MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100511_016ROR2.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100511_016ROR2.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	228-UNIMOD:510	0.09	45.0	4	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	207-UNIMOD:510,214-UNIMOD:21,207-UNIMOD:21	0.14	44.0	2	1	0
PRT	sp|P68363-2|TBA1B_HUMAN	Isoform 2 of Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	315-UNIMOD:510,316-UNIMOD:21,335-UNIMOD:21,307-UNIMOD:510,314-UNIMOD:510	0.09	42.0	5	2	1
PRT	sp|P63104-2|1433Z_HUMAN	Isoform 2 of 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	148-UNIMOD:510	0.14	41.0	2	1	0
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	554-UNIMOD:510,570-UNIMOD:21	0.03	40.0	1	1	1
PRT	sp|Q9H1E3-2|NUCKS_HUMAN	Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	89-UNIMOD:510,106-UNIMOD:21,110-UNIMOD:510,98-UNIMOD:35	0.11	39.0	3	1	0
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	null	129-UNIMOD:510,149-UNIMOD:21,150-UNIMOD:510,138-UNIMOD:35,144-UNIMOD:21	0.09	37.0	3	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	292-UNIMOD:510,301-UNIMOD:21,305-UNIMOD:21,306-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,613-UNIMOD:510,617-UNIMOD:35,620-UNIMOD:35,621-UNIMOD:35,623-UNIMOD:510,42-UNIMOD:510,53-UNIMOD:510,187-UNIMOD:510,482-UNIMOD:510,491-UNIMOD:510	0.10	35.0	9	6	4
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	39-UNIMOD:510,43-UNIMOD:21	0.09	34.0	1	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	null	39-UNIMOD:510,41-UNIMOD:21	0.06	34.0	1	1	0
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	223-UNIMOD:510	0.09	33.0	2	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	158-UNIMOD:510,189-UNIMOD:510	0.13	33.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	33.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	431-UNIMOD:510,432-UNIMOD:21,423-UNIMOD:510,430-UNIMOD:510	0.06	32.0	2	2	2
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	300-UNIMOD:510,309-UNIMOD:21,313-UNIMOD:21,314-UNIMOD:510,47-UNIMOD:510,58-UNIMOD:510,621-UNIMOD:510,625-UNIMOD:35,628-UNIMOD:35,631-UNIMOD:510,500-UNIMOD:510	0.07	32.0	5	4	3
PRT	sp|P29320|EPHA3_HUMAN	Ephrin type-A receptor 3 OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	930-UNIMOD:510,937-UNIMOD:21,940-UNIMOD:4,945-UNIMOD:510,595-UNIMOD:510,596-UNIMOD:21,602-UNIMOD:21,614-UNIMOD:510,601-UNIMOD:21	0.04	31.0	3	2	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	14-UNIMOD:510	0.06	31.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	239-UNIMOD:510,239-UNIMOD:21,19-UNIMOD:510,360-UNIMOD:510,197-UNIMOD:510	0.14	31.0	5	4	3
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	325-UNIMOD:510,336-UNIMOD:510,330-UNIMOD:35	0.03	30.0	2	1	0
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	76-UNIMOD:21,79-UNIMOD:21,83-UNIMOD:35,73-UNIMOD:510	0.20	30.0	3	1	0
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	204-UNIMOD:510,213-UNIMOD:35,222-UNIMOD:510	0.09	29.0	2	1	0
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	44-UNIMOD:510,48-UNIMOD:21,54-UNIMOD:21	0.10	29.0	1	1	1
PRT	sp|P25788-2|PSA3_HUMAN	Isoform 2 of Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	235-UNIMOD:510,238-UNIMOD:510,248-UNIMOD:35	0.06	29.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	127-UNIMOD:510,129-UNIMOD:21,133-UNIMOD:21	0.08	29.0	1	1	1
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,466-UNIMOD:35	0.03	28.0	1	1	0
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	268-UNIMOD:510,272-UNIMOD:21,278-UNIMOD:21	0.05	28.0	1	1	0
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	200-UNIMOD:510,213-UNIMOD:21,207-UNIMOD:21	0.07	28.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	270-UNIMOD:510,270-UNIMOD:21,280-UNIMOD:21,281-UNIMOD:510,33-UNIMOD:510,44-UNIMOD:21,54-UNIMOD:510	0.08	28.0	3	3	3
