3090.342459	3090.345078	K	E	144	170
PSM	DNLTLWTSDQQDDDGGEGNN	12	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:510	ms_run[1]:scan=4602	47.92507	2	2226.9335	2226.9356	R	-	228	248
PSM	ASSLGEIDESSELR	13	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3353	36.897	2	1605.7347	1605.7347	R	V	533	547
PSM	SQSEYKPDTPQSGLEYSGIQELEDR	14	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=5197	54.195	3	3163.335	3163.3350	K	R	572	597
PSM	SQSEYKPDTPQSGLEYSGIQELEDR	15	sp|Q16513|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:510,1-UNIMOD:21,6-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=5197	54.194875	3	3163.3317	3163.3344	K	R	620	645
PSM	ASSLGEIDESSELR	16	sp|Q16513|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3353	36.897145	2	1605.733741	1605.734730	R	V	581	595
PSM	SQSEYKPDTPQSGLEYSGIQELEDR	17	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,6-UNIMOD:510,9-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=4574	47.663	3	3083.3686	3083.3686	K	R	572	597
PSM	DSSTSPGDYVLSVSENSR	18	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4469	46.62809166666667	2	2012.8766	2012.8783	R	V	39	57
PSM	ALFKPPEDSQDDESDSDAEEEQTTK	19	sp|Q13769|THOC5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,4-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=2810	32.672	3	2992.3447	2992.3447	K	R	299	324
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	20	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2107	27.443	3	2826.1852	2826.1852	R	E	418	442
PSM	IQALQQQADEAEDR	21	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=1890	25.854	2	1647.8276	1647.8276	K	A	14	28
PSM	TAENATSGETLEENEAGD	22	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=1836	25.454	2	1870.8128	1870.8128	K	-	323	341
PSM	SQSEYKPDTPQSGLEYSGIQELEDR	23	sp|Q16513|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=5197	54.194875	3	3163.332273	3163.334954	K	R	620	645
PSM	ASSLGEIDESSELR	24	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=3744	40.083	2	1685.7011	1685.7011	R	V	533	547
PSM	DLADELALVDVIEDK	25	sp|P00338-5|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6102	68.111	2	1724.972	1724.9720	K	L	43	58
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	26	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2561	30.807	3	2810.1902	2810.1902	R	E	418	442
PSM	SVTEQGAELSNEER	27	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=1520	23.14	2	1581.7695	1581.7695	K	N	28	42
PSM	ASSLGEIDESSELR	28	sp|Q16513|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:510,2-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=3744	40.082865000000005	2	1685.6994	1685.7005	R	V	581	595
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	29	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=3216	35.842	3	3112.2782	3112.2782	K	L	595	622
PSM	NPDDITQEEYGEFYK	30	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3869	41.216	2	1914.916	1914.9160	R	S	292	307
PSM	SQSEYKPDTPQSGLEYSGIQELEDR	31	sp|Q16513|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,6-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=4924	51.022596666666665	3	3163.3323	3163.3344	K	R	620	645
PSM	DNLTLWTSDQQDEEAGEGN	32	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=4679	48.616	2	2154.9402	2154.9402	R	-	228	247
PSM	ELISNASDALDK	33	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2710	31.908	2	1342.7616	1342.7616	R	I	42	54
PSM	EVDEQMLNVQNK	34	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2637	31.366	2	1513.8083	1513.8083	K	N	325	337
PSM	IIIEELSLVAASPTLSPR	35	sp|Q16513-3|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=5906	64.819	2	2102.089	2102.0890	R	Q	291	309
PSM	QSMISTQNQYSTLSK	36	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:21,3-UNIMOD:35,15-UNIMOD:510	ms_run[2]:scan=2250	28.48	2	1878.9071	1878.9071	R	P	309	324
PSM	DWEDDSDEDMSNFDR	37	sp|Q15185|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=4267	44.74280666666667	2	1989.6842	1988.6822	K	F	108	123
