MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100628_016CDK9-CycT1.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100628_016CDK9-CycT1.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	51.0	null	333-UNIMOD:510,336-UNIMOD:21	0.06	51.0	1	1	0
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	46.0	null	355-UNIMOD:510,356-UNIMOD:21	0.06	46.0	1	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	228-UNIMOD:510	0.09	45.0	3	1	0
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	227-UNIMOD:510,247-UNIMOD:21,202-UNIMOD:510,213-UNIMOD:21	0.13	41.0	3	2	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null	180-UNIMOD:510,186-UNIMOD:21,182-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	230-UNIMOD:510,232-UNIMOD:21,230-UNIMOD:21	0.04	39.0	3	1	0
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	841-UNIMOD:510,846-UNIMOD:21	0.02	38.0	1	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	871-UNIMOD:510,886-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	10-UNIMOD:510,11-UNIMOD:4,25-UNIMOD:4,29-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	57-UNIMOD:510,73-UNIMOD:510	0.10	36.0	1	1	1
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,446-UNIMOD:510	0.03	35.0	2	2	2
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	606-UNIMOD:510,612-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|O60563|CCNT1_HUMAN	Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	351-UNIMOD:510,351-UNIMOD:21,376-UNIMOD:510,575-UNIMOD:510,577-UNIMOD:21,590-UNIMOD:510,439-UNIMOD:510,444-UNIMOD:21,454-UNIMOD:510,352-UNIMOD:21,358-UNIMOD:21,558-UNIMOD:510,560-UNIMOD:21,562-UNIMOD:21,570-UNIMOD:21,573-UNIMOD:510,580-UNIMOD:21,564-UNIMOD:21,568-UNIMOD:21,574-UNIMOD:510,369-UNIMOD:21,416-UNIMOD:510,416-UNIMOD:21,427-UNIMOD:21,438-UNIMOD:510,207-UNIMOD:510,216-UNIMOD:21,219-UNIMOD:510,215-UNIMOD:21,333-UNIMOD:510,336-UNIMOD:21,340-UNIMOD:21,342-UNIMOD:510,431-UNIMOD:21,558-UNIMOD:21,566-UNIMOD:21,567-UNIMOD:21	0.17	35.0	23	10	3
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	228-UNIMOD:510	0.08	34.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	431-UNIMOD:510,439-UNIMOD:21,432-UNIMOD:21	0.04	34.0	2	1	0
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	342-UNIMOD:510,345-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	239-UNIMOD:510,19-UNIMOD:510,360-UNIMOD:510	0.11	34.0	3	3	3
PRT	sp|Q13131|AAPK1_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	null	183-UNIMOD:510,185-UNIMOD:4,187-UNIMOD:21	0.03	34.0	1	1	0
PRT	sp|Q86W92|LIPB1_HUMAN	Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	null	994-UNIMOD:510,1003-UNIMOD:21	0.02	34.0	1	1	0
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	54-UNIMOD:510,54-UNIMOD:4,60-UNIMOD:21,69-UNIMOD:21,208-UNIMOD:510,213-UNIMOD:21,215-UNIMOD:510,216-UNIMOD:21,222-UNIMOD:510,217-UNIMOD:21	0.07	33.0	4	2	1
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	33.0	1	1	0
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	4-UNIMOD:510,14-UNIMOD:21,11-UNIMOD:21	0.06	33.0	3	1	0
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	221-UNIMOD:510,37-UNIMOD:510,38-UNIMOD:21	0.06	33.0	4	2	0
PRT	sp|Q8N556|AFAP1_HUMAN	Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	33.0	null	246-UNIMOD:510,251-UNIMOD:4,259-UNIMOD:4,265-UNIMOD:21,269-UNIMOD:510,264-UNIMOD:21	0.03	33.0	2	1	0
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	1203-UNIMOD:510,1211-UNIMOD:21,1208-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	40-UNIMOD:510,41-UNIMOD:21,44-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	2913-UNIMOD:510,2928-UNIMOD:21,2937-UNIMOD:510	0.01	32.0	1	1	1
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	656-UNIMOD:510,658-UNIMOD:21,669-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|Q9BTE3-2|MCMBP_HUMAN	Isoform 2 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	102-UNIMOD:510,108-UNIMOD:4,118-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	null	14-UNIMOD:510	0.06	32.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	9-UNIMOD:510,16-UNIMOD:21,27-UNIMOD:510,31-UNIMOD:510	0.03	31.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	418-UNIMOD:510,420-UNIMOD:35,435-UNIMOD:21,441-UNIMOD:510	0.05	31.0	1	1	1
PRT	sp|Q8NBJ7-5|SUMF2_HUMAN	Isoform 5 of Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	191-UNIMOD:510,191-UNIMOD:35,194-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|Q13033-2|STRN3_HUMAN	Isoform Alpha of Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	219-UNIMOD:510,229-UNIMOD:21,231-UNIMOD:510	0.02	31.0	1	1	1
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	107-UNIMOD:510,111-UNIMOD:21,120-UNIMOD:4,123-UNIMOD:510	0.03	31.0	2	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	39-UNIMOD:510,40-UNIMOD:21,43-UNIMOD:21	0.06	31.0	3	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	428-UNIMOD:510,435-UNIMOD:21,442-UNIMOD:510,1099-UNIMOD:510,1103-UNIMOD:21	0.02	30.0	2	2	2
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	2111-UNIMOD:510,2125-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	73-UNIMOD:510,83-UNIMOD:35,79-UNIMOD:21	0.20	30.0	3	1	0
PRT	sp|Q92576-2|PHF3_HUMAN	Isoform 2 of PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	1507-UNIMOD:510,1526-UNIMOD:21,1528-UNIMOD:4	0.01	30.0	1	1	0
PRT	sp|Q8N6T3-4|ARFG1_HUMAN	Isoform 4 of ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	227-UNIMOD:510,227-UNIMOD:21,229-UNIMOD:510,238-UNIMOD:4,230-UNIMOD:510,232-UNIMOD:21	0.07	30.0	2	2	1
PRT	sp|O14979-3|HNRDL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	116-UNIMOD:510,122-UNIMOD:21,131-UNIMOD:510	0.07	30.0	1	1	1
PRT	sp|Q9UPW0-2|FOXJ3_HUMAN	Isoform 2 of Forkhead box protein J3 OS=Homo sapiens OX=9606 GN=FOXJ3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	177-UNIMOD:510,189-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	63-UNIMOD:510,74-UNIMOD:21,76-UNIMOD:21,62-UNIMOD:510	0.08	29.0	4	3	2
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	29-UNIMOD:510,39-UNIMOD:21,42-UNIMOD:510,37-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	61-UNIMOD:510,69-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	8-UNIMOD:510,23-UNIMOD:510,320-UNIMOD:510,323-UNIMOD:21,329-UNIMOD:510,320-UNIMOD:21,300-UNIMOD:510,303-UNIMOD:21,308-UNIMOD:510	0.11	29.0	4	3	2
PRT	sp|P50750|CDK9_HUMAN	Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	4-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:4,13-UNIMOD:4,18-UNIMOD:510,25-UNIMOD:510,29-UNIMOD:21,35-UNIMOD:510,359-UNIMOD:510,362-UNIMOD:21,366-UNIMOD:21,363-UNIMOD:21	0.12	29.0	5	4	3
PRT	sp|Q7Z417-2|NUFP2_HUMAN	Isoform 2 of Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	107-UNIMOD:510,115-UNIMOD:35,117-UNIMOD:21	0.13	29.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	29.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	207-UNIMOD:510,207-UNIMOD:21	0.14	29.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	61-UNIMOD:510,70-UNIMOD:21,72-UNIMOD:510	0.02	29.0	1	1	1
PRT	sp|P18850|ATF6A_HUMAN	Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	88-UNIMOD:510,104-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	2424-UNIMOD:510,2433-UNIMOD:21,2435-UNIMOD:510	0.00	28.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	2885-UNIMOD:510,2889-UNIMOD:21,2888-UNIMOD:21	0.00	28.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	539-UNIMOD:510,550-UNIMOD:510,613-UNIMOD:510,617-UNIMOD:35,620-UNIMOD:35,621-UNIMOD:35,623-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,187-UNIMOD:510,492-UNIMOD:510	0.10	28.0	6	6	6