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	null	571-UNIMOD:510,576-UNIMOD:4,584-UNIMOD:21,592-UNIMOD:35	0.02	28.0	1	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	125-UNIMOD:510	0.01	27.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	100-UNIMOD:510,105-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	114-UNIMOD:510	0.13	26.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	null	98-UNIMOD:510,108-UNIMOD:35,104-UNIMOD:21	0.16	26.0	2	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	null	310-UNIMOD:510,314-UNIMOD:21,321-UNIMOD:21	0.04	26.0	1	1	0
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	140-UNIMOD:510,144-UNIMOD:21,152-UNIMOD:510	0.09	25.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	323-UNIMOD:510	0.06	25.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	null	241-UNIMOD:510,242-UNIMOD:21	0.05	25.0	1	1	0
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	228-UNIMOD:510	0.08	24.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	129-UNIMOD:510,133-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	355-UNIMOD:510,363-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	424-UNIMOD:510,425-UNIMOD:21,443-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P04746|AMYP_HUMAN	Pancreatic alpha-amylase OS=Homo sapiens OX=9606 GN=AMY2A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	null	289-UNIMOD:35,291-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	444-UNIMOD:510,449-UNIMOD:21,458-UNIMOD:21,463-UNIMOD:510,448-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	74-UNIMOD:510	0.11	23.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	259-UNIMOD:510,264-UNIMOD:21,265-UNIMOD:21,271-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	82-UNIMOD:510,86-UNIMOD:21,89-UNIMOD:21	0.09	22.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	542-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	301-UNIMOD:510,312-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	154-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	null	82-UNIMOD:510,84-UNIMOD:21,103-UNIMOD:510	0.17	22.0	1	1	1
PRT	sp|P22492|H1T_HUMAN	Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	69-UNIMOD:510,79-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	96-UNIMOD:510	0.09	21.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	26-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	25-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	273-UNIMOD:510,279-UNIMOD:21,281-UNIMOD:4	0.02	20.0	2	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	167-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|Q01974|ROR2_HUMAN	Tyrosine-protein kinase transmembrane receptor ROR2 OS=Homo sapiens OX=9606 GN=ROR2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	443-UNIMOD:510,445-UNIMOD:35,447-UNIMOD:21,454-UNIMOD:35,461-UNIMOD:510,452-UNIMOD:35,449-UNIMOD:21	0.02	19.0	3	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	825-UNIMOD:510,827-UNIMOD:21,839-UNIMOD:510	0.01	19.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	null	85-UNIMOD:510	0.03	19.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	null	292-UNIMOD:510,294-UNIMOD:21,305-UNIMOD:35,306-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|O75486|SUPT3_HUMAN	Transcription initiation protein SPT3 homolog OS=Homo sapiens OX=9606 GN=SUPT3H PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	null	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	175-UNIMOD:510,180-UNIMOD:21,184-UNIMOD:510	0.06	18.0	1	1	1
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	295-UNIMOD:510,305-UNIMOD:510	0.02	18.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	220-UNIMOD:510,227-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	null	57-UNIMOD:510,73-UNIMOD:510	0.10	18.0	1	1	1
PRT	sp|O75069|TMCC2_HUMAN	Transmembrane and coiled-coil domains protein 2 OS=Homo sapiens OX=9606 GN=TMCC2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	null	164-UNIMOD:510,179-UNIMOD:21,180-UNIMOD:21,183-UNIMOD:21	0.03	18.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:510	ms_run[2]:scan=3178	48.2	2	2226.9361	2226.9361	R	-	228	248