PSM	ASSLGEIDESSELR	38	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=3874	41.254	2	1685.7011	1685.7011	R	V	533	547
PSM	ESLKEEDESDDDNM	39	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=972	18.856	2	1738.7364	1738.7364	K	-	235	249
PSM	IEDVTPIPSDSTR	40	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2843	32.937	2	1542.7391	1542.7391	R	R	129	142
PSM	QDENDDDDDWNPCK	41	sp|Q14974-2|IMB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=2242	28.422	2	1832.7432	1832.7432	K	A	188	202
PSM	SGTPPRQGSITSPQANEQSVTPQR	42	sp|Q9UQ35-2|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1775	25.01	3	2636.2768	2636.2768	K	R	846	870
PSM	YGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAK	43	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,18-UNIMOD:510,28-UNIMOD:21,38-UNIMOD:510	ms_run[2]:scan=4754	49.265	3	4205.7706	4205.7706	K	R	79	117
PSM	SGTPPRQGSITSPQANEQSVTPQR	44	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=1775	25.009703333333334	3	2636.2718	2636.2763	K	R	846	870
PSM	DNLTLWTSDQQDDDGGEGNN	45	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=5469	58.122	2	2226.9361	2226.9361	R	-	228	248
PSM	QVPDSAATATAYLCGVK	46	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=4270	44.766	2	1898.9485	1898.9486	R	A	107	124
PSM	SYELPDGQVITIGNER	47	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=4681	48.632	2	1823.9478	1823.9478	K	F	239	255
PSM	TAFQEALDAAGDK	48	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3224	35.903	2	1403.7569	1403.7569	K	L	9	22
PSM	DNLTLWTSDQQDDDGGEGNN	49	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510	ms_run[1]:scan=4824	49.941245	2	2226.9333	2226.9356	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	50	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510	ms_run[1]:scan=4917	50.957586666666664	2	2226.933808	2226.936145	R	-	228	248
PSM	ASSLGEIDESSELR	51	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3221	35.88	2	1605.7347	1605.7347	R	V	533	547
PSM	ETVSEESNVLCLSK	52	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3249	36.091	2	1661.8818	1661.8818	R	S	581	595
PSM	EVDEQMLNVQNK	53	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1668	24.231	2	1529.8032	1529.8032	K	N	325	337
PSM	GAEAANVTGPGGVPVQGSK	54	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,18-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2135	27.647	2	1842.9513	1842.9513	K	Y	119	138
PSM	LIAPVAEEEATVPNNK	55	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2879	33.216	2	1762.0149	1762.0149	K	I	8	24
PSM	TDYNASVSVPDSSGPER	56	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2595	31.056	2	1893.8206	1893.8206	R	I	70	87
PSM	ASSLGEIDESSELR	57	sp|Q16513|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=3221	35.880426666666665	2	1605.7333	1605.7342	R	V	581	595
PSM	GILAADESTGSIAK	58	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2752	32.21505833333333	2	1479.7839	1479.7853	K	R	29	43
PSM	AFGESSTESDEEEEEGCGHTHCVR	59	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=1532	23.229	3	2852.0751	2852.0751	R	G	69	93
PSM	DLIHDQDEDEEEEEGQR	60	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1939	26.21	3	2118.9038	2118.9038	R	F	77	94
PSM	EDQTEYLEER	61	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1889	25.847	2	1344.6258	1344.6258	K	R	187	197
PSM	EGLELPEDEEEK	62	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2801	32.592	2	1483.7566	1483.7566	K	K	539	551
PSM	EQVANSAFVER	63	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1733	24.704	2	1282.673	1282.6730	K	V	492	503
PSM	GHQQLYWSHPR	64	sp|P62273|RS29_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1566	23.475	2	1521.7091	1521.7091	M	K	2	13
PSM	GILAADESTGSIAK	65	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2752	32.215	2	1479.7858	1479.7858	K	R	29	43
PSM	HELQANCYEEVK	66	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1404	22.279	2	1586.8035	1586.8035	K	D	133	145
PSM	HGSYEDAVHSGALND	67	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1747	24.803	2	1604.7279	1604.7279	K	-	542	557