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	325-UNIMOD:510,330-UNIMOD:35,336-UNIMOD:510,163-UNIMOD:510,164-UNIMOD:35,166-UNIMOD:21,172-UNIMOD:21,174-UNIMOD:510	0.06	28.0	3	2	1
PRT	sp|Q99873-5|ANM1_HUMAN	Isoform 4 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	271-UNIMOD:510,274-UNIMOD:4,278-UNIMOD:4,280-UNIMOD:21	0.05	28.0	1	1	0
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	28.0	null	104-UNIMOD:510,105-UNIMOD:4,109-UNIMOD:21,121-UNIMOD:510,104-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|Q92576|PHF3_HUMAN	PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	null	1595-UNIMOD:510,1613-UNIMOD:21,1616-UNIMOD:4	0.01	28.0	1	1	0
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	466-UNIMOD:510,475-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	204-UNIMOD:510,222-UNIMOD:510,223-UNIMOD:510,213-UNIMOD:35	0.13	27.0	3	2	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	235-UNIMOD:510,244-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	689-UNIMOD:510,697-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P54646|AAPK2_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens OX=9606 GN=PRKAA2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	172-UNIMOD:510,173-UNIMOD:21,174-UNIMOD:4	0.03	27.0	1	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	12-UNIMOD:510,27-UNIMOD:21,30-UNIMOD:510,26-UNIMOD:21	0.06	27.0	2	1	0
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	502-UNIMOD:510,507-UNIMOD:21,522-UNIMOD:4,355-UNIMOD:510,363-UNIMOD:4	0.08	26.0	2	2	2
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	223-UNIMOD:510,237-UNIMOD:4	0.10	26.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	22-UNIMOD:510,31-UNIMOD:21,39-UNIMOD:510,11-UNIMOD:510,14-UNIMOD:21	0.12	26.0	2	2	2
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	5-UNIMOD:510,9-UNIMOD:21	0.08	26.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	133-UNIMOD:510,139-UNIMOD:4,144-UNIMOD:510,82-UNIMOD:510,92-UNIMOD:510	0.15	26.0	2	2	2
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	165-UNIMOD:510,171-UNIMOD:21,178-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	95-UNIMOD:510,101-UNIMOD:4,74-UNIMOD:510	0.23	26.0	2	2	2
PRT	sp|Q92804-2|RBP56_HUMAN	Isoform Short of TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	72-UNIMOD:510,89-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|P85037-2|FOXK1_HUMAN	Isoform 2 of Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	253-UNIMOD:510,257-UNIMOD:21,264-UNIMOD:35,265-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	26-UNIMOD:510,37-UNIMOD:21,38-UNIMOD:21,45-UNIMOD:21,37-UNIMOD:510	0.04	26.0	5	3	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	1072-UNIMOD:510,1081-UNIMOD:21	0.01	26.0	1	1	0
PRT	sp|Q96CW6|S7A6O_HUMAN	Probable RNA polymerase II nuclear localization protein SLC7A6OS OS=Homo sapiens OX=9606 GN=SLC7A6OS PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	297-UNIMOD:510,302-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q14004-2|CDK13_HUMAN	Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	379-UNIMOD:510,383-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	182-UNIMOD:510,192-UNIMOD:510,204-UNIMOD:510,210-UNIMOD:35,211-UNIMOD:21,215-UNIMOD:35,193-UNIMOD:510,201-UNIMOD:21	0.17	25.0	3	3	3
PRT	sp|Q9NUQ3|TXLNG_HUMAN	Gamma-taxilin OS=Homo sapiens OX=9606 GN=TXLNG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	94-UNIMOD:510,97-UNIMOD:21,101-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|P17812-2|PYRG1_HUMAN	Isoform 2 of CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	340-UNIMOD:510,344-UNIMOD:21,353-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	71-UNIMOD:510,76-UNIMOD:21,81-UNIMOD:510	0.04	25.0	1	1	1
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	74-UNIMOD:510,76-UNIMOD:21,80-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	554-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	1874-UNIMOD:510,1878-UNIMOD:21,1885-UNIMOD:21,1887-UNIMOD:510,1909-UNIMOD:510,1913-UNIMOD:21,1920-UNIMOD:21,1922-UNIMOD:510,1888-UNIMOD:510,1892-UNIMOD:21,1896-UNIMOD:21,1906-UNIMOD:21,1908-UNIMOD:510	0.03	25.0	3	3	3
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	387-UNIMOD:510,490-UNIMOD:510,499-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510	0.05	25.0	3	3	3
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	null	207-UNIMOD:510,217-UNIMOD:21,218-UNIMOD:4,219-UNIMOD:510	0.06	25.0	1	1	0
PRT	sp|Q99873|ANM1_HUMAN	Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	357-UNIMOD:510,360-UNIMOD:4,364-UNIMOD:4,365-UNIMOD:21	0.04	25.0	1	1	0
PRT	sp|Q8N6T3|ARFG1_HUMAN	ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	null	340-UNIMOD:510,342-UNIMOD:510,343-UNIMOD:21,351-UNIMOD:4	0.05	25.0	1	1	0
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	894-UNIMOD:510,900-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	28-UNIMOD:510	0.06	24.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	448-UNIMOD:510,454-UNIMOD:510,455-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	201-UNIMOD:510,210-UNIMOD:21,215-UNIMOD:510,235-UNIMOD:510,237-UNIMOD:21,247-UNIMOD:4	0.09	24.0	2	2	2
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	694-UNIMOD:510,705-UNIMOD:21,710-UNIMOD:510	0.02	24.0	1	1	1
PRT	sp|Q15018|ABRX2_HUMAN	BRISC complex subunit Abraxas 2 OS=Homo sapiens OX=9606 GN=ABRAXAS2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	269-UNIMOD:510,280-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q08AD1-2|CAMP2_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	1284-UNIMOD:510,1292-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9H2U2-4|IPYR2_HUMAN	Isoform 4 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	143-UNIMOD:510,151-UNIMOD:21,154-UNIMOD:510	0.08	24.0	1	1	0
PRT	sp|Q6VN20-2|RBP10_HUMAN	Isoform 2 of Ran-binding protein 10 OS=Homo sapiens OX=9606 GN=RANBP10	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	241-UNIMOD:510,252-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	815-UNIMOD:510,815-UNIMOD:21,817-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	86-UNIMOD:510,87-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	2885-UNIMOD:510,2887-UNIMOD:21,2889-UNIMOD:21	0.00	24.0	2	1	0
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1072-UNIMOD:510,1084-UNIMOD:21,1453-UNIMOD:510,1453-UNIMOD:4,1459-UNIMOD:21,1462-UNIMOD:35	0.01	23.0	2	2	1
PRT	sp|O00115-2|DNS2A_HUMAN	Isoform 2 of Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	66-UNIMOD:510,70-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|P32004-3|L1CAM_HUMAN	Isoform 3 of Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1227-UNIMOD:510,1239-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	70-UNIMOD:510,71-UNIMOD:35,77-UNIMOD:21,81-UNIMOD:21	0.08	23.0	2	1	0
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	1335-UNIMOD:510,1356-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	460-UNIMOD:510,466-UNIMOD:35,471-UNIMOD:21,484-UNIMOD:510	0.02	23.0	1	1	0
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	298-UNIMOD:510,303-UNIMOD:21,313-UNIMOD:35,317-UNIMOD:510,302-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|O43852-9|CALU_HUMAN	Isoform 9 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	95-UNIMOD:510,100-UNIMOD:21	0.11	22.0	1	1	1
