MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100709_016MAP2K4.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100709_016MAP2K4.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	228-UNIMOD:510	0.09	44.0	7	1	0
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	333-UNIMOD:510,336-UNIMOD:21	0.06	42.0	1	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	204-UNIMOD:510,222-UNIMOD:510,213-UNIMOD:35,223-UNIMOD:510,121-UNIMOD:510,131-UNIMOD:510	0.18	41.0	5	3	2
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	16-UNIMOD:510,35-UNIMOD:21,47-UNIMOD:4,48-UNIMOD:510	0.05	41.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	180-UNIMOD:510,182-UNIMOD:21,186-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	239-UNIMOD:510,240-UNIMOD:21,360-UNIMOD:510,19-UNIMOD:510	0.11	39.0	5	3	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	230-UNIMOD:510,231-UNIMOD:21,232-UNIMOD:21,230-UNIMOD:21	0.04	38.0	4	1	0
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	221-UNIMOD:510	0.03	38.0	1	1	1
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	463-UNIMOD:510,473-UNIMOD:21,482-UNIMOD:510	0.01	37.0	1	1	1
PRT	sp|Q96S44|PRPK_HUMAN	EKC/KEOPS complex subunit TP53RK OS=Homo sapiens OX=9606 GN=TP53RK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	6-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:21	0.09	37.0	4	1	0
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	39-UNIMOD:510,40-UNIMOD:21	0.09	36.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	292-UNIMOD:510,301-UNIMOD:21,306-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,305-UNIMOD:21,457-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510,379-UNIMOD:510	0.10	36.0	8	5	4
PRT	sp|P17544-5|ATF7_HUMAN	Isoform 5 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	42-UNIMOD:510,51-UNIMOD:21,53-UNIMOD:21	0.14	36.0	4	1	0
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	223-UNIMOD:510,28-UNIMOD:510	0.16	35.0	2	2	2
PRT	sp|Q15185-2|TEBP_HUMAN	Isoform 2 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	75-UNIMOD:510,84-UNIMOD:35,80-UNIMOD:21	0.13	34.0	2	1	0
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	45-UNIMOD:510,57-UNIMOD:21	0.17	34.0	1	1	1
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	299-UNIMOD:510,302-UNIMOD:510,314-UNIMOD:21,323-UNIMOD:510	0.04	33.0	1	1	1
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	207-UNIMOD:510,218-UNIMOD:35	0.14	33.0	2	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	82-UNIMOD:510,94-UNIMOD:21,469-UNIMOD:510,502-UNIMOD:510	0.10	33.0	2	2	2
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	871-UNIMOD:510,886-UNIMOD:21,885-UNIMOD:21	0.01	33.0	3	1	0
PRT	sp|Q5VSL9-3|STRP1_HUMAN	Isoform 3 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	69-UNIMOD:510,71-UNIMOD:21,85-UNIMOD:510	0.04	32.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	73-UNIMOD:510,83-UNIMOD:35,79-UNIMOD:21	0.20	32.0	3	1	0
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	158-UNIMOD:510,160-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	203-UNIMOD:510,221-UNIMOD:510	0.05	31.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	328-UNIMOD:510,330-UNIMOD:21,340-UNIMOD:510	0.03	31.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	43-UNIMOD:510,57-UNIMOD:510,175-UNIMOD:510,181-UNIMOD:21,185-UNIMOD:510,100-UNIMOD:510,105-UNIMOD:4	0.15	30.0	3	3	3
PRT	sp|P52948-4|NUP98_HUMAN	Isoform 4 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	600-UNIMOD:510,606-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	581-UNIMOD:510,591-UNIMOD:4,594-UNIMOD:510,689-UNIMOD:510,693-UNIMOD:4,697-UNIMOD:35	0.03	30.0	2	2	2
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	355-UNIMOD:510,360-UNIMOD:21,366-UNIMOD:21	0.06	30.0	2	1	0
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	223-UNIMOD:510	0.09	29.0	2	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	325-UNIMOD:510,336-UNIMOD:510,330-UNIMOD:35	0.03	29.0	2	1	0
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	145-UNIMOD:510,169-UNIMOD:510	0.06	29.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	300-UNIMOD:510,309-UNIMOD:21,314-UNIMOD:510,547-UNIMOD:510,558-UNIMOD:510,47-UNIMOD:510,53-UNIMOD:21,58-UNIMOD:510,192-UNIMOD:510,251-UNIMOD:510,255-UNIMOD:510,269-UNIMOD:510	0.10	29.0	6	5	4
PRT	sp|Q13158|FADD_HUMAN	FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	190-UNIMOD:510,194-UNIMOD:21,193-UNIMOD:35,196-UNIMOD:35,197-UNIMOD:21	0.10	29.0	3	1	0
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	28.0	1	1	1
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	269-UNIMOD:510,295-UNIMOD:21,298-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	340-UNIMOD:510,344-UNIMOD:21,353-UNIMOD:510	0.04	28.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	57-UNIMOD:510,73-UNIMOD:510	0.10	27.0	1	1	1
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	1909-UNIMOD:510,1913-UNIMOD:21,1920-UNIMOD:21,1922-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	416-UNIMOD:510,418-UNIMOD:21,420-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	125-UNIMOD:510	0.01	26.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	26.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	14-UNIMOD:510	0.06	26.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	61-UNIMOD:510,69-UNIMOD:21,563-UNIMOD:510,573-UNIMOD:510,102-UNIMOD:510,113-UNIMOD:510	0.06	26.0	3	3	3