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	2	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	44.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3038	46.727	3	3570.4718	3570.4718	R	-	207	238
PSM	DYEEVGVDSVEGEGEEEGEEY	3	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3050	46.848	2	2461.927	2461.9270	K	-	315	336
PSM	DYEEVGVDSVEGEGEEEGEEY	4	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3145	47.878	2	2461.927	2461.9270	K	-	315	336
PSM	DNLTLWTSDTQGDEAEAGEGGEN	5	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510	ms_run[2]:scan=3217	48.645	2	2442.0519	2442.0519	R	-	148	171
PSM	YAALSVDGEDENEGEDYAE	6	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510,17-UNIMOD:21	ms_run[2]:scan=2557	40.469	2	2188.8422	2188.8422	K	-	554	573
PSM	DNLTLWTSDQQDDDGGEGNN	7	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510	ms_run[2]:scan=3089	47.186	2	2226.9361	2226.9361	R	-	228	248
PSM	DSGSDEDFLMEDDDDSDYGSSK	8	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,18-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=2934	45.326	2	2575.9582	2575.9582	K	K	89	111
PSM	DSGSDEDFLMEDDDDSDYGSSK	9	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:510,21-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=2934	45.32564	2	2575.955187	2575.958184	K	K	129	151
PSM	DYEEVGVDSVEGEGEEEGEEY	10	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,2-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=3060	46.96	3	2541.8933	2541.8933	K	-	315	336
PSM	NPDDITQEEYGEFYK	11	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2484	39.537	2	2074.8486	2074.8486	R	S	292	307
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	12	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=3038	46.72740666666667	3	3570.469790	3570.471782	R	-	207	238
PSM	DSSTSPGDYVLSVSENSR	13	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2963	45.651	2	2012.8788	2012.8788	R	V	39	57
PSM	DSSTSPGDYVLSVSENSR	14	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=2963	45.65085	2	2012.8782	2012.8783	R	V	39	57
PSM	DNLTLWTSENQGDEGDAGEGEN	15	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=3067	47.018	2	2384.01	2384.0100	R	-	223	245
PSM	DSGSDEDFLMEDDDDSDYGSSK	16	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,10-UNIMOD:35,18-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=2529	40.071	3	2591.9531	2591.9531	K	K	89	111
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	17	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,32-UNIMOD:510	ms_run[2]:scan=2152	35.492	3	3790.3213	3790.3213	K	A	158	190
PSM	TAFQEALDAAGDK	18	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2178	35.788	2	1403.7569	1403.7569	K	L	9	22
PSM	DNLTLWTSDQQDDDGGEGNN	19	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510	ms_run[2]:scan=3179	48.207	3	2226.9361	2226.9361	R	-	228	248
PSM	DYEEVGADSADGEDEGEEY	20	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2284	37.062	2	2191.7691	2191.7691	K	-	431	450
PSM	NPDDITNEEYGEFYK	21	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2428	38.875	2	2060.833	2060.8330	R	S	300	315
PSM	NPDDITQEEYGEFYK	22	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2506	39.859	2	1994.8823	1994.8823	R	S	292	307
PSM	DSGSDEDFLMEDDDDSDYGSSK	23	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,10-UNIMOD:35,21-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=2529	40.07083166666666	3	2591.953491	2591.953099	K	K	129	151
PSM	EIFTGVEYSSCDTIAK	24	sp|P29320|EPHA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2559	40.484	2	1966.9271	1966.9271	K	I	930	946
PSM	IQALQQQADEAEDR	25	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=1400	26.423	2	1647.8276	1647.8276	K	A	14	28
PSM	SYELPDGQVITIGNER	26	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=3176	48.183	2	1823.9478	1823.9478	K	F	239	255
PSM	DNLTLWTSENQGDEGDAGEGEN	27	sp|P31946-2|1433B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510	ms_run[2]:scan=3072	47.059	3	2384.01	2384.0100	R	-	223	245