PRT	sp|P61916-2|NPC2_HUMAN	Isoform 2 of NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	36-UNIMOD:510,40-UNIMOD:21,42-UNIMOD:4,47-UNIMOD:4,51-UNIMOD:510	0.14	22.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	542-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	126-UNIMOD:510,133-UNIMOD:21	0.11	22.0	1	1	1
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	144-UNIMOD:510,169-UNIMOD:510,147-UNIMOD:21,124-UNIMOD:510,133-UNIMOD:21,135-UNIMOD:35	0.15	22.0	3	2	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	72-UNIMOD:510,91-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	172-UNIMOD:510,177-UNIMOD:4	0.07	22.0	1	1	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	107-UNIMOD:510,119-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|O60885|BRD4_HUMAN	Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	1291-UNIMOD:510,1309-UNIMOD:21,1320-UNIMOD:35,1314-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	232-UNIMOD:510,233-UNIMOD:21,245-UNIMOD:510,225-UNIMOD:510,232-UNIMOD:21,114-UNIMOD:510,130-UNIMOD:510	0.15	22.0	3	3	3
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	28-UNIMOD:510,28-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q9NQR4|NIT2_HUMAN	Omega-amidase NIT2 OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	196-UNIMOD:510,205-UNIMOD:21,213-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	25-UNIMOD:510,34-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	210-UNIMOD:510,211-UNIMOD:21,216-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P60174-3|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	244-UNIMOD:510,249-UNIMOD:21,255-UNIMOD:4,256-UNIMOD:510	0.05	21.0	1	1	0
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	230-UNIMOD:510,238-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	555-UNIMOD:510,563-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	159-UNIMOD:510,166-UNIMOD:21,168-UNIMOD:510,28-UNIMOD:510,35-UNIMOD:510	0.10	21.0	2	2	2
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	292-UNIMOD:510,304-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q14157-4|UBP2L_HUMAN	Isoform 4 of Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	453-UNIMOD:510,459-UNIMOD:35,460-UNIMOD:21,477-UNIMOD:510	0.03	21.0	1	1	0
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	75-UNIMOD:510,85-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	639-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	195-UNIMOD:510,203-UNIMOD:21,208-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|O14545|TRAD1_HUMAN	TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	317-UNIMOD:510,325-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q6PCE3|PGM2L_HUMAN	Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	166-UNIMOD:510,171-UNIMOD:35,175-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	548-UNIMOD:510,552-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	78-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	91-UNIMOD:510,94-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	295-UNIMOD:510,305-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q9ULD2-4|MTUS1_HUMAN	Isoform 4 of Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	330-UNIMOD:510,336-UNIMOD:21,340-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q96G46-2|DUS3L_HUMAN	Isoform 2 of tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	257-UNIMOD:510,260-UNIMOD:4,273-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q13158|FADD_HUMAN	FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	190-UNIMOD:510,190-UNIMOD:21,193-UNIMOD:35,196-UNIMOD:35	0.10	20.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	323-UNIMOD:510	0.06	20.0	1	1	1
PRT	sp|Q9UJU6-5|DBNL_HUMAN	Isoform 5 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	121-UNIMOD:510,129-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	3-UNIMOD:510,17-UNIMOD:21,21-UNIMOD:510	0.17	20.0	1	1	1
PRT	sp|P85037|FOXK1_HUMAN	Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	416-UNIMOD:510,416-UNIMOD:21,428-UNIMOD:21	0.02	20.0	1	1	0
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	309-UNIMOD:510,316-UNIMOD:21,320-UNIMOD:510	0.04	20.0	1	1	0
PRT	sp|Q8ND30|LIPB2_HUMAN	Liprin-beta-2 OS=Homo sapiens OX=9606 GN=PPFIBP2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	75-UNIMOD:21,81-UNIMOD:21,84-UNIMOD:21,86-UNIMOD:510	0.02	19.0	1	1	1
PRT	sp|Q14CZ0|CP072_HUMAN	UPF0472 protein C16orf72 OS=Homo sapiens OX=9606 GN=C16orf72 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	171-UNIMOD:510,173-UNIMOD:21,174-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	104-UNIMOD:510,104-UNIMOD:4,125-UNIMOD:21,134-UNIMOD:510	0.12	19.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	20-UNIMOD:510,27-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:510,9-UNIMOD:21	0.13	19.0	1	1	1
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	210-UNIMOD:510,211-UNIMOD:4,216-UNIMOD:21,220-UNIMOD:510	0.04	19.0	1	1	1
PRT	sp|Q9UKI8-4|TLK1_HUMAN	Isoform 4 of Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens OX=9606 GN=TLK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	50-UNIMOD:510,63-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	846-UNIMOD:510,848-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q9UJ70|NAGK_HUMAN	N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	70-UNIMOD:510,76-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	494-UNIMOD:510,495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21,521-UNIMOD:510	0.05	19.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	40-UNIMOD:510,50-UNIMOD:510	0.06	19.0	1	1	1
PRT	sp|Q06587|RING1_HUMAN	E3 ubiquitin-protein ligase RING1 OS=Homo sapiens OX=9606 GN=RING1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	24-UNIMOD:510,38-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	99-UNIMOD:510,104-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q6ZVT6|CF20D_HUMAN	Protein CFAP20DC OS=Homo sapiens OX=9606 GN=CFAP20DC PE=2 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	249-UNIMOD:21,251-UNIMOD:21	0.03	19.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	SSGSPYGGGYGSGGGSGGYGSR	1	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	51.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1844	25.22	2	2023.8121	2023.8121	R	R	333	355
PSM	SSGSPYGGGYGSGGGSGGYGSR	2	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	46.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=1844	25.220481666666664	2	2023.808654	2023.812145	R	R	355	377
PSM	DNLTLWTSDQQDDDGGEGNN	3	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510	ms_run[2]:scan=4649	49.499	2	2226.9361	2226.9361	R	-	228	248
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	4	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=3921	42.419	2	2608.0617	2608.0617	R	G	227	255
PSM	INSSGESGDESDEFLQSR	5	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=3179	35.928845	2	2070.8612	2069.8632	R	K	180	198
PSM	SSSPAPADIAQTVQEDLR	6	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4981	53.255	2	1997.9519	1997.9519	K	T	230	248
PSM	DFAARSPSASITDEDSNV	7	sp|Q86W92-3|LIPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3604	39.523	2	1994.8683	1994.8683	K	-	841	859
PSM	EYIPGQPPLSQSSDSSPTR	8	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3279	36.693	2	2158.9996	2158.9996	K	N	871	890
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	9	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,2-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=2345	29.045	3	3122.2192	3122.2192	R	A	10	40