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	120-UNIMOD:510,123-UNIMOD:21,145-UNIMOD:510	0.11	26.0	1	1	1
PRT	sp|P15336-3|ATF2_HUMAN	Isoform 3 of Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	60-UNIMOD:510,69-UNIMOD:21,71-UNIMOD:21	0.08	26.0	3	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	310-UNIMOD:510,320-UNIMOD:21	0.04	26.0	1	1	0
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	815-UNIMOD:510,822-UNIMOD:21,823-UNIMOD:21,815-UNIMOD:21,819-UNIMOD:21,817-UNIMOD:21	0.03	26.0	3	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	1072-UNIMOD:510,1084-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	25-UNIMOD:510,34-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	25.0	1	1	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	8-UNIMOD:510,23-UNIMOD:510,320-UNIMOD:510,320-UNIMOD:21,329-UNIMOD:510	0.08	25.0	2	2	2
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	63-UNIMOD:510,64-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	186-UNIMOD:510,186-UNIMOD:35,190-UNIMOD:21,204-UNIMOD:510,193-UNIMOD:21	0.03	25.0	2	2	2
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	100-UNIMOD:510,101-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	25.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	241-UNIMOD:510,244-UNIMOD:21,246-UNIMOD:4,253-UNIMOD:510	0.02	25.0	1	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	82-UNIMOD:510,92-UNIMOD:510,133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510	0.15	25.0	2	2	2
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	259-UNIMOD:510,261-UNIMOD:21,264-UNIMOD:4,271-UNIMOD:510	0.02	25.0	1	1	0
PRT	sp|Q9BRX2|PELO_HUMAN	Protein pelota homolog OS=Homo sapiens OX=9606 GN=PELO PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	368-UNIMOD:510,374-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	11-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	268-UNIMOD:510,279-UNIMOD:21,193-UNIMOD:510,199-UNIMOD:21,205-UNIMOD:4	0.10	24.0	2	2	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	188-UNIMOD:510,200-UNIMOD:4,201-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	871-UNIMOD:510,872-UNIMOD:4,876-UNIMOD:21,882-UNIMOD:510,1644-UNIMOD:510,1648-UNIMOD:21,1664-UNIMOD:510	0.01	24.0	2	2	2
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	305-UNIMOD:510,307-UNIMOD:21,318-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P45985|MP2K4_HUMAN	Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	55-UNIMOD:510,56-UNIMOD:21,60-UNIMOD:21,55-UNIMOD:21,245-UNIMOD:510,246-UNIMOD:4,257-UNIMOD:21,260-UNIMOD:510,261-UNIMOD:21,59-UNIMOD:510,66-UNIMOD:21,384-UNIMOD:510,388-UNIMOD:35,393-UNIMOD:21,391-UNIMOD:21,394-UNIMOD:21,396-UNIMOD:35	0.15	24.0	6	4	2
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	92-UNIMOD:510,97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,106-UNIMOD:21,112-UNIMOD:4,116-UNIMOD:4,117-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|P15336|ATF2_HUMAN	Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	60-UNIMOD:510,69-UNIMOD:21,73-UNIMOD:21,71-UNIMOD:21	0.03	24.0	3	1	0
PRT	sp|P17544|ATF7_HUMAN	Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	42-UNIMOD:510,53-UNIMOD:21,55-UNIMOD:21	0.03	24.0	1	1	0
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	428-UNIMOD:510,435-UNIMOD:21,442-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1153-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	95-UNIMOD:510,101-UNIMOD:4	0.11	23.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	334-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	656-UNIMOD:510,658-UNIMOD:21,669-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	80-UNIMOD:510,82-UNIMOD:21,92-UNIMOD:510,67-UNIMOD:510	0.05	23.0	2	2	2
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	323-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|P22492|H1T_HUMAN	Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	69-UNIMOD:510,79-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	173-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q12968-5|NFAC3_HUMAN	Isoform 5 of Nuclear factor of activated T-cells, cytoplasmic 3 OS=Homo sapiens OX=9606 GN=NFATC3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	159-UNIMOD:510,165-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	995-UNIMOD:510,999-UNIMOD:21,1013-UNIMOD:510	0.01	22.0	1	1	1
PRT	sp|Q6GYQ0-3|RGPA1_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	1047-UNIMOD:510,1047-UNIMOD:21,1063-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	86-UNIMOD:510,87-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	47-UNIMOD:510,52-UNIMOD:21,58-UNIMOD:510	0.04	22.0	1	1	0
PRT	sp|O00115-2|DNS2A_HUMAN	Isoform 2 of Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	66-UNIMOD:510,70-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|O60716-24|CTND1_HUMAN	Isoform 3 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	149-UNIMOD:510,151-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	223-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	104-UNIMOD:510,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:510,158-UNIMOD:510,189-UNIMOD:510	0.25	21.0	2	2	2