PSM	QSMISTQNQYSTLSK	68	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,2-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2970	33.915	2	1862.9122	1862.9122	R	P	309	324
PSM	QVPDSAATATAYLCGVK	69	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=4280	44.841	2	1898.9485	1898.9486	R	A	107	124
PSM	VEIIANDQGNR	70	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510	ms_run[1]:scan=1562	23.4476	2	1261.6819	1261.6834	R	I	50	61
PSM	QISYNYSDLDQSNVTEETPEGEEHHPVADTENK	71	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,33-UNIMOD:510	ms_run[1]:scan=3505	38.10753	4	3922.7299	3922.7326	K	E	241	274
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	72	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=4879	50.59494166666667	3	2995.3847	2995.3854	R	G	2913	2938
PSM	AFGESSTESDEEEEEGCGHTHCVR	73	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1532	23.22931833333333	3	2853.0722	2852.0742	R	G	69	93
PSM	IEDVTPIPSDSTR	74	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[1]:scan=2843	32.937104999999995	2	1542.738384	1542.739087	R	R	129	142
PSM	AITGASLADIMAK	75	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:35,13-UNIMOD:510	ms_run[2]:scan=3706	39.76	2	1424.7623	1424.7623	R	R	81	94
PSM	AITGASLADIMAK	76	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5192	54.157	2	1488.7337	1488.7337	R	R	81	94
PSM	FASENDLPEWK	77	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4279	44.834	2	1482.7068	1482.7068	R	E	58	69
PSM	IVRGDQPAASGDSDDDEPPPLPR	78	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2435	29.873	3	2517.1597	2517.1597	K	L	45	68
PSM	LHGTAQQLLQDSK	79	sp|Q16513-3|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2340	29.143	2	1585.8502	1585.8502	K	T	172	185
PSM	MLAESDESGDEESVSQTDKTELQNTLR	80	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:35,5-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3910	41.565	3	3255.4051	3255.4051	K	T	186	213
PSM	NNSGEEFDCAFR	81	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2736	32.098	2	1478.6309	1478.6309	R	L	355	367
PSM	NQLTSNPENTVFDAK	82	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=2994	34.092	2	1744.9268	1744.9268	K	R	82	97
PSM	SLPFSENVSAVQK	83	sp|Q16513-3|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,9-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3933	41.781	2	1552.8175	1552.8175	R	L	21	34
PSM	TLSSSAQEDIIR	84	sp|Q9H788-2|SH24A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2807	32.65	2	1432.7023	1432.7023	R	W	268	280
PSM	ESEDKPEIEDVGSDEEEEK	85	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=1984	26.542	3	2294.1022	2294.1022	K	K	251	270
PSM	GILAADESTGSIAK	86	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,14-UNIMOD:510	ms_run[2]:scan=2355	29.259	2	1399.8195	1399.8195	K	R	29	43
PSM	GREDVSNFDDEFTSEAPILTPPREPR	87	sp|Q16513-3|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=4460	46.559	3	3087.4399	3087.4399	R	I	891	917
PSM	IQVLQQQADDAEER	88	sp|P06753-4|TPM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2230	28.338	2	1675.8589	1675.8589	K	A	14	28
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	89	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,26-UNIMOD:510	ms_run[2]:scan=3677	39.543	3	3010.3787	3010.3787	K	E	120	146
PSM	LDFSDTMVQQK	90	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4092	43.089	2	1458.7102	1458.7102	K	L	34	45
PSM	MQVDQEEPHVEEQQQQTPAENK	91	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,22-UNIMOD:510	ms_run[2]:scan=1770	24.973	3	2689.2926	2689.2926	K	A	522	544
PSM	NQDECVIALHDCNGDVNR	92	sp|Q14157-4|UBP2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=2220	28.266	3	2161.9693	2161.9693	K	A	64	82
PSM	RLSQSDEDVIR	93	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1736	24.725	2	1430.6979	1430.6979	K	L	119	130
PSM	TGRDTPENGETAIGAENSEK	94	sp|Q8N3X1|FNBP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=1274	21.289	3	2223.0329	2223.0329	K	I	475	495
PSM	VIGSGCNLDSAR	95	sp|P00338-5|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1384	22.129	2	1281.656	1281.6560	R	F	158	170