PSM	DNLTLWTSDQQDDDGGEGNN	10	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:510	ms_run[1]:scan=4772	50.812284999999996	2	2227.9402	2226.9352	R	-	228	248
PSM	SLDSDESEDEEDDYQQK	11	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,17-UNIMOD:510	ms_run[2]:scan=1795	24.869	2	2098.8975	2098.8975	K	R	57	74
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	12	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2398	29.469	3	2847.2212	2847.2212	K	M	445	470
PSM	NSDVLQSPLDSAARDEL	13	sp|Q8NBJ5|GT251_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4611	49.13	2	1942.9097	1942.9097	K	-	606	623
PSM	TSENLALTGVDHSLPQDGSNAFISQK	14	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,1-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4421	47.181	3	2876.423	2876.4230	R	Q	351	377
PSM	DNLTLWTSDQQDEEAGEGN	15	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4618	49.184	2	2154.9402	2154.9402	R	-	228	247
PSM	DYEEVGADSADGEDEGEEY	16	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3805	41.42	2	2191.7691	2191.7691	K	-	431	450
PSM	SWASPVYTEADGTFSR	17	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4424	47.204	2	1886.83	1886.8300	R	L	342	358
PSM	SYELPDGQVITIGNER	18	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=4663	49.605	2	1823.9478	1823.9478	K	F	239	255
PSM	TSCGSPNYAAPEVISGR	19	sp|Q13131|AAPK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,3-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=3047	34.778423333333336	2	1878.8369	1878.8390	R	L	183	200
PSM	DFAARSPSASITDEDSNV	20	sp|Q86W92|LIPB1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=3604	39.522731666666665	2	1994.865393	1994.868263	K	-	994	1012
PSM	SSSPAPADIAQTVQEDLR	21	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=4981	53.254665	2	1997.950682	1997.951933	K	T	230	248
PSM	INSSGESGDESDEFLQSR	22	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3179	35.928845	2	2070.862373	2069.863906	R	K	180	198
PSM	CAPSAGSPAAAVGRESPGAAATSSSGPQAQQHR	23	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=1897	25.613	4	3312.4556	3312.4556	R	G	54	87
PSM	DSSTSPGDYVLSVSENSR	24	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4381	46.789	2	2012.8788	2012.8788	R	V	39	57
PSM	NQYDNDVTVWSPQGR	25	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3548	39.064	2	1891.8314	1891.8314	R	I	4	19
PSM	STAGDTHLGGEDFDNR	26	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=1796	24.877	2	1724.7814	1724.7814	K	M	221	237
PSM	EAYSGCSGPVDSECPPPPSSPVHK	27	sp|Q8N556|AFAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:4,20-UNIMOD:21,24-UNIMOD:510	ms_run[1]:scan=2068	26.927261666666663	3	2688.1823	2688.1868	K	A	246	270
PSM	SATSSSPGSPLHSLETSL	28	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=4799	51.152615	2	1870.876644	1870.877371	K	-	1203	1221
PSM	DSSTCPGDYVLSVSENSR	29	sp|P46109|CRKL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=4297	45.928	2	2085.8774	2085.8774	R	V	40	58
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	30	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,16-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=4821	51.398	3	2995.386	2995.3860	R	G	2913	2938
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	31	sp|Q9UPR0-2|PLCL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=2813	32.819	3	2685.0632	2685.0632	K	M	446	470
PSM	NDSPTQIPVSSDVCR	32	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=2755	32.376	2	1787.7973	1787.7973	R	L	656	671
PSM	YRDVAECGPQQELDLNSPR	33	sp|Q9BTE3-2|MCMBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,7-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=3079	35.041	3	2360.068	2360.0680	K	N	102	121
PSM	IQALQQQADEAEDR	34	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510	ms_run[1]:scan=2007	26.43768	2	1648.829455	1647.827645	K	A	14	28
PSM	APVQPQQSPAAAPGGTDEKPSGK	35	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21,19-UNIMOD:510,23-UNIMOD:510	ms_run[2]:scan=1191	20.22	3	2399.2583	2399.2583	K	E	9	32
PSM	EAYSGCSGPVDSECPPPPSSPVHK	36	sp|Q8N556|AFAP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:4,19-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2068	26.927	3	2688.1874	2688.1874	K	A	246	270
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	37	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:35,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2190	27.858	3	2826.1852	2826.1852	R	E	418	442
PSM	GPSEETGGAVFDHPAK	38	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,3-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2145	27.509	2	1745.8298	1745.8298	R	I	575	591
PSM	MGNTPDSASDNLGFR	39	sp|Q8NBJ7-5|SUMF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,1-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=2859	33.163	2	1710.7133	1710.7133	R	C	191	206
PSM	MPIEGSENPERPFLEK	40	sp|O60563|CCNT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3622	39.698	2	2020.0013	2020.0013	K	A	439	455
PSM	NLEQILNGGESPK	41	sp|Q13033-2|STRN3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4300	45.951	2	1545.8076	1545.8076	K	Q	219	232
PSM	QVPDSAATATAYLCGVK	42	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=4227	45.206	2	1898.9485	1898.9486	R	A	107	124
PSM	DSSTSPGDYVLSVSENSR	43	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4381	46.789093333333334	2	2012.8772	2012.8783	R	V	39	57
PSM	FSEGVLQSPSQDQEK	44	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,8-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2775	32.539	2	1825.8772	1825.8772	R	L	428	443
PSM	GEQVSQNGLPAEQGSPR	45	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=1765	24.649	2	1866.8685	1866.8685	K	V	2111	2128
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	46	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,21-UNIMOD:21	ms_run[2]:scan=3905	42.271	3	2608.0617	2608.0617	R	G	227	255
PSM	KEESEESDDDMGFGLFD	47	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4315	46.076	2	2032.8732	2032.8732	K	-	73	90
PSM	RQLQEDQENNLQDNQTSNSSPCR	48	sp|Q92576-2|PHF3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,20-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=1351	21.497	3	2874.2412	2874.2412	K	S	1507	1530
PSM	TLNAETPKSSPLPAK	49	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:510,9-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1915	25.743	2	1814.9681	1814.9681	R	G	208	223
PSM	TRKSPSSDSWTCADTSTER	50	sp|Q8N6T3-4|ARFG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,1-UNIMOD:21,3-UNIMOD:510,12-UNIMOD:4	ms_run[2]:scan=1438	22.159	3	2319.0475	2319.0475	K	R	227	246
PSM	TSENLALTGVDHSLPQDGSNAFISQK	51	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,2-UNIMOD:21,8-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4800	51.16	3	2956.3893	2956.3893	R	Q	351	377
PSM	VFVGGLSPDTSEEQIK	52	sp|O14979-3|HNRDL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,7-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4060	43.659	2	1852.9496	1852.9496	K	E	116	132
PSM	VTLYNTDQDGSDSPR	53	sp|Q9UPW0-2|FOXJ3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2481	30.164	2	1780.7729	1780.7729	R	S	177	192
PSM	TSENLALTGVDHSLPQDGSNAFISQK	54	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,1-UNIMOD:21,8-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=4800	51.160175	3	2956.3869	2956.3888	R	Q	351	377
PSM	ADLNQGIGEPQSPSR	55	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2222	28.11	2	1681.7885	1681.7885	R	R	63	78
PSM	DNLTLWTSDQQDDDGGEGNN	56	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510	ms_run[2]:scan=4648	49.491	3	2226.9361	2226.9361	R	-	228	248