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	96-UNIMOD:510	0.09	21.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	20-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	161-UNIMOD:510,171-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P23434|GCSH_HUMAN	Glycine cleavage system H protein, mitochondrial OS=Homo sapiens OX=9606 GN=GCSH PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	137-UNIMOD:510,138-UNIMOD:4,139-UNIMOD:21,146-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|O43598|DNPH1_HUMAN	2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	157-UNIMOD:510,169-UNIMOD:21	0.11	21.0	1	1	1
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	104-UNIMOD:510,105-UNIMOD:4,109-UNIMOD:21,121-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	193-UNIMOD:510	0.12	20.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	253-UNIMOD:510,265-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	295-UNIMOD:510,305-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	237-UNIMOD:510,241-UNIMOD:21,246-UNIMOD:510	0.01	20.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	542-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P10696|PPBN_HUMAN	Alkaline phosphatase, germ cell type OS=Homo sapiens OX=9606 GN=ALPG PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	107-UNIMOD:510,114-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510	0.03	20.0	1	1	0
PRT	sp|Q13033-2|STRN3_HUMAN	Isoform Alpha of Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	219-UNIMOD:510,229-UNIMOD:21,231-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	87-UNIMOD:510,154-UNIMOD:510	0.06	20.0	2	2	2
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	55-UNIMOD:510,63-UNIMOD:510	0.08	20.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	576-UNIMOD:510,578-UNIMOD:21,580-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	250-UNIMOD:510,256-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	110-UNIMOD:510,114-UNIMOD:21,123-UNIMOD:4,126-UNIMOD:510	0.03	20.0	1	1	0
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	424-UNIMOD:510,426-UNIMOD:35,443-UNIMOD:21,447-UNIMOD:510	0.05	20.0	1	1	0
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	69-UNIMOD:510,74-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4	0.20	19.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	28-UNIMOD:510,35-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|Q9H3K6-2|BOLA2_HUMAN	Isoform 2 of BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	15-UNIMOD:510	0.29	19.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	194-UNIMOD:510,202-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	184-UNIMOD:510,194-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|P26373-2|RL13_HUMAN	Isoform 2 of 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	75-UNIMOD:510,77-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	44-UNIMOD:510	0.12	19.0	1	1	1
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|O15042-3|SR140_HUMAN	Isoform 3 of U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	68-UNIMOD:510,76-UNIMOD:21,79-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|Q15052-2|ARHG6_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	333-UNIMOD:510,334-UNIMOD:21,341-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	80-UNIMOD:510,82-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	119-UNIMOD:510,121-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	98-UNIMOD:510,107-UNIMOD:510	0.04	19.0	1	1	1
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	385-UNIMOD:510,398-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	0.07	19.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	42-UNIMOD:510,42-UNIMOD:4,43-UNIMOD:21,67-UNIMOD:510	0.05	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510	ms_run[2]:scan=4678	50.988	2	2226.9361	2226.9361	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	2	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510	ms_run[2]:scan=4774	51.983	2	2226.9361	2226.9361	R	-	228	248
PSM	SSGSPYGGGYGSGGGSGGYGSR	3	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1812	26.05	2	2023.8121	2023.8121	R	R	333	355
PSM	DNLTLWTSDMQGDGEEQNK	4	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4555	49.717	2	2248.059	2248.0590	R	E	204	223
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	5	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,20-UNIMOD:21,32-UNIMOD:4,33-UNIMOD:510	ms_run[2]:scan=3958	43.707	3	3881.5895	3881.5895	R	G	16	49
PSM	DNLTLWTSDQQDDDGGEGNN	6	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=4872	53.042	2	2226.9361	2226.9361	R	-	228	248
PSM	INSSGESGDESDEFLQSR	7	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3238	37.338	2	2069.8639	2069.8639	R	K	180	198
PSM	SYELPDGQVITIGNER	8	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4576	49.918	2	1903.9141	1903.9141	K	F	239	255
PSM	INSSGESGDESDEFLQSR	9	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=3238	37.33791166666666	2	2069.859957	2069.863906	R	K	180	198
PSM	SSSPAPADIAQTVQEDLR	10	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=5087	55.593	2	1997.9519	1997.9519	K	T	230	248
PSM	STAGDTHLGGEDFDNR	11	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510	ms_run[2]:scan=1648	24.799	2	1724.7814	1724.7814	K	M	221	237
PSM	SSSPAPADIAQTVQEDLR	12	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=5087	55.59325	2	1997.9486	1997.9514	K	T	230	248