PSM	EVDEQMLNVQNK	28	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1842	31.525	2	1513.8083	1513.8083	K	N	325	337
PSM	KEESEESDDDMGFGLFD	29	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=3977	57.969	2	2124.6796	2124.6796	K	-	73	90
PSM	DNLTLWTSDQQDDDGGEGNN	30	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510	ms_run[1]:scan=3090	47.19363666666666	3	2226.9353	2226.9356	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	31	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=2569	40.598	3	2264.0539	2264.0539	R	E	204	223
PSM	DSGSDEDFLMEDDDDSDYGSSK	32	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,18-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=2937	45.35	3	2575.9582	2575.9582	K	K	89	111
PSM	ELAPYDENWFYTR	33	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3709	54.599	2	1896.7585	1896.7585	K	A	44	57
PSM	ESLKEEDESDDDNM	34	sp|P25788-2|PSA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:35	ms_run[2]:scan=822	19.619	2	1738.7364	1738.7364	K	-	235	249
PSM	QVYEEEYGSSLEDDVVGDTSGYYQR	35	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=3542	52.544	3	3081.2266	3081.2266	K	M	127	152
PSM	DNLTLWTSDTQGDEAEAGEGGEN	36	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=3216	48.637	3	2442.0519	2442.0519	R	-	148	171
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	37	sp|Q9UPR0-2|PLCL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=1330	25.657	3	2863.2161	2863.2161	K	M	445	470
PSM	LISWYDNEFGYSNR	38	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=3558	52.737	2	1956.7909	1956.7909	K	V	268	282
PSM	TLSNAEDYLDDEDSD	39	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2832	44.103	2	1814.6831	1814.6831	R	-	200	215
PSM	YISPDQLADLYK	40	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=3115	47.475	2	1652.7776	1652.7776	R	S	270	282
PSM	EGLELPEDEEEK	41	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=1942	32.945655	2	1483.7561	1483.7561	K	K	539	551
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	42	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[1]:scan=1330	25.65735	3	2863.2149	2863.2156	K	M	571	596
PSM	DNNQFASASLDR	43	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=1636	29.019	2	1370.6639	1370.6639	K	T	125	137
PSM	DYEEVGVDSVEGEGEEEGEEY	44	sp|P68363-2|TBA1B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=3046	46.811	3	2461.927	2461.9270	K	-	315	336
PSM	TLSNAEDYLDDEDSD	45	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2550	40.366	2	1814.6831	1814.6831	R	-	200	215
PSM	VIGSGCNLDSAR	46	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1056	22.842	2	1281.656	1281.6560	R	F	100	112
PSM	DNSTMGYMMAK	47	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,9-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=753	18.349	2	1363.6094	1363.6094	R	K	613	624
PSM	ELISNSSDALDK	48	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1570	28.209	2	1358.7566	1358.7566	R	I	47	59
PSM	EVDEQMLNVQNK	49	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:35,12-UNIMOD:510	ms_run[2]:scan=1220	24.568	2	1529.8032	1529.8032	K	N	325	337
PSM	KEESEESDDDMGFGLFD	50	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=2905	45	2	2032.8732	2032.8732	K	-	73	90
PSM	SYELPDGQVITIGNER	51	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=3005	46.258	2	1903.9141	1903.9141	K	F	239	255
PSM	YFQINQDEEEEEDED	52	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=2176	35.77	2	1964.786	1964.7860	R	-	114	129
PSM	KEESEESDDDMGFGLFD	53	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[1]:scan=2905	45.00033	2	2032.8723	2032.8727	K	-	98	115
PSM	LISWYDNEFGYSNR	54	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=3558	52.736965000000005	2	1956.790939	1956.790879	K	V	310	324
PSM	KEESEESDDDMGFGLFD	55	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3921	57.269	2	2096.8446	2096.8446	K	-	73	90
PSM	LAPDYDALDVANK	56	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2380	38.214	2	1551.7858	1551.7858	R	I	140	153