PSM	YALYDATYETK	96	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2993	34.085	2	1404.7449	1404.7449	R	E	82	93
PSM	YEQGTGCWQGPNR	97	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=1729	24.674	2	1585.7156	1585.7156	K	S	462	475
PSM	YYTSASGDEMVSLK	98	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:35,14-UNIMOD:510	ms_run[2]:scan=3049	34.503	2	1793.7508	1793.7508	R	D	465	479
PSM	KITIADCGQLE	99	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[1]:scan=2632	31.32983333333333	2	1314.7481	1314.7484	K	-	155	166
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	100	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,23-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=2561	30.80739666666667	3	2810.185253	2810.190250	R	E	424	448
PSM	ATAGDTHLGGEDFDNR	101	sp|P48741|HSP77_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1703	24.484	3	1708.7865	1708.7865	K	L	223	239
PSM	GYFEYIEENK	102	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3814	40.813	2	1438.6694	1438.6694	R	Y	237	247
PSM	KEESEESDDDMGFGLFD	103	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=5027	52.093	2	2016.8783	2016.8783	K	-	99	116
PSM	LDFDLEPEPPPAPPRASSLGEIDESSELR	104	sp|Q16513-3|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,17-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=5607	60.164	3	3356.5315	3356.5315	K	V	518	547
PSM	LDFSDTMVQQK	105	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3835	40.966	2	1458.7102	1458.7102	K	L	34	45
PSM	LQELNAHIVVSDPEDITDCPRTPDTPNNDPR	106	sp|Q16513-3|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21,19-UNIMOD:4,22-UNIMOD:21,25-UNIMOD:21	ms_run[2]:scan=4527	47.2	3	3801.6208	3801.6208	K	C	100	131
PSM	QEYDESGPSIVHR	107	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1564	23.461	3	1549.7585	1549.7585	K	K	360	373
PSM	RNQSFCPTVNLDK	108	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2547	30.705	2	1725.8546	1725.8546	K	L	65	78
PSM	SPSPEPIYNSEGK	109	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1989	26.579	2	1551.7494	1551.7494	R	R	80	93
PSM	ATSVALPGWSPSETRSSFMSR	110	sp|Q16513|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:21,16-UNIMOD:21,19-UNIMOD:35	ms_run[1]:scan=4913	50.927618333333335	3	2543.0408	2543.0413	K	T	351	372
PSM	SQSEYKPDTPQSGLEYSGIQELEDR	111	sp|Q16513|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,6-UNIMOD:510,9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=5102	53.02349833333333	3	3163.3330	3163.3344	K	R	620	645
PSM	DNLTLWTSDQQDDDGGEGNN	112	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510	ms_run[1]:scan=6846	81.646045	2	2227.9382	2226.9352	R	-	228	248
PSM	ATSVALPGWSPSETRSSFMSR	113	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=4821	49.918	3	2543.0418	2543.0418	K	T	351	372
PSM	DNSTMGYMMAK	114	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2948	33.739	2	1315.6247	1315.6247	R	K	613	624
PSM	EGLELPEDEEEKK	115	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2251	28.487	3	1645.9147	1645.9147	K	K	539	552
PSM	LDFSDTMVQQK	116	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,7-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2968	33.9	2	1474.7051	1474.7051	K	L	34	45
PSM	LDFSDTMVQQK	117	sp|Q16513-3|PKN2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=3211	35.804	2	1474.7051	1474.7051	K	L	34	45
PSM	NFSDNQLQEGK	118	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1711	24.543	2	1346.7103	1346.7103	R	N	161	172
PSM	TDSQTIGDFATR	119	sp|Q13480-2|GAB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3031	34.369	2	1424.6397	1424.6397	R	R	545	557
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	120	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:35	ms_run[2]:scan=4180	43.919	3	3506.5004	3506.5004	R	-	207	238
PSM	VLDIPGQDSETVFDIQNDRNSILPK	121	sp|Q16513|PKN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,9-UNIMOD:21,21-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=5482	58.23431333333333	3	3040.4812	3040.4827	R	S	595	620