PSM	AGEEDEGEEDSDSDYEISAK	13	sp|A2RRP1-2|NBAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2425	30.836	2	2321.9221	2321.9221	R	A	463	483
PSM	ATTPADGEEPAPEAEALAAAR	14	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3802	42.206	2	2150.9945	2150.9945	R	E	6	27
PSM	ATTPADGEEPAPEAEALAAAR	15	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3802	42.20612833333333	2	2150.9902	2150.9940	R	E	6	27
PSM	DSSTSPGDYVLSVSENSR	16	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4511	49.259	2	2012.8788	2012.8788	R	V	39	57
PSM	NPDDITQEEYGEFYK	17	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3820	42.353	2	1994.8823	1994.8823	R	S	292	307
PSM	TDSVIIADQTPTPTR	18	sp|P17544-5|ATF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3208	37.112	2	1807.8218	1807.8218	R	F	42	57
PSM	TPEELDDSDFETEDFDVR	19	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4829	52.648	2	2271.9157	2271.9157	R	S	264	282
PSM	DNLTLWTSDTQGDEAEAGEGGEN	20	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=4821	52.569	3	2442.0519	2442.0519	R	-	223	246
PSM	SVTEQGAELSNEER	21	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510	ms_run[2]:scan=1510	23.74	2	1581.7695	1581.7695	K	N	28	42
PSM	DNLTLWTSDMQGDGEEQNK	22	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3895	43.148	2	2264.0539	2264.0539	R	E	204	223
PSM	DWEDDSDEDMSNFDR	23	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,10-UNIMOD:35	ms_run[2]:scan=3075	36.065	2	1924.7117	1924.7117	K	F	75	90
PSM	DWEDDSDEDMSNFDR	24	sp|Q15185-2|TEBP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3452	39.063	2	2004.6781	2004.6781	K	F	75	90
PSM	IVRGDQPAASGDSDDDEPPPLPR	25	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2468	31.168	3	2517.1597	2517.1597	K	L	45	68
PSM	ALFKPPEDSQDDESDSDAEEEQTTK	26	sp|Q13769|THOC5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,4-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=2878	34.413	3	2992.3447	2992.3447	K	R	299	324
PSM	QENCGAQQVPAGPGTSTPPSSPVR	27	sp|Q96G46-2|DUS3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=2396	30.614	3	2535.1637	2535.1637	R	T	257	281
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	28	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=4669	50.919	3	3490.5054	3490.5054	R	-	207	238
PSM	VDATEESDLAQQYGVR	29	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2974	35.242	2	1893.857	1893.8570	K	G	82	98
PSM	DNLTLWTSDQQDDDGGEGNN	30	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510	ms_run[1]:scan=4968	54.157318333333336	2	2226.9315	2226.9356	R	-	228	248
PSM	EYIPGQPPLSQSSDSSPTR	31	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[1]:scan=3351	38.242095	2	2158.9954	2158.9991	K	N	871	890
PSM	AASPPASASDLIEQQQK	32	sp|Q5VSL9-3|STRP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=3319	37.99	2	1887.9616	1887.9616	R	R	69	86
PSM	KEESEESDDDMGFGLFD	33	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4331	47.357	2	2032.8732	2032.8732	K	-	73	90
PSM	SSTPLPTISSSAENTR	34	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2604	32.226	2	1760.8406	1760.8406	R	Q	158	174
PSM	DATNVGDEGGFAPNILENK	35	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4415	48.192	2	2028.0436	2028.0436	K	E	203	222
PSM	ELISNASDALDK	36	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2744	33.309	2	1342.7616	1342.7616	R	I	42	54
PSM	LAYINPDLALEEK	37	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4556	49.725	2	1635.8797	1635.8797	R	N	328	341
PSM	DLADELALVDVIEDK	38	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6088	72.294	2	1724.972	1724.9720	K	L	43	58
PSM	DNLTLWTSDMQGDGEEQNK	39	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3878	43.015	3	2264.0539	2264.0539	R	E	204	223
PSM	DSENLASPSEYPENGER	40	sp|P52948-4|NUP98_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2710	33.045	2	2006.8319	2006.8319	R	F	600	617
PSM	ETVSEESNVLCLSK	41	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3286	37.719	2	1661.8818	1661.8818	R	S	581	595
PSM	EYIPGQPPLSQSSDSSPTR	42	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3351	38.242	2	2158.9996	2158.9996	K	N	871	890
PSM	SSGSPYGGGYGSGGGSGGYGSR	43	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=1812	26.049558333333334	2	2023.8055	2023.8116	R	R	355	377
PSM	DNLTLWTSENQGDEGDAGEGEN	44	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=4653	50.785	2	2384.01	2384.0100	R	-	223	245
PSM	EVDEQMLNVQNK	45	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2686	32.858	2	1513.8083	1513.8083	K	N	325	337
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	46	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2354	30.283	3	2847.2212	2847.2212	K	M	445	470
PSM	NDQDTWDYTNPNLSGQGDPGSNPNK	47	sp|P14866-2|HNRPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,25-UNIMOD:510	ms_run[2]:scan=3443	38.977	3	2801.2801	2801.2801	K	R	145	170
PSM	NPDDITNEEYGEFYK	48	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3750	41.735	2	1980.8667	1980.8667	R	S	300	315
PSM	NPDDITQEEYGEFYK	49	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3959	43.714	2	1994.8823	1994.8823	R	S	292	307
PSM	SGAMSPMSWNSDASTSEAS	50	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4470	48.846	2	2015.7702	2015.7702	R	-	190	209
PSM	SSGSPYGGGYGSGGGSGGYGSR	51	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[1]:scan=1812	26.049558333333334	2	2023.806086	2023.812145	R	R	355	377