PSM	GILAADESTGSIAK	57	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2823	32.895	2	1479.7858	1479.7858	K	R	29	43
PSM	ITPSYVAFTPEGER	58	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3807	41.435	2	1679.802	1679.8020	R	L	61	75
PSM	LIAPVAEEEATVPNNK	59	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=2957	33.947	2	1762.0149	1762.0149	K	I	8	24
PSM	QYDSVECPFCDEVSK	60	sp|P50750|CDK9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:4,10-UNIMOD:4,15-UNIMOD:510	ms_run[2]:scan=3735	40.776	2	2009.8424	2009.8424	K	Y	4	19
PSM	RIITYNEAMDSPDQ	61	sp|Q7Z417-2|NUFP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=2362	29.173	2	1781.7755	1781.7755	K	-	107	121
PSM	TAFQEALDAAGDK	62	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3258	36.536	2	1403.7569	1403.7569	K	L	9	22
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	63	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4796	51.117	3	3570.4718	3570.4718	R	-	207	238
PSM	TVIIEQSWGSPK	64	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3794	41.325	2	1491.8011	1491.8011	R	V	61	73
PSM	GILAADESTGSIAK	65	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=2823	32.894553333333334	2	1479.784967	1479.785825	K	R	29	43
PSM	DSSTSPGDYVLSVSENSR	66	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=4381	46.789093333333334	2	2012.877725	2012.878828	R	V	39	57
PSM	AEPQPLSPASSSYSVSSPR	67	sp|P18850|ATF6A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=2931	33.754	2	2059.9676	2059.9676	K	S	88	107
PSM	AFLAELEQNSPK	68	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4035	43.404	2	1493.7803	1493.7803	K	I	2424	2436
PSM	AGSSTPGDAPPAVAEVQGR	69	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2513	30.418	2	1879.8889	1879.8889	R	S	2885	2904
PSM	EGLELPEDEEEK	70	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2883	33.357	2	1483.7566	1483.7566	K	K	539	551
PSM	EVDEQMLNVQNK	71	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1743	24.488	2	1529.8032	1529.8032	K	N	325	337
PSM	GQLCELSCSTDYR	72	sp|Q99873-5|ANM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:4,8-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=2871	33.252	2	1701.6952	1701.6952	K	M	271	284
PSM	SCGSSTPDEFPTDIPGTK	73	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,2-UNIMOD:4,6-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=3707	40.50631166666666	2	2042.9160	2042.9175	R	G	104	122
PSM	RQLQEDQENNLQDNQTSNSSPCR	74	sp|Q92576|PHF3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:510,19-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1351	21.496611666666666	3	2874.236630	2874.241209	K	S	1595	1618
PSM	AEEDEILNRSPR	75	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1912	25.721	2	1541.7299	1541.7299	K	N	466	478
PSM	DNLTLWTSDMQGDGEEQNK	76	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=4468	47.666	3	2248.059	2248.0590	R	E	204	223
PSM	EAAFSPGQQDWSR	77	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3344	37.218	2	1591.6881	1591.6881	R	D	1099	1112
PSM	LDQPVSAPPSPR	78	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=1963	26.097	2	1376.6913	1376.6913	K	D	235	247
PSM	NQYDNDVTVWSPQGR	79	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=3525	38.829	2	1891.8314	1891.8314	R	I	4	19
PSM	RVSVCAETYNPDEEEEDTDPR	80	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2657	31.605	3	2624.0798	2624.0798	R	V	97	118
PSM	SLPTTVPESPNYR	81	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3023	34.547	2	1573.7602	1573.7602	R	N	689	702
PSM	TSCGSPNYAAPEVISGR	82	sp|P54646|AAPK2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21,3-UNIMOD:4	ms_run[2]:scan=3047	34.778	2	1878.8395	1878.8395	R	L	172	189
PSM	GEAAAERPGEAAVASSPSK	83	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,16-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=1126	19.682281666666665	3	1931.9600	1931.9621	K	A	12	31
PSM	NQYDNDVTVWSPQGR	84	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=3548	39.06351	2	1891.830426	1891.831424	R	I	4	19
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	85	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=2761	32.434	3	3127.3403	3127.3403	R	-	502	532
PSM	DNLTLWTSDSAGEECDAAEGAEN	86	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,15-UNIMOD:4	ms_run[2]:scan=4781	50.895	3	2488.0396	2488.0396	R	-	223	246
PSM	DNSTMGYMMAK	87	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=906	17.583	2	1363.6094	1363.6094	R	K	613	624
PSM	FSGWYDADLSPAGHEEAK	88	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3995	43.036	3	2126.9623	2126.9623	R	R	22	40
PSM	GGGGNFGPGPGSNFR	89	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2668	31.687	2	1490.6516	1490.6516	R	G	202	217
PSM	GPLQSVQVFGR	90	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3914	42.366	2	1300.6753	1300.6753	K	K	5	16
PSM	HELQANCYEEVK	91	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:4,12-UNIMOD:510	ms_run[2]:scan=1552	23.029	2	1586.8035	1586.8035	K	D	133	145
PSM	IFVGGLSPDTPEEK	92	sp|Q14103-4|HNRPD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3889	42.122	2	1635.8433	1635.8433	K	I	165	179
PSM	IGQGTFGEVFK	93	sp|P50750|CDK9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4507	48.133	2	1329.7006	1329.7006	K	A	25	36
PSM	KEESEESDDDMGFGLFD	94	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4847	51.675	2	2112.8395	2112.8395	K	-	73	90
PSM	KITIADCGQLE	95	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2727	32.14	2	1314.749	1314.7490	K	-	95	106
PSM	NPATTNQTEFERVF	96	sp|P50750|CDK9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=5147	55.602	2	1846.7752	1846.7752	R	-	359	373
PSM	QSSYSQQPYNNQGQQQNMESSGSQGGR	97	sp|Q92804-2|RBP56_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,18-UNIMOD:35	ms_run[2]:scan=1167	20.008	3	3024.3076	3024.3076	K	A	72	99
PSM	SAPASPTHPGLMSPR	98	sp|P85037-2|FOXK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=1582	23.251	2	1714.7363	1714.7363	R	S	253	268
PSM	TYSLSSSFSSSSSTRK	99	sp|O60563|CCNT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21,13-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3196	36.056	2	2018.8313	2018.8313	K	R	558	574
PSM	VEIIANDQGNRTTPSYVAFTDTER	100	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=4480	47.79669833333333	3	2890.2975	2890.2994	K	L	26	50
PSM	AFGPGLQGGSAGSPAR	101	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[1]:scan=2480	30.15673833333333	2	1542.7390	1542.7399	K	F	1072	1088
PSM	EFGYDSPHDLDSD	102	sp|Q96CW6|S7A6O_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3386	37.619	2	1609.6034	1609.6034	K	-	297	310
PSM	GGDVSPSPYSSSSWR	103	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2963	33.991	2	1681.7197	1681.7197	R	R	379	394
PSM	KRGPSEETGGAVFDHPAK	104	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=1475	22.446	3	2144.0553	2144.0553	R	I	573	591
PSM	NFSDNQLQEGK	105	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1813	25	2	1346.7103	1346.7103	R	N	182	193
PSM	NLVSPAYCTQESR	106	sp|Q9NUQ3|TXLNG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=2658	31.613	2	1637.7333	1637.7333	R	E	94	107
PSM	SGSSSPDSEITELK	107	sp|P17812-2|PYRG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2992	34.261	2	1583.7604	1583.7604	R	F	340	354
PSM	TFDQLTPDESK	108	sp|Q15293|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2522	30.485	2	1427.6858	1427.6858	K	E	71	82
PSM	TQSPGGCSAEAVLAR	109	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2587	31.004	2	1616.7442	1616.7442	R	K	74	89