PSM	TAENATSGETLEENEAGD	57	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=1345	25.802	2	1870.8128	1870.8128	K	-	323	341
PSM	KEESEESDDDMGFGLFD	58	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=3921	57.26874166666666	2	2096.8435	2096.8441	K	-	98	115
PSM	SYELPDGQVITIGNER	59	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=3005	46.25762	2	1903.914003	1903.914091	K	F	241	257
PSM	DNLTLWTSDQQDEEAGEGN	60	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=3137	47.797	2	2154.9402	2154.9402	R	-	228	247
PSM	LGDVYVNDAFGTAHR	61	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2414	38.667	3	1747.8143	1747.8143	K	A	129	144
PSM	NNSGEEFDCAFR	62	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=1920	32.68	2	1478.6309	1478.6309	R	L	355	367
PSM	QTQTFTTYSDNQPGVLIQVYEGER	63	sp|P11142-2|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=3345	50.212	3	2967.3153	2967.3153	K	A	424	448
PSM	MSYLKNWGEGWGFVPSDR	64	sp|P04746|AMYP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=3179	48.207254999999996	3	2226.936929	2223.944892	K	A	289	307
PSM	DSGSDEDFLMEDDDDSDYGSSK	65	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:510,16-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=2937	45.349845	3	2575.958101	2575.958184	K	K	129	151
PSM	AGFAGDDAPR	66	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=924	21.154	2	1009.5041	1009.5041	K	A	19	29
PSM	DFPEYTFAIADEEDYAGEVK	67	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4062	59.016	3	2536.0648	2536.0648	K	D	444	464
PSM	EGMNIVEAMER	68	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2657	41.855	2	1311.6375	1311.6375	K	F	74	85
PSM	NPDDITQEEYGEFYK	69	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=2590	40.914	2	1914.916	1914.9160	R	S	292	307
PSM	QEYDESGPSIVHR	70	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1168	24.027	3	1549.7585	1549.7585	K	K	360	373
PSM	EGLELPEDEEEK	71	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=1951	33.048970000000004	2	1483.7561	1483.7561	K	K	539	551
PSM	DFPEYTFAIADEEDYAGEVK	72	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,5-UNIMOD:21,15-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=4062	59.015843333333336	3	2536.0643	2536.0643	K	D	444	464
PSM	DLLIAYYDVDYEK	73	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3778	55.388	2	1846.8355	1846.8356	K	N	259	272
PSM	DQGTYEDYVEGLR	74	sp|P60660-2|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2448	39.112	2	1737.6748	1737.6748	K	V	82	95
PSM	ELISNASDALDK	75	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1877	32.044	2	1342.7616	1342.7616	R	I	42	54
PSM	HGSYEDAVHSGALND	76	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1297	25.295	2	1604.7279	1604.7279	K	-	542	557
PSM	NNASTDYDLSDK	77	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1105	23.32	2	1409.6947	1409.6947	K	S	301	313
PSM	TNQELQEINR	78	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1091	23.188	2	1277.6788	1277.6788	R	V	154	164
PSM	DNYVPEVSALDQEIIEVDPDTK	79	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,22-UNIMOD:510	ms_run[1]:scan=4247	61.442725	3	2636.2790	2636.2777	R	E	82	104
PSM	AAVPSGASTGIYEALELRDNDK	80	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,12-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=2903	44.985	3	2424.221	2424.2210	R	T	33	55
PSM	ALAAAGYDVEK	81	sp|P22492|H1T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1475	27.186	2	1174.687	1174.6870	K	N	69	80
PSM	DGNGYISAAELR	82	sp|P0DP25|CALM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2124	35.212	2	1298.6679	1298.6679	K	H	96	108
PSM	DNLTLWTSDMQGDGEEQNK	83	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3018	46.473	3	2248.059	2248.0590	R	E	204	223
PSM	EDMAALEKDYEEVGADSADGEDEGEEY	84	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=2949	45.493	3	3113.238	3113.2380	R	-	423	450
PSM	EDQTEYLEER	85	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1392	26.341	2	1344.6258	1344.6258	K	R	187	197