PSM	AFLAELEQNSPK	52	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4071	44.741	2	1493.7803	1493.7803	K	I	2424	2436
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	53	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,34-UNIMOD:510	ms_run[2]:scan=4940	53.824	4	3824.5651	3824.5651	K	A	469	503
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	54	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510	ms_run[2]:scan=1478	23.479	3	3241.4532	3241.4532	K	E	269	299
PSM	NPDDITQEEYGEFYK	55	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=3884	43.061	2	1914.916	1914.9160	R	S	292	307
PSM	SGSSSPDSEITELK	56	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2980	35.291	2	1583.7604	1583.7604	R	F	340	354
PSM	TDSVIIADQTPTPTR	57	sp|P17544-5|ATF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2875	34.39	2	1727.8555	1727.8555	R	F	42	57
PSM	TDSVIIADQTPTPTR	58	sp|P17544-5|ATF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=3400	38.636	2	1807.8218	1807.8218	R	F	42	57
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	59	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4907	53.495	3	2995.386	2995.3860	R	G	2913	2938
PSM	SGAMSPMSWNSDASTSEAS	60	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,4-UNIMOD:35,5-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=2723	33.147	2	2047.76	2047.7600	R	-	190	209
PSM	SLDSDESEDEEDDYQQK	61	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,17-UNIMOD:510	ms_run[2]:scan=1758	25.639	2	2098.8975	2098.8975	K	R	57	74
PSM	YSPTSPTYSPTSPK	62	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2762	33.448	2	1739.7733	1739.7733	K	Y	1909	1923
PSM	DHSPTPSVFNSDEER	63	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2728	33.186	2	1909.7345	1909.7345	R	Y	416	431
PSM	DNNQFASASLDR	64	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=2310	29.908	2	1370.6639	1370.6639	K	T	125	137
PSM	FASENDLPEWK	65	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4311	47.167	2	1482.7068	1482.7068	R	E	58	69
PSM	IQALQQQADEAEDR	66	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1887	26.653	2	1647.8276	1647.8276	K	A	14	28
PSM	ITPSYVAFTPEGER	67	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3862	42.835	2	1679.802	1679.8020	R	L	61	75
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	68	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4112	45.156	3	3090.3451	3090.3451	K	E	120	146
PSM	NDSVIVADQTPTPTR	69	sp|P15336-3|ATF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2628	32.41	2	1806.8014	1806.8014	R	F	60	75
PSM	SYELPDGQVITIGNER	70	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=4709	51.243	2	1823.9478	1823.9478	K	F	239	255
PSM	LISWYDNEFGYSNR	71	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=4964	54.11111166666667	2	1876.8211	1876.8240	K	V	310	324
PSM	DNLTLWTSDQQDDDGGEGNN	72	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510	ms_run[1]:scan=4676	50.972746666666666	3	2226.9348	2226.9356	R	-	228	248
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	73	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=3091	36.189105	3	2528.1487	2528.1517	R	L	815	839
PSM	AFGPGLQGGSAGSPAR	74	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2448	31.013	2	1542.7404	1542.7404	K	F	1072	1088
PSM	ATTPADGEEPAPEAEALAAAR	75	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3790	42.097	3	2150.9945	2150.9945	R	E	6	27
PSM	DNLTLWTSDQQDDDGGEGNN	76	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=4870	53.025	3	2226.9361	2226.9361	R	-	228	248
PSM	EGLELPEDEEEK	77	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2833	34.052	2	1483.7566	1483.7566	K	K	547	559
PSM	ELISNSSDALDK	78	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2704	32.996	2	1438.7229	1438.7229	R	I	47	59
PSM	EQFLDGDGWTSR	79	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=4124	45.25	2	1523.6506	1523.6506	K	W	25	37
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	80	sp|Q9NPQ8-2|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2166	28.786	3	2826.1852	2826.1852	R	E	418	442
PSM	LIAPVAEEEATVPNNK	81	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2906	34.634	2	1762.0149	1762.0149	K	I	8	24
PSM	LYTLVLTDPDAPSR	82	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4518	49.317	2	1673.849	1673.8490	K	K	63	77
PSM	MLAESDESGDEESVSQTDK	83	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:35,5-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=1757	25.632	2	2219.9301	2219.9301	K	T	186	205
PSM	QVPDSAATATAYLCGVK	84	sp|P09923|PPBI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=4309	47.151	2	1898.9485	1898.9486	R	A	107	124
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	85	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=3091	36.189	3	2528.1522	2528.1522	R	L	815	839
PSM	SSSPVQVEEEPVR	86	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2000	27.525	2	1555.7343	1555.7343	R	L	100	113
PSM	TAFQEALDAAGDK	87	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3239	37.346	2	1403.7569	1403.7569	K	L	9	22
PSM	TDSVIIADQTPTPTR	88	sp|P17544-5|ATF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2712	33.062	2	1727.8555	1727.8555	R	F	42	57
PSM	VDSTTCLFPVEEK	89	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=4284	46.875	2	1671.8103	1671.8103	R	A	241	254