PSM	YAALSVDGEDENEGEDYAE	110	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3668	40.072	2	2108.8758	2108.8758	K	-	554	573
PSM	YSPTSPTYSPTTPK	111	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2685	31.812	2	1753.7889	1753.7889	K	Y	1874	1888
PSM	GVVDSEDLPLNISR	112	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510	ms_run[1]:scan=4027	43.33209333333333	2	1546.841552	1546.841504	R	E	387	401
PSM	VEIIANDQGNRTTPSYVAFTDTER	113	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=4223	45.17494833333333	3	2890.2973	2890.2994	K	L	26	50
PSM	IIYGGSVTGATCK	114	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[1]:scan=2410	29.557528333333334	2	1473.756044	1473.757502	R	E	207	220
PSM	GQLCELSCSTDYR	115	sp|Q99873|ANM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,4-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=2871	33.252003333333334	2	1701.6953	1701.6947	K	M	357	370
PSM	TRKSPSSDSWTCADTSTER	116	sp|Q8N6T3|ARFG1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,3-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1438	22.159233333333333	3	2319.0438	2319.0470	K	R	340	359
PSM	EFVSISSPAHVAT	117	sp|P22681|CBL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3674	40.142	2	1457.7016	1457.7016	R	-	894	907
PSM	ELAEDGYSGVEVR	118	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=2650	31.552	2	1456.7258	1456.7258	R	V	28	41
PSM	ELQAAGKSPEDLER	119	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=1958	26.061	2	1689.8611	1689.8611	K	L	448	462
PSM	GALQNIIPASTGAAK	120	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3591	39.411	2	1558.8756	1558.8756	R	A	201	216
PSM	GASQAGMTGYGMPR	121	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:35,8-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=1032	18.927	2	1528.6264	1528.6264	R	Q	204	218
PSM	GEPNVSYICSR	122	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2440	29.777	2	1394.6114	1394.6114	R	Y	210	221
PSM	ISLEQPPNGSDTPNPEK	123	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=2843	33.042	3	1969.967	1969.9670	R	Y	694	711
PSM	NNSGEEFDCAFR	124	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2837	32.998	2	1478.6309	1478.6309	R	L	355	367
PSM	NVIGLQMGTNR	125	sp|P37802-2|TAGL2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3417	37.905	2	1315.6532	1315.6532	K	G	193	204
PSM	QMPSESLDPAFSPR	126	sp|Q15018|ABRX2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3947	42.64	2	1674.7537	1674.7537	R	M	269	283
PSM	SESVEGFLSPSR	127	sp|Q08AD1-2|CAMP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3757	40.994	2	1407.6495	1407.6495	R	C	1284	1296
PSM	SIYYITGESK	128	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2794	32.679	2	1227.7023	1227.7023	K	E	482	492
PSM	SLVESVSSSPNK	129	sp|Q9H2U2-4|IPYR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1933	25.878	2	1380.7174	1380.7174	R	E	143	155
PSM	SQDSYPGSPSLSPR	130	sp|Q6VN20-2|RBP10_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2404	29.513	2	1590.7139	1590.7139	K	H	241	255
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	131	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=2729	32.154	3	2448.1858	2448.1858	R	L	815	839
PSM	TTPSVVAFTADGER	132	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3816	41.516	2	1563.7394	1563.7394	R	L	86	100
PSM	YALYDATYETK	133	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3071	34.957	2	1404.7449	1404.7449	R	E	82	93
PSM	TTPSYVAFTDTER	134	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510	ms_run[1]:scan=3244	36.43102833333333	2	1520.7557	1520.7566	R	L	37	50
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	135	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2729	32.15379	3	2448.1836	2448.1853	R	L	815	839
PSM	ADLNQGIGEPQSPSR	136	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[1]:scan=2222	28.109653333333334	2	1681.786721	1681.788496	R	R	63	78
PSM	AGSSTPGDAPPAVAEVQGR	137	sp|Q7Z6Z7|HUWE1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2513	30.417571666666667	2	1879.887767	1879.888939	R	S	2885	2904
PSM	AFGPGLQGGSAGSPAR	138	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2480	30.157	2	1542.7404	1542.7404	K	F	1072	1088
PSM	ALINSPEGAVGR	139	sp|O00115-2|DNS2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2728	32.147	2	1296.6651	1296.6651	R	S	66	78
PSM	DVIELTDDSFDK	140	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=4387	46.861	2	1463.7668	1463.7668	K	N	158	170
PSM	EAAGGNDSSGATSPINPAVALE	141	sp|P32004-3|L1CAM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4413	47.121	2	2140.9738	2140.9738	K	-	1227	1249
PSM	ELISNASDALDK	142	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2791	32.657	2	1342.7616	1342.7616	R	I	42	54
PSM	EMPQDLRSPARTPPSEEDSAEAER	143	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=1687	24.049	4	2827.2544	2827.2544	K	L	70	94
PSM	HIYYITGETK	144	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=2095	27.127	2	1291.7449	1291.7449	K	D	490	500
PSM	LALDGETLGEEEQEDEQPPWASPSPTSR	145	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,22-UNIMOD:21	ms_run[2]:scan=4974	53.158	3	3181.4189	3181.4189	R	Q	1335	1363
PSM	NPATTNQTEFER	146	sp|P50750|CDK9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2333	28.956	2	1600.6384	1600.6384	R	V	359	371
PSM	TYSLSSSFSSSSSTR	147	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=3847	41.773	2	1776.7069	1776.7069	K	K	558	573
PSM	TYSLSSSFSSSSSTR	148	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=3934	42.516	2	1856.6732	1856.6732	K	K	558	573
PSM	TYSLSSSFSSSSSTR	149	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=3847	41.77321166666666	2	1776.7042	1776.7063	K	K	558	573
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	150	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,7-UNIMOD:35,12-UNIMOD:21,25-UNIMOD:510	ms_run[1]:scan=1018	18.817016666666667	3	2695.2022	2695.2064	K	L	460	485
PSM	DGGRSSPGGQDEGGFMAQGK	151	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:35,20-UNIMOD:510	ms_run[1]:scan=1322	21.26634333333333	3	2100.9182	2100.9203	R	T	298	318
PSM	GEAAAERPGEAAVASSPSK	152	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,15-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=1126	19.682281666666665	3	1931.960503	1931.962621	K	A	12	31
PSM	DWILPSDYDHAEAEAR	153	sp|O43852-9|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4582	48.824	3	2000.873	2000.8730	K	H	95	111
PSM	EVNVSPCPTQPCQLSK	154	sp|P61916-2|NPC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2601	31.106	2	1990.953	1990.9530	K	G	36	52
PSM	HGSYEDAVHSGALND	155	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1879	25.482	2	1604.7279	1604.7279	K	-	542	557
PSM	IGRIEDVTPIPSDSTR	156	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2842	33.035	3	1868.9457	1868.9457	K	R	126	142
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	157	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,26-UNIMOD:510	ms_run[2]:scan=3692	40.304	3	3010.3787	3010.3787	K	E	144	170
PSM	LQQGAGLESPQGQPEPGAASPQR	158	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=2245	28.278	3	2416.1596	2416.1596	R	Q	72	95
PSM	LTWHSCPEDEAQ	159	sp|Q13185|CBX3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=2446	29.835	2	1505.6669	1505.6669	R	-	172	184
PSM	NPATTNQTEFERVF	160	sp|P50750|CDK9_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=5715	64.217	2	1926.7416	1926.7416	R	-	359	373
PSM	QASTDAGTAGALTPQHVR	161	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=1474	22.439	3	1893.9158	1893.9158	R	A	107	125