PSM	VEIIANDQGNR	86	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=1139	23.72676166666667	2	1261.6834	1261.6834	K	T	26	37
PSM	DNSTMGYMAAK	87	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=758	18.443	2	1287.6112	1287.6112	R	K	621	632
PSM	EQFLDGDGWTSR	88	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510	ms_run[2]:scan=2517	39.97	2	1443.6843	1443.6843	K	W	25	37
PSM	TYVDPHTYEDPTQAVHEFAK	89	sp|P29320|EPHA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,8-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2580	40.782	3	2575.1346	2575.1346	R	E	595	615
PSM	GEPNVSYICSR	90	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1717	30.150106666666666	2	1394.6110	1394.6109	R	Y	273	284
PSM	DITSDTSGDFR	91	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=1723	30.197	2	1246.589	1246.5890	K	N	167	178
PSM	QLMASPSQDMEMPLINQHK	92	sp|Q01974|ROR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:35,5-UNIMOD:21,12-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=2050	34.407	3	2377.1154	2377.1154	R	Q	443	462
PSM	SIYYITGESK	93	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,10-UNIMOD:510	ms_run[2]:scan=1886	32.138	2	1227.7023	1227.7023	K	E	482	492
PSM	SLYDEVAAQGEVVRK	94	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2185	35.876	3	1810.9503	1810.9503	K	L	825	840
PSM	YYVTIIDAPGHR	95	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:510	ms_run[2]:scan=2019	34.001	3	1437.7829	1437.7829	K	D	85	97
PSM	DLYANTVLSGGTTMYPGIADR	96	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=3117	47.491685	3	2424.0534	2424.0529	K	M	292	313
PSM	GEPNVSYICSR	97	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1646	29.123534999999997	2	1394.6110	1394.6109	R	Y	273	284
PSM	QLMASPSQDMEMPLINQHK	98	sp|Q01974|ROR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:510,3-UNIMOD:35,5-UNIMOD:21,10-UNIMOD:35,12-UNIMOD:35,19-UNIMOD:510	ms_run[1]:scan=1586	28.401835	3	2393.1098	2393.1098	R	Q	443	462
PSM	MNNTAASPMSTATSSSGR	99	sp|O75486|SUPT3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=3977	57.96898666666667	2	2124.679017	2123.695688	-	S	1	19
PSM	AAVPSGASTGIYEALELR	100	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3391	50.685	2	1917.9661	1917.9661	R	D	33	51
PSM	DQVANSAFVER	101	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=1465	27.086	2	1268.6573	1268.6573	K	L	500	511
PSM	EDMAALEKDYEEVGVDSVEGEGEEEGEEY	102	sp|P68363-2|TBA1B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3378	50.558	3	3383.396	3383.3960	R	-	307	336
PSM	FLDGIYVSEK	103	sp|P32969|RL9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2720	42.61	2	1317.6894	1317.6894	K	G	175	185
PSM	GDLGIEIPAEK	104	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=2351	37.799	2	1208.7289	1208.7289	R	V	295	306
PSM	GYSFTTTAER	105	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510	ms_run[2]:scan=1436	26.817	2	1165.5828	1165.5828	R	E	197	207
PSM	HWILPQDYDHAQAEAR	106	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2062	34.524	3	2062.9475	2062.9475	R	H	220	236
PSM	NPDDITNEEYGEFYK	107	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2436	38.961	3	2060.833	2060.8330	R	S	300	315
PSM	SLDSDESEDEEDDYQQK	108	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:510,17-UNIMOD:510	ms_run[2]:scan=1273	25.084	3	2098.8975	2098.8975	K	R	57	74
PSM	TYVDPHTYEDPTQAVHEFAK	109	sp|P29320|EPHA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,2-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:510	ms_run[1]:scan=2580	40.78197	3	2575.1345	2575.1341	R	E	595	615
PSM	QLMASPSQDMEMPLINQHK	110	sp|Q01974|ROR2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:510,3-UNIMOD:35,7-UNIMOD:21,12-UNIMOD:35,19-UNIMOD:510	ms_run[1]:scan=2050	34.407376666666664	3	2377.1135	2377.1148	R	Q	443	462
PSM	GASLHSSSGGGSSGSSSRRTK	111	sp|O75069|TMCC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:510,16-UNIMOD:21,17-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=4067	59.059565	2	2224.919728	2222.893203	R	S	164	185