PSM	YALYDATYETK	90	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3009	35.551	2	1404.7449	1404.7449	R	E	82	93
PSM	ATTPADGEEPAPEAEALAAAR	91	sp|Q96S44|PRPK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3790	42.096579999999996	3	2150.9928	2150.9940	R	E	6	27
PSM	SGAMSPMSWNSDASTSEAS	92	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,4-UNIMOD:35,7-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=2723	33.14731833333334	2	2047.7559	2047.7595	R	-	190	209
PSM	VDSTTCLFPVEEK	93	sp|Q06210|GFPT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,13-UNIMOD:510	ms_run[1]:scan=4284	46.875211666666665	2	1671.8086	1671.8098	R	A	259	272
PSM	EVDEQMLNVQNK	94	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1671	24.974	2	1529.8032	1529.8032	K	N	325	337
PSM	FPVPELSDQEGDSSSEED	95	sp|Q9BRX2|PELO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4976	54.234	2	2079.8258	2079.8258	R	-	368	386
PSM	HGESAWNLENR	96	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1610	24.504	2	1345.6587	1345.6587	R	F	11	22
PSM	LISWYDNEFGYSNR	97	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=4964	54.111	2	1876.8245	1876.8245	K	V	268	282
PSM	NDSVIVADQTPTPTR	98	sp|P15336-3|ATF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2385	30.515	2	1726.8351	1726.8351	R	F	60	75
PSM	QDENDDDDDWNPCK	99	sp|Q14974-2|IMB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,13-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=2292	29.767	2	1832.7432	1832.7432	K	A	188	202
PSM	QEYDESGPSIVHR	100	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1551	24.054	2	1549.7585	1549.7585	K	K	360	373
PSM	SCFESSPDPELK	101	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:4,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2610	32.272	2	1542.695	1542.6950	R	S	871	883
PSM	SRSPESQVIGENTK	102	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1317	22.19	2	1678.8564	1678.8564	R	Q	305	319
PSM	SSSPAPADIAQTVQEDLR	103	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=5094	55.695	3	1997.9519	1997.9519	K	T	230	248
PSM	STARFTLNPNPTGVQNPHIER	104	sp|P45985|MP2K4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=3505	39.489	3	2542.1943	2542.1943	K	L	55	76
PSM	VNDGVCDCCDGTDEYNSGVICENTCK	105	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,6-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:21,21-UNIMOD:4,25-UNIMOD:4,26-UNIMOD:510	ms_run[2]:scan=2880	34.428	3	3188.2175	3188.2175	R	E	92	118
PSM	STARFTLNPNPTGVQNPHIER	106	sp|P45985|MP2K4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=3505	39.48863	3	2542.1919	2542.1938	K	L	55	76
PSM	SSSPAPADIAQTVQEDLR	107	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=5094	55.695026666666664	3	1997.9503	1997.9514	K	T	230	248
PSM	NDSVIVADQTPTPTR	108	sp|P15336|ATF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=2628	32.410115000000005	2	1806.799555	1806.801443	R	F	60	75
PSM	TDSVIIADQTPTPTR	109	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=3400	38.63646666666667	2	1807.820501	1807.821844	R	F	42	57
PSM	DVIELTDDSFDK	110	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=4447	48.558	2	1463.7668	1463.7668	K	N	158	170
PSM	ELISNSSDALDK	111	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2183	28.924	2	1358.7566	1358.7566	R	I	47	59
PSM	FSEGVLQSPSQDQEK	112	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2811	33.849	2	1825.8772	1825.8772	R	L	428	443
PSM	IAQLEEELEEEQGNTELINDR	113	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=4601	50.268	3	2505.2295	2505.2295	R	L	1153	1174
PSM	KEESEESDDDMGFGLFD	114	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=5022	54.903	2	2016.8783	2016.8783	K	-	73	90
PSM	KITIADCGQLE	115	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2612	32.286	2	1314.749	1314.7490	K	-	95	106
PSM	LCDFGISGQLVDSIAKTR	116	sp|P45985|MP2K4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=5072	55.431	3	2207.0735	2207.0735	K	D	245	263
PSM	NDLAVVDVR	117	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2590	32.116	2	1033.598	1033.5980	K	I	334	343
PSM	NDSPTQIPVSSDVCR	118	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=2793	33.709	2	1787.7973	1787.7973	R	L	656	671
PSM	SPSPEPIYNSEGK	119	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1979	27.364	2	1551.7494	1551.7494	R	R	80	93
PSM	TAENATSGETLEENEAGD	120	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1871	26.53	2	1870.8128	1870.8128	K	-	323	341
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	121	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:35	ms_run[2]:scan=4225	46.322	3	3506.5004	3506.5004	R	-	207	238
PSM	VPTANVSVVDLTCR	122	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3881	43.037	2	1643.8166	1643.8166	R	L	193	207
PSM	DNLTLWTSDQQDDDGGEGNN	123	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510	ms_run[1]:scan=4775	51.99073666666666	3	2226.9348	2226.9356	R	-	228	248
PSM	ALAAAGYDVEK	124	sp|P22492|H1T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2012	27.615	2	1174.687	1174.6870	K	N	69	80
PSM	DNLTLWTSENQGDEGDAGEGEN	125	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4647	50.737	3	2384.01	2384.0100	R	-	223	245
PSM	DYTYEELLNR	126	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4335	47.387	2	1348.6723	1348.6723	R	V	173	183
PSM	EALQDVEDENQ	127	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=2215	29.171	2	1322.605	1322.6050	K	-	223	234