PSM	QEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQR	162	sp|O60885|BRD4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,19-UNIMOD:21,30-UNIMOD:35	ms_run[2]:scan=2535	30.583	4	3936.8234	3936.8234	R	E	1291	1326
PSM	RGPSEETGGAVFDHPAK	163	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,7-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1896	25.607	3	1981.8973	1981.8973	K	I	574	591
PSM	SADTLWDIQK	164	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4139	44.43	2	1323.6748	1323.6748	K	D	320	330
PSM	SADTLWDIQK	165	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4305	45.988	2	1323.6748	1323.6748	K	D	320	330
PSM	SAPASPTHPGLMSPR	166	sp|P85037-2|FOXK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=2340	29.009	2	1698.7414	1698.7414	R	S	253	268
PSM	SCGSSTPDEFPTDIPGTK	167	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,2-UNIMOD:4,18-UNIMOD:510	ms_run[2]:scan=3707	40.506	2	2042.918	2042.9180	R	G	104	122
PSM	SPSSDSWTCADTSTER	168	sp|Q8N6T3-4|ARFG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2381	29.342	2	1899.7406	1899.7406	K	R	230	246
PSM	SSGPYGGGGQYFAK	169	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2877	33.299	2	1522.713	1522.7130	R	P	232	246
PSM	STAGDTHLGGEDFDNR	170	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1783	24.782	3	1724.7814	1724.7814	K	M	221	237
PSM	SVTEQGAELSNEER	171	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=1972	26.162	2	1661.7358	1661.7358	K	N	28	42
PSM	TSENLALTGVDHSLPQDGSNAFISQK	172	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,19-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4699	50.025	3	2956.3893	2956.3893	R	Q	351	377
PSM	TSENLALTGVDHSLPQDGSNAFISQK	173	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,19-UNIMOD:21,26-UNIMOD:510	ms_run[1]:scan=4699	50.025216666666665	3	2956.387433	2956.389299	R	Q	351	377
PSM	AGFAGDDAPR	174	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1247	20.657	2	1009.5041	1009.5041	K	A	19	29
PSM	AVDNQVYVATASPARDDK	175	sp|Q9NQR4|NIT2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=2037	26.698	3	2067.031	2067.0310	R	A	196	214
PSM	EDQTEYLEER	176	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1990	26.311	2	1344.6258	1344.6258	K	R	187	197
PSM	EGMNIVEAMER	177	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3980	42.925	2	1311.6375	1311.6375	K	F	74	85
PSM	EQFLDGDGWTSR	178	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3723	40.674	2	1443.6843	1443.6843	K	W	25	37
PSM	EQFLDGDGWTSR	179	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=4063	43.681	2	1523.6506	1523.6506	K	W	25	37
PSM	GSPHYFSPFRPY	180	sp|Q13242|SRSF9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4823	51.413	2	1647.6737	1647.6737	R	-	210	222
PSM	IIYGGSVTGATCK	181	sp|P60174-3|TPIS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=2410	29.558	2	1473.7575	1473.7575	R	E	244	257
PSM	IMNTFSVVPSPK	182	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:35,4-UNIMOD:21,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3851	41.816	2	1562.7493	1562.7493	R	V	163	175
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	183	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=3999	43.067	3	3090.3451	3090.3451	K	E	144	170
PSM	LAIQGPEDSPSR	184	sp|Q15773|MLF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2402	29.498	2	1382.6655	1382.6655	R	Q	230	242
PSM	LELQGPRGSPNAR	185	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=1784	24.79	2	1507.7721	1507.7721	R	S	555	568
PSM	LVQAFQFTDK	186	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3894	42.174	2	1343.7163	1343.7163	R	H	159	169
PSM	QVPDSAATATAYLCGVK	187	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:510	ms_run[2]:scan=4210	45.077	3	1898.9485	1898.9486	R	A	107	124
PSM	RGPSEETGGAVFDHPAK	188	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1590	23.309	3	1901.9309	1901.9309	K	I	574	591
PSM	SPDLAPTPAPQSTPR	189	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2085	27.054	2	1647.8082	1647.8082	K	N	292	307
PSM	SQYAYAAQNLLSHHDSHSSVILK	190	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=3580	39.315	4	2796.331	2796.3310	K	M	416	439
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	191	sp|Q14157-4|UBP2L_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:35,8-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=1018	18.817	3	2695.2069	2695.2069	K	L	453	478
PSM	TDGEPGPQGWSPR	192	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2578	30.925	2	1496.6509	1496.6509	K	E	75	88
PSM	TTPSVVAFTADGER	193	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3851	41.816	2	1563.7394	1563.7394	R	L	86	100
PSM	TTPSYVAFTDTER	194	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3772	41.159	2	1600.7234	1600.7234	R	L	37	50
PSM	VPTANVSVVDLTCR	195	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3989	42.992	2	1643.8166	1643.8166	R	L	235	249
PSM	YEWDVAEAR	196	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3055	34.837	2	1171.5722	1171.5722	K	K	639	648
PSM	YLLGDAPVSPSSQK	197	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3386	37.619	2	1608.8437	1608.8437	K	L	195	209
PSM	ALPSLNTGSSSPR	198	sp|O14545|TRAD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[1]:scan=2847	33.07318166666666	2	1399.6913	1399.6916	R	G	317	330
PSM	AVAGVMITASHNR	199	sp|Q6PCE3|PGM2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=1558	23.074	3	1455.7118	1455.7118	K	K	166	179
PSM	DGGRSSPGGQDEGGFMAQGK	200	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:35,20-UNIMOD:510	ms_run[2]:scan=1322	21.266	3	2100.9208	2100.9208	R	T	298	318
PSM	EAESSPFVER	201	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=1841	25.199	2	1263.5597	1263.5597	K	L	548	558
PSM	EALQDVEDENQ	202	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2233	28.191	2	1322.605	1322.6050	K	-	223	234
PSM	EIIDLVLDR	203	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=4626	49.298	2	1118.6759	1118.6759	K	I	78	87
PSM	EMPQDLRSPARTPPSEEDSAEAER	204	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:35,8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=1874	25.444	4	2907.2207	2907.2207	K	L	70	94
PSM	GDFCIQVGR	205	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=2945	33.858	2	1084.5548	1084.5548	R	N	91	100
PSM	GDLGIEIPAEK	206	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3535	38.942	2	1208.7289	1208.7289	R	V	295	306
PSM	GGNFGGRSSGPYGGGGQYFAK	207	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,9-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=3447	38.167	3	2247.9776	2247.9776	K	P	225	246
PSM	HGESAWNLENR	208	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2366	29.203	2	1425.6251	1425.6251	R	F	11	22
PSM	KRGPSEETGGAVFDHPAK	209	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=1515	22.756	3	2064.089	2064.0890	R	I	573	591
PSM	NSGSFPSPSISPR	210	sp|Q9ULD2-4|MTUS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3256	36.521	2	1525.6428	1525.6428	R	-	330	343
PSM	QENCGAQQVPAGPGTSTPPSSPVR	211	sp|Q96G46-2|DUS3L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=2385	29.372	3	2535.1637	2535.1637	R	T	257	281
PSM	RADLNQGIGEPQSPSRR	212	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=1384	21.743	3	1993.9907	1993.9907	R	V	62	79
PSM	RGPSEETGGAVFDHPAK	213	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=1677	23.975	2	1901.9309	1901.9309	K	I	574	591
PSM	SGAMSPMSWNSDASTSEAS	214	sp|Q13158|FADD_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,4-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=2609	31.206	2	2047.76	2047.7600	R	-	190	209