PSM	DNLTLWTSDQQDDDGGEGNN	122	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510	ms_run[1]:scan=6774	80.54011833333334	2	2228.9432	2226.9352	R	-	228	248
PSM	AHSSMVGVNLPQK	123	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=2824	32.79308666666667	2	1594.7609	1594.7611	R	A	172	185
PSM	AFLAELEQNSPK	124	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4072	42.938	2	1493.7803	1493.7803	K	I	2424	2436
PSM	AGGIETIANEYSDR	125	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3291	36.409	2	1528.7582	1528.7582	R	C	20	34
PSM	DVNQQEFVR	126	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2023	26.83	2	1167.6097	1167.6097	K	A	8	17
PSM	EIIDLVLDR	127	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=4662	48.477	2	1118.6759	1118.6759	K	I	78	87
PSM	ELISNSSDALDK	128	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2168	27.889	2	1358.7566	1358.7566	R	I	47	59
PSM	FNLTYVSHDGDDK	129	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2792	32.525	3	1577.7998	1577.7998	R	K	571	584
PSM	GDRSEDFGVNEDLADSDAR	130	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2820	32.762	3	2100.9408	2100.9408	K	A	186	205
PSM	GHQQLYWSHPR	131	sp|P62273|RS29_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1547	23.338	3	1521.7091	1521.7091	M	K	2	13
PSM	HGESAWNLENR	132	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1735	24.718	2	1345.6587	1345.6587	R	F	11	22
PSM	HWILPQDYDHAQAEAR	133	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3113	35.033	3	1982.9811	1982.9811	R	H	220	236
PSM	LQIQCVVEDDK	134	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=3176	35.548	2	1413.781	1413.7810	K	V	219	230
PSM	LTWHSCPEDEAQ	135	sp|Q13185|CBX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=2339	29.136	2	1505.6669	1505.6669	R	-	172	184
PSM	NNASTDYDLSDK	136	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1466	22.74	2	1409.6947	1409.6947	K	S	301	313
PSM	NNTQVLINCR	137	sp|P62316-2|SMD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=1594	23.68	2	1264.677	1264.6770	K	N	28	38
PSM	NRPTSISWDGLDSGK	138	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3622	39.108	2	1779.8829	1779.8829	K	L	48	63
PSM	RVSVCAETYNPDEEEEDTDPR	139	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2601	31.102	3	2624.0798	2624.0798	R	V	97	118
PSM	SASWGSADQLK	140	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2834	32.868	2	1296.6388	1296.6388	R	E	221	232
PSM	SGSYSYLEER	141	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2639	31.38	2	1303.5546	1303.5546	R	K	821	831
PSM	SLQSVAEER	142	sp|P61313-2|RL15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2325	29.03	2	1131.5385	1131.5385	R	A	97	106
PSM	SSILLDVKPWDDETDMAK	143	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,8-UNIMOD:510,16-UNIMOD:35,18-UNIMOD:510	ms_run[2]:scan=4764	49.354	3	2260.1435	2260.1435	K	L	140	158
PSM	STAGDTHLGGEDFDNR	144	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1664	24.202	3	1724.7814	1724.7814	K	M	221	237
PSM	TASFSESRADEVAPAK	145	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1874	25.736	2	1812.8931	1812.8931	R	K	192	208
PSM	TTPSYVAFTDTER	146	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3194	35.679	2	1520.7571	1520.7571	R	L	37	50
PSM	YYTSASGDEMVSLK	147	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:35,14-UNIMOD:510	ms_run[1]:scan=3049	34.50274833333334	2	1793.7495	1793.7503	R	D	465	479
PSM	SSILLDVKPWDDETDMAK	148	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,8-UNIMOD:510,16-UNIMOD:35,18-UNIMOD:510	ms_run[1]:scan=4764	49.353653333333334	3	2260.143016	2260.143470	K	L	140	158
PSM	IGRIEDVTPIPSDSTR	149	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[1]:scan=3275	36.28746833333334	2	1869.9472	1868.9452	K	R	126	142
PSM	KEESEESDDDMGFGLFD	150	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[1]:scan=4316	45.17773833333333	2	2032.872623	2032.873182	K	-	98	115
PSM	DWEDDSDEDMSNFDR	151	sp|Q15185|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=4267	44.74280666666667	2	1989.685594	1988.683164	K	F	108	123