PSM	EDQTEYLEER	128	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1909	26.817	2	1344.6258	1344.6258	K	R	192	202
PSM	ESSLSPSPASSISSR	129	sp|Q12968-5|NFAC3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2243	29.394	2	1604.7507	1604.7507	R	S	159	174
PSM	FTLNPNPTGVQNPHIER	130	sp|P45985|MP2K4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=3919	43.371	3	2126.9764	2126.9764	R	L	59	76
PSM	ILDQMPATPSSPMYVD	131	sp|P45985|MP2K4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=4223	46.305	2	1893.8354	1893.8354	K	-	384	400
PSM	NDSVIVADQTPTPTR	132	sp|P15336-3|ATF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2218	29.194	2	1726.8351	1726.8351	R	F	60	75
PSM	NPDDITQEEYGEFYK	133	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3960	43.722	3	1994.8823	1994.8823	R	S	292	307
PSM	QREESETRSESSDFEVVPK	134	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2112	28.384	3	2386.1326	2386.1326	R	R	995	1014
PSM	QVVESAYEVIK	135	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3076	36.073	2	1411.7636	1411.7636	K	L	175	186
PSM	SQTPSPSTLNIDHMEQK	136	sp|Q6GYQ0-3|RGPA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=2933	34.864	3	2059.9922	2059.9922	R	D	1047	1064
PSM	TTPSVVAFTADGER	137	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3886	43.077	2	1563.7394	1563.7394	R	L	86	100
PSM	TVIIEQSWGSPK	138	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3863	42.843	2	1491.8011	1491.8011	R	V	61	73
PSM	ELISNSSDALDK	139	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2704	32.99580833333333	2	1438.722419	1438.722891	R	I	47	59
PSM	NDSVIVADQTPTPTR	140	sp|P15336|ATF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=2630	32.42617166666667	3	1806.8003	1806.8009	R	F	60	75
PSM	ALINSPEGAVGR	141	sp|O00115-2|DNS2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2733	33.222	2	1296.6651	1296.6651	R	S	66	78
PSM	APSRQDVYGPQPQVR	142	sp|O60716-24|CTND1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1586	24.319	3	1810.894	1810.8940	R	V	149	164
PSM	ATAGDTHLGGEDFDNR	143	sp|P48741|HSP77_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1681	25.052	3	1708.7865	1708.7865	K	L	223	239
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	144	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=3464	39.157	3	3527.556	3527.5560	K	L	104	135
PSM	DGNGYISAAELR	145	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3159	36.737	2	1298.6679	1298.6679	K	H	96	108
PSM	DSSTSPGDYVLSVSENSR	146	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4503	49.18	3	2012.8788	2012.8788	R	V	39	57
PSM	EAAENSLVAYK	147	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2017	27.652	2	1261.7191	1261.7191	K	A	121	132
PSM	EVYELLDSPGK	148	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3836	42.54	2	1396.7163	1396.7163	K	V	20	31
PSM	GEPNVSYICSR	149	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2355	30.291	2	1394.6114	1394.6114	R	Y	210	221
PSM	NFSDNQLQEGK	150	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1698	25.182	2	1346.7103	1346.7103	R	N	161	172
PSM	QEYDESGPSIVHR	151	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1531	23.901	3	1549.7585	1549.7585	K	K	360	373
PSM	SCYEDGWLIK	152	sp|P23434|GCSH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:4,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4209	46.168	2	1417.6625	1417.6625	K	M	137	147
PSM	YFEADPPGQVAASPDPTT	153	sp|O43598|DNPH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3730	41.532	2	1975.8665	1975.8665	R	-	157	175
PSM	SCGSSTPDEFPTDIPGTK	154	sp|P41091|IF2G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,2-UNIMOD:4,6-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=3797	42.15138833333333	2	2042.9149	2042.9175	R	G	104	122
PSM	NDSVIVADQTPTPTR	155	sp|P15336|ATF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=2385	30.515204999999998	2	1726.833080	1726.835112	R	F	60	75
PSM	ILDQMPATPSSPMYVD	156	sp|P45985|MP2K4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=4793	52.223385	2	1973.799183	1973.801703	K	-	384	400
PSM	DNLTLWTADNAGEEGGEAPQEPQS	157	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4849	52.812	3	2562.157	2562.1570	R	-	193	217
PSM	EEASDYLELDTIK	158	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=4240	46.439	2	1592.8458	1592.8458	K	N	253	266
PSM	ESEDKPEIEDVGSDEEEEK	159	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=2005	27.562	3	2294.1022	2294.1022	K	K	251	270
PSM	EYIPGQPPLSQSSDSSPTR	160	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3361	38.333	3	2158.9996	2158.9996	K	N	871	890
PSM	GDLGIEIPAEK	161	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3531	39.686	2	1208.7289	1208.7289	R	V	295	306
PSM	GYFEYIEENK	162	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3856	42.786	2	1438.6694	1438.6694	R	Y	237	247
PSM	HGSYEDAVHSGALND	163	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1700	25.196	2	1604.7279	1604.7279	K	-	542	557
PSM	HVPDSGATATAYLCGVK	164	sp|P10696|PPBN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=3382	38.497	3	1893.9332	1893.9332	K	G	107	124
PSM	NLEQILNGGESPK	165	sp|Q13033-2|STRN3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4358	47.642	2	1545.8076	1545.8076	K	Q	219	232
PSM	QDIAFAYQR	166	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2729	33.194	2	1144.6089	1144.6089	R	R	87	96