PSM	TAENATSGETLEENEAGD	215	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=1914	25.736	2	1870.8128	1870.8128	K	-	323	341
PSM	TLNAETPKSSPLPAK	216	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1898	25.619	3	1814.9681	1814.9681	R	G	208	223
PSM	TTPSYVAFTDTER	217	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=3262	36.566	2	1520.7571	1520.7571	R	L	37	50
PSM	WSNWEIPVSTDGK	218	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4688	49.916	2	1665.8076	1665.8076	K	H	207	220
PSM	YQEQGGEASPQRTWEQQQEVVSR	219	sp|Q9UJU6-5|DBNL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2888	33.395	3	2833.2881	2833.2881	R	N	121	144
PSM	YSPTSPTYSPTSPK	220	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2660	31.627	2	1739.7733	1739.7733	K	Y	1909	1923
PSM	WSNWEIPVSTDGK	221	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,9-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4688	49.91553	2	1665.8067	1665.8071	K	H	207	220
PSM	VEIIANDQGNR	222	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510	ms_run[1]:scan=1634	23.649853333333333	2	1261.6825	1261.6834	K	T	26	37
PSM	TLNAETPKSSPLPAK	223	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,8-UNIMOD:510,9-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=1898	25.619055	3	1814.9660	1814.9676	R	G	208	223
PSM	YVASYLLAALGGNSSPSAK	224	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,15-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=5384	59.164305000000006	3	2016.0601	2016.0600	R	D	3	22
PSM	YSPTSPTYSPTSPVYTPTSPK	225	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:21,19-UNIMOD:21,21-UNIMOD:510	ms_run[1]:scan=4295	45.91292333333333	3	2565.1037	2565.1037	K	Y	1888	1909
PSM	DSSTSPGDYVLSVSENSR	226	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4372	46.72053333333333	3	2012.8782	2012.8783	R	V	39	57
PSM	SAPASPTHPGLMSPR	227	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=2340	29.00861666666667	2	1698.739964	1698.741426	R	S	416	431
PSM	SLVESVSSSPNK	228	sp|Q9H2U2|IPYR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=1933	25.877888333333335	2	1380.715853	1380.717411	R	E	309	321
PSM	AALLSQIPGPTAAYIK	229	sp|Q8ND30|LIPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4226	45.198	2	1886.881	1886.8810	R	E	71	87
PSM	AGSSTPGDAPPAVAEVQGR	230	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2523	30.492	3	1879.8889	1879.8889	R	S	2885	2904
PSM	ATAPQTQHVSPMR	231	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=905	17.576	3	1552.7281	1552.7281	R	Q	124	137
PSM	ATSTETSSSVETDLQPFR	232	sp|Q14CZ0|CP072_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21	ms_run[2]:scan=4613	49.145	2	2148.9078	2148.9078	R	E	171	189
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	233	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:4,22-UNIMOD:21,31-UNIMOD:510	ms_run[2]:scan=3533	38.927	4	3527.556	3527.5560	K	L	104	135
PSM	CSGPGLSPGMVR	234	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=2107	27.214	2	1346.5936	1346.5936	K	A	1453	1465
PSM	DISLSDYK	235	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:510	ms_run[2]:scan=3008	34.396	2	1007.5812	1007.5812	K	G	28	36
PSM	DNLTLWTSDMQGDGEEQNK	236	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=3806	41.427	3	2264.0539	2264.0539	R	E	204	223
PSM	EDTEEHHLRDYFEQYGK	237	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,17-UNIMOD:510	ms_run[2]:scan=3828	41.632	4	2263.0818	2263.0818	K	I	114	131
PSM	ELISNSSDALDK	238	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2280	28.55	2	1358.7566	1358.7566	R	I	47	59
PSM	EQVANSAFVER	239	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1846	25.236	2	1282.673	1282.6730	K	V	492	503
PSM	GLTSVINQK	240	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3382	37.591	2	1106.6373	1106.6373	R	L	300	309
PSM	GNDPLTSSPGR	241	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=1480	22.484	2	1213.5552	1213.5552	R	S	20	31
PSM	GPSEETGGAVFDHPAK	242	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1919	25.774	3	1745.8298	1745.8298	R	I	575	591
PSM	GVQVETISPGDGR	243	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2317	28.839	2	1427.687	1427.6870	M	T	2	15
PSM	ICEPGYSPTYK	244	sp|P07858|CATB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:4,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2438	29.762	2	1461.6888	1461.6888	K	Q	210	221
PSM	IMNTFSVVPSPK	245	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4374	46.736	2	1546.7544	1546.7544	R	V	163	175
PSM	ISDYFEYQGGNGSSPVR	246	sp|Q9UKI8-4|TLK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=3732	40.754	3	1988.873	1988.8730	K	G	50	67
PSM	KEESEESDDDMGFGLFD	247	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=4982	53.262	2	2016.8783	2016.8783	K	-	73	90
PSM	QEYDESGPSIVHR	248	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1676	23.968	3	1549.7585	1549.7585	K	K	360	373
PSM	RADLNQGIGEPQSPSR	249	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=1669	23.916	3	1837.8896	1837.8896	R	R	62	78
PSM	RWLSSQPSFK	250	sp|O60563|CCNT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3551	39.086	2	1462.7048	1462.7048	K	L	333	343
PSM	SGTPPRQGSITSPQANEQSVTPQR	251	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1854	25.295	3	2636.2768	2636.2768	K	R	846	870
PSM	SLGLSLSGGDQEDAGR	252	sp|Q9UJ70|NAGK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3750	40.914	2	1674.7674	1674.7674	R	I	70	86
PSM	SQYAYAAQNLLSHHDSHSSVILK	253	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:21,16-UNIMOD:21,23-UNIMOD:510	ms_run[2]:scan=3841	41.73	4	2876.2973	2876.2973	K	M	416	439
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	254	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21,28-UNIMOD:510	ms_run[2]:scan=1200	20.288	4	3246.2875	3246.2875	R	K	494	522
PSM	TLEEDEEELFK	255	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3728	40.724	2	1448.7559	1448.7559	K	M	40	51
PSM	TPQEAIMDGTEIAVSPR	256	sp|Q06587|RING1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3796	41.339	3	1927.9175	1927.9175	R	S	24	41
PSM	TYSLSSSFSSSSSTR	257	sp|O60563|CCNT1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,1-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=3934	42.515771666666666	2	1856.6726	1856.6727	K	K	558	573
PSM	VEIIANDQGNRTTPSYVAFTDTER	258	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[1]:scan=4058	43.645185	3	2810.3316	2810.3331	K	L	26	50
PSM	SSSPAPADIAQTVQEDLR	259	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=4986	53.318369999999994	3	1997.9513	1997.9514	K	T	230	248
PSM	QEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQR	260	sp|O60885|BRD4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,24-UNIMOD:21,30-UNIMOD:35	ms_run[1]:scan=2535	30.5831	4	3936.8166	3936.8229	R	E	1291	1326
PSM	AGSSTPGDAPPAVAEVQGR	261	sp|Q7Z6Z7|HUWE1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=2523	30.49208333333333	3	1879.8882	1879.8884	R	S	2885	2904
PSM	SATSSSPGSPLHSLETSL	262	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=5464	60.333308333333335	2	1950.8416	1950.8432	K	-	1203	1221
PSM	HTGPNSPDTANDGFVR	263	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=1604	23.415375	3	1797.7880	1797.7890	K	L	99	115
PSM	ERTETPSGSSSGNNRIEDK	264	sp|Q6ZVT6|CF20D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=5508	61.00111333333333	2	2224.9172	2222.8832	R	A	247	266
PSM	DYEEVGADSADGEDEGEEY	265	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3805	41.41963	2	2191.766558	2191.769062	K	-	431	450