MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000508 phospho -- main
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\PeakList.MaxQuantPlist1\mai100625_011ITK.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220104\20220104170124317195^fe80..dc7a.184c.1632.7be4^jpost@jpost.jpost\Psearch.MaxQuantExec1\mai100625_011ITK.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20211018
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y),Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=300
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20211018
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Dimethyl:2H(4)13C(2) (K),Dimethyl:2H(4)13C(2) (N-term),Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[1]-site	K
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:510, Dimethyl:2H(4)13C(2),]
MTD	variable_mod[2]-site	N-term
MTD	variable_mod[2]-position	Any N-term
MTD	variable_mod[3]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[3]-site	M
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	S
MTD	variable_mod[4]-position	Anywhere
MTD	variable_mod[5]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[5]-site	T
MTD	variable_mod[5]-position	Anywhere
MTD	variable_mod[6]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[6]-site	Y
MTD	variable_mod[6]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	228-UNIMOD:510,29-UNIMOD:510,31-UNIMOD:21	0.15	43.0	5	2	1
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	null	36-UNIMOD:510,45-UNIMOD:21,52-UNIMOD:510	0.06	43.0	1	1	1
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	null	198-UNIMOD:510,206-UNIMOD:21,217-UNIMOD:21,222-UNIMOD:510,154-UNIMOD:510	0.10	42.0	3	3	3
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	null	236-UNIMOD:510,250-UNIMOD:21	0.07	41.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	null	239-UNIMOD:510,240-UNIMOD:21,360-UNIMOD:510,362-UNIMOD:21	0.08	40.0	5	2	0
PRT	sp|Q9NYF8-4|BCLF1_HUMAN	Isoform 4 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	null	205-UNIMOD:510,217-UNIMOD:21	0.03	39.0	1	1	0
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	39.0	null	205-UNIMOD:510,219-UNIMOD:21	0.02	39.0	1	1	0
PRT	sp|P46108-2|CRK_HUMAN	Isoform Crk-I of Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	39-UNIMOD:510,41-UNIMOD:21	0.09	38.0	1	1	0
PRT	sp|Q9UPR0-2|PLCL2_HUMAN	Isoform 2 of Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	445-UNIMOD:510,450-UNIMOD:4,458-UNIMOD:21,466-UNIMOD:35	0.03	38.0	2	1	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	120-UNIMOD:510,123-UNIMOD:21,145-UNIMOD:510,25-UNIMOD:510,26-UNIMOD:21,29-UNIMOD:35,24-UNIMOD:510	0.17	38.0	4	3	2
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	null	82-UNIMOD:510,94-UNIMOD:21,99-UNIMOD:21,103-UNIMOD:510	0.05	38.0	3	2	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	142-UNIMOD:510,142-UNIMOD:21,153-UNIMOD:4,157-UNIMOD:510,146-UNIMOD:21,22-UNIMOD:510,26-UNIMOD:21,39-UNIMOD:510,118-UNIMOD:510,134-UNIMOD:21,138-UNIMOD:510	0.23	38.0	4	3	2
PRT	sp|A2RRP1-2|NBAS_HUMAN	Isoform 2 of Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	463-UNIMOD:510,473-UNIMOD:21,482-UNIMOD:510	0.01	37.0	1	1	1
PRT	sp|Q9UNZ2-6|NSF1C_HUMAN	Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	46-UNIMOD:510,56-UNIMOD:21,61-UNIMOD:510	0.07	37.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	null	16-UNIMOD:510,17-UNIMOD:21,31-UNIMOD:510	0.09	37.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	221-UNIMOD:510,37-UNIMOD:510,41-UNIMOD:21,540-UNIMOD:510,545-UNIMOD:21,550-UNIMOD:510,26-UNIMOD:510,37-UNIMOD:21,40-UNIMOD:21,424-UNIMOD:510,432-UNIMOD:21,443-UNIMOD:21	0.12	37.0	8	6	4
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	null	241-UNIMOD:510,241-UNIMOD:21	0.05	37.0	1	1	0
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	162-UNIMOD:510,168-UNIMOD:4,176-UNIMOD:21,179-UNIMOD:510,94-UNIMOD:510,106-UNIMOD:21,113-UNIMOD:510,63-UNIMOD:510,64-UNIMOD:21	0.29	36.0	3	3	3
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	422-UNIMOD:510,431-UNIMOD:21,436-UNIMOD:510,435-UNIMOD:21,622-UNIMOD:510,612-UNIMOD:510,614-UNIMOD:21,615-UNIMOD:21,621-UNIMOD:510	0.04	36.0	4	3	2
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	null	385-UNIMOD:510,391-UNIMOD:21,402-UNIMOD:510	0.03	36.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	33-UNIMOD:510,44-UNIMOD:21,270-UNIMOD:510,280-UNIMOD:21,281-UNIMOD:510,270-UNIMOD:21,41-UNIMOD:21,54-UNIMOD:510,93-UNIMOD:510,94-UNIMOD:35,103-UNIMOD:510	0.11	35.0	6	4	3
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	428-UNIMOD:510,438-UNIMOD:21,441-UNIMOD:510	0.03	35.0	1	1	1
PRT	sp|Q9NZ63|TLS1_HUMAN	Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	141-UNIMOD:510,145-UNIMOD:4,147-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|Q08881|ITK_HUMAN	Tyrosine-protein kinase ITK/TSK OS=Homo sapiens OX=9606 GN=ITK PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	563-UNIMOD:510,572-UNIMOD:21,565-UNIMOD:21,573-UNIMOD:21,230-UNIMOD:510,240-UNIMOD:21,242-UNIMOD:510,237-UNIMOD:21,506-UNIMOD:510,512-UNIMOD:21,519-UNIMOD:510,514-UNIMOD:21,211-UNIMOD:510,220-UNIMOD:21,224-UNIMOD:21,229-UNIMOD:510,515-UNIMOD:21,269-UNIMOD:510,273-UNIMOD:21,274-UNIMOD:21,280-UNIMOD:510,194-UNIMOD:510,198-UNIMOD:21,199-UNIMOD:4,557-UNIMOD:510,563-UNIMOD:21,272-UNIMOD:21,195-UNIMOD:510,36-UNIMOD:510,40-UNIMOD:21,120-UNIMOD:510,120-UNIMOD:21,126-UNIMOD:35,129-UNIMOD:510,215-UNIMOD:510,225-UNIMOD:21,223-UNIMOD:21,524-UNIMOD:510,526-UNIMOD:21,531-UNIMOD:21,281-UNIMOD:510,284-UNIMOD:21,289-UNIMOD:4,291-UNIMOD:510,559-UNIMOD:21,203-UNIMOD:21,243-UNIMOD:21	0.24	35.0	32	14	6
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	264-UNIMOD:510,271-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|P62847-2|RS24_HUMAN	Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	null	69-UNIMOD:510,76-UNIMOD:21,81-UNIMOD:21,83-UNIMOD:510,74-UNIMOD:35	0.12	35.0	2	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	null	39-UNIMOD:510,40-UNIMOD:21	0.06	35.0	1	1	0
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	343-UNIMOD:510,356-UNIMOD:21,358-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	595-UNIMOD:510,596-UNIMOD:510,608-UNIMOD:4,612-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	43-UNIMOD:510,57-UNIMOD:510,175-UNIMOD:510,185-UNIMOD:510,181-UNIMOD:21,100-UNIMOD:510,105-UNIMOD:4	0.15	34.0	4	3	2
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	434-UNIMOD:510,445-UNIMOD:21,434-UNIMOD:35,105-UNIMOD:510,115-UNIMOD:21,95-UNIMOD:510,95-UNIMOD:21,100-UNIMOD:21,104-UNIMOD:510,62-UNIMOD:510,67-UNIMOD:21	0.11	34.0	6	4	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	null	28-UNIMOD:510,140-UNIMOD:510,149-UNIMOD:21,157-UNIMOD:510,12-UNIMOD:510,19-UNIMOD:21,25-UNIMOD:4,27-UNIMOD:510	0.20	34.0	3	3	3
PRT	sp|P46778|RL21_HUMAN	60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	143-UNIMOD:510,146-UNIMOD:510,156-UNIMOD:21,159-UNIMOD:35,22-UNIMOD:510,30-UNIMOD:21,31-UNIMOD:35,29-UNIMOD:21	0.19	34.0	4	2	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	131-UNIMOD:510,133-UNIMOD:35,134-UNIMOD:21,145-UNIMOD:510,180-UNIMOD:510,186-UNIMOD:21,182-UNIMOD:21	0.03	34.0	3	2	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	228-UNIMOD:510	0.08	33.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	1781-UNIMOD:510,1790-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|P29353-5|SHC1_HUMAN	Isoform 5 of SHC-transforming protein 1 OS=Homo sapiens OX=9606 GN=SHC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	206-UNIMOD:510,213-UNIMOD:21,221-UNIMOD:510	0.05	33.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	292-UNIMOD:510,301-UNIMOD:21,305-UNIMOD:21,306-UNIMOD:510,539-UNIMOD:510,550-UNIMOD:510,457-UNIMOD:510,459-UNIMOD:21,42-UNIMOD:510,53-UNIMOD:510,462-UNIMOD:21,613-UNIMOD:510,619-UNIMOD:21,620-UNIMOD:35,623-UNIMOD:510,621-UNIMOD:35,492-UNIMOD:510,54-UNIMOD:510,56-UNIMOD:21,64-UNIMOD:510,276-UNIMOD:510,276-UNIMOD:21,284-UNIMOD:510,482-UNIMOD:510,484-UNIMOD:21,485-UNIMOD:21,491-UNIMOD:510,274-UNIMOD:510,275-UNIMOD:510	0.16	33.0	16	10	6
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	null	472-UNIMOD:510,481-UNIMOD:21,493-UNIMOD:510	0.04	33.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	null	239-UNIMOD:510,239-UNIMOD:21	0.05	33.0	1	1	0
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	14-UNIMOD:510,32-UNIMOD:21,35-UNIMOD:510,18-UNIMOD:510	0.03	32.0	2	2	2
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	69-UNIMOD:510,70-UNIMOD:21,82-UNIMOD:510,46-UNIMOD:510,48-UNIMOD:21,54-UNIMOD:510	0.07	32.0	2	2	2
PRT	sp|Q04837|SSBP_HUMAN	Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	67-UNIMOD:510,73-UNIMOD:21,81-UNIMOD:510	0.11	32.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	108-UNIMOD:510,125-UNIMOD:21	0.06	32.0	1	1	1
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	null	296-UNIMOD:510,301-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	20-UNIMOD:510,30-UNIMOD:21,31-UNIMOD:21,333-UNIMOD:510,336-UNIMOD:21	0.04	31.0	3	2	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	528-UNIMOD:510,538-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q9Y3Y2-4|CHTOP_HUMAN	Isoform 3 of Chromatin target of PRMT1 protein OS=Homo sapiens OX=9606 GN=CHTOP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	168-UNIMOD:510,177-UNIMOD:21,180-UNIMOD:510,178-UNIMOD:35	0.07	31.0	2	1	0
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	73-UNIMOD:510,83-UNIMOD:35	0.20	31.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	107-UNIMOD:510,118-UNIMOD:21,121-UNIMOD:510,188-UNIMOD:510,196-UNIMOD:21	0.05	31.0	2	2	2
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	null	250-UNIMOD:510,256-UNIMOD:21	0.06	31.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	237-UNIMOD:510,237-UNIMOD:4,243-UNIMOD:21,249-UNIMOD:510	0.02	30.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	129-UNIMOD:510,133-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	4-UNIMOD:510,15-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|Q8NI22-2|MCFD2_HUMAN	Isoform 2 of Multiple coagulation factor deficiency protein 2 OS=Homo sapiens OX=9606 GN=MCFD2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	79-UNIMOD:510,83-UNIMOD:21,91-UNIMOD:510	0.15	30.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	275-UNIMOD:510,275-UNIMOD:21,289-UNIMOD:21,298-UNIMOD:510	0.01	30.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	null	556-UNIMOD:510,564-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	207-UNIMOD:510,207-UNIMOD:21,214-UNIMOD:21,31-UNIMOD:510,38-UNIMOD:21	0.19	30.0	3	2	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	28-UNIMOD:510,34-UNIMOD:21,35-UNIMOD:21	0.06	29.0	2	1	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	325-UNIMOD:510,336-UNIMOD:510,47-UNIMOD:510,51-UNIMOD:21,58-UNIMOD:510,50-UNIMOD:21	0.06	29.0	3	2	1
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	540-UNIMOD:510,547-UNIMOD:21,551-UNIMOD:4,556-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	198-UNIMOD:510,207-UNIMOD:21,229-UNIMOD:510,240-UNIMOD:21,241-UNIMOD:510,243-UNIMOD:510,253-UNIMOD:21,255-UNIMOD:510,210-UNIMOD:510,210-UNIMOD:21,212-UNIMOD:35,219-UNIMOD:21,220-UNIMOD:510,221-UNIMOD:510,239-UNIMOD:35	0.18	29.0	8	4	2
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	328-UNIMOD:510,330-UNIMOD:21,340-UNIMOD:510	0.03	29.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	413-UNIMOD:510,424-UNIMOD:21,427-UNIMOD:510	0.03	29.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	57-UNIMOD:510,63-UNIMOD:21,64-UNIMOD:4,70-UNIMOD:510	0.09	29.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	232-UNIMOD:510,236-UNIMOD:21,242-UNIMOD:21,245-UNIMOD:510,233-UNIMOD:21	0.06	29.0	5	2	0
PRT	sp|O15371-2|EIF3D_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	42-UNIMOD:510,50-UNIMOD:21,53-UNIMOD:510	0.03	29.0	1	1	0
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	null	193-UNIMOD:510,199-UNIMOD:21,205-UNIMOD:4,268-UNIMOD:510,272-UNIMOD:21,278-UNIMOD:21	0.10	29.0	3	2	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	129-UNIMOD:510,133-UNIMOD:21,144-UNIMOD:510,130-UNIMOD:21	0.07	29.0	4	1	0
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	64-UNIMOD:510,69-UNIMOD:21,70-UNIMOD:21,75-UNIMOD:35	0.15	28.0	4	1	0
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	82-UNIMOD:510,89-UNIMOD:21,27-UNIMOD:510,29-UNIMOD:21,32-UNIMOD:4,80-UNIMOD:510,81-UNIMOD:510,85-UNIMOD:21,86-UNIMOD:21,36-UNIMOD:35	0.19	28.0	5	3	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	121-UNIMOD:510,130-UNIMOD:21,131-UNIMOD:510,204-UNIMOD:510,213-UNIMOD:35,222-UNIMOD:510,223-UNIMOD:510	0.18	28.0	3	3	3
PRT	sp|Q9BRP8-2|PYM1_HUMAN	Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	33-UNIMOD:510,44-UNIMOD:21,47-UNIMOD:510	0.08	28.0	1	1	1
PRT	sp|P20618|PSB1_HUMAN	Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	147-UNIMOD:510,150-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|P23526-2|SAHH_HUMAN	Isoform 2 of Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	124-UNIMOD:510,137-UNIMOD:21,138-UNIMOD:510	0.04	28.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	542-UNIMOD:510,545-UNIMOD:21,544-UNIMOD:21	0.03	28.0	2	1	0
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	1928-UNIMOD:510,1942-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	432-UNIMOD:510,445-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	51-UNIMOD:510,61-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	114-UNIMOD:510,120-UNIMOD:21,127-UNIMOD:510	0.07	28.0	1	1	0
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	381-UNIMOD:510,384-UNIMOD:21,392-UNIMOD:510	0.02	28.0	1	1	1
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	323-UNIMOD:510	0.06	28.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	640-UNIMOD:510,659-UNIMOD:21,658-UNIMOD:21	0.03	28.0	2	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	82-UNIMOD:510,85-UNIMOD:21,89-UNIMOD:21,92-UNIMOD:510,54-UNIMOD:510,68-UNIMOD:21,73-UNIMOD:510,133-UNIMOD:510,139-UNIMOD:4,140-UNIMOD:21,144-UNIMOD:510,88-UNIMOD:21,91-UNIMOD:21	0.29	28.0	7	4	3
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	462-UNIMOD:510,462-UNIMOD:21,468-UNIMOD:4,92-UNIMOD:510,97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,106-UNIMOD:21,112-UNIMOD:4,116-UNIMOD