PSM	TLSDYNIQK	167	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=1912	26.839	2	1148.6714	1148.6714	R	E	55	64
PSM	TRSPSPDDILER	168	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=3060	35.947	2	1578.6904	1578.6904	R	V	576	588
PSM	VERADGYEPPVQESV	169	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2381	30.486	2	1787.8191	1787.8191	K	-	250	265
PSM	VIGSGCNLDSAR	170	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1369	22.606	2	1281.656	1281.6560	R	F	100	112
PSM	YHTSQSGDEMTSLSEYVSR	171	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3454	39.08	3	2210.001	2210.0010	R	M	457	476
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	172	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=3649	40.79037666666667	3	2608.1156	2608.1180	R	L	815	839
PSM	HVPDSGATATAYLCGVK	173	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[1]:scan=3382	38.497321666666664	3	1893.9321	1893.9327	K	G	110	127
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	174	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,3-UNIMOD:35,20-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=2166	28.786223333333332	3	2826.178393	2826.185165	R	E	424	448
PSM	AFGESSTESDEEEEEGCGHTHCVR	175	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=1519	23.811	3	2852.0751	2852.0751	R	G	69	93
PSM	AGFAGDDAPR	176	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1138	20.73	2	1009.5041	1009.5041	K	A	19	29
PSM	DISLSDYK	177	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:510	ms_run[2]:scan=2997	35.42	2	1007.5812	1007.5812	K	G	28	36
PSM	DLEAEHVEVEDTTLNR	178	sp|Q9H3K6-2|BOLA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=3100	36.274	3	1902.9383	1902.9383	R	C	15	31
PSM	DQIYDIFQK	179	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=4630	50.567	2	1236.7027	1236.7027	K	L	194	203
PSM	DSSDSADGRATPSENLVPSSAR	180	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2379	30.471	3	2332.0392	2332.0392	R	V	184	206
PSM	EGALCEENMR	181	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=881	18.351	2	1257.5542	1257.5542	K	G	689	699
PSM	GFSLEELR	182	sp|P26373-2|RL13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4390	47.942	2	1063.5163	1063.5163	R	V	75	83
PSM	GRGPSPEGSSSTESSPEHPPK	183	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,5-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=857	18.052	3	2254.054	2254.0540	K	S	1644	1665
PSM	HELQANCYEEVK	184	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1348	22.438	2	1586.8035	1586.8035	K	D	133	145
PSM	HGYIGEFEIIDDHR	185	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=3481	39.3	3	1733.8586	1733.8586	K	A	44	58
PSM	IQVLQQQADDAEER	186	sp|P06753-4|TPM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1898	26.737	2	1641.7958	1641.7958	K	A	14	28
PSM	KEESEESDDDMGFGLFD	187	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4938	53.807	2	2112.8395	2112.8395	K	-	73	90
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	188	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,32-UNIMOD:510	ms_run[2]:scan=3268	37.567	4	3790.3213	3790.3213	K	A	158	190
PSM	LYSILQGDSPTK	189	sp|O15042-3|SR140_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3800	42.19	2	1468.7851	1468.7851	K	W	68	80
PSM	MLAESDESGDEESVSQTDKTELQNTLR	190	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:35,5-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=3967	43.793	3	3255.4051	3255.4051	K	T	186	213
PSM	MSGFIYQGK	191	sp|Q15052-2|ARHG6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3523	39.627	2	1177.5879	1177.5879	R	I	333	342
PSM	NELESYAYSLK	192	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3707	41.323	2	1383.7558	1383.7558	R	N	563	574
PSM	QLSSGVSEIR	193	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2195	29.014	2	1188.5964	1188.5964	R	H	80	90
PSM	RLSQSDEDVIR	194	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1720	25.344	2	1430.6979	1430.6979	K	L	119	130
PSM	SADTLWDIQK	195	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4361	47.665	2	1323.6748	1323.6748	K	D	320	330
PSM	SIYYITGESK	196	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2693	32.909	2	1227.7023	1227.7023	K	E	482	492
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	197	sp|Q15637-4|SF01_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,16-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3622	40.556	3	2913.407	2913.4070	R	R	67	93
PSM	TNQELQEINR	198	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1400	22.851	2	1277.6788	1277.6788	R	V	154	164
PSM	TWNDPSVQQDIK	199	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2659	32.651	2	1497.81	1497.8100	R	F	102	114
PSM	VEVTEFEDIK	200	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=3681	41.108	2	1275.7235	1275.7235	R	S	98	108
PSM	VPSPLEGSEGDGDTD	201	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=3323	38.022	2	1587.6402	1587.6402	K	-	385	400
PSM	VRYSLDPENPTK	202	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2439	30.943	3	1565.8127	1565.8127	M	S	2	14
PSM	GVVDSEDLPLNISR	203	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510	ms_run[1]:scan=4044	44.502961666666664	2	1546.8406	1546.8410	R	E	379	393
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	204	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=2991	35.37395166666666	3	2488.0372	2487.0372	R	R	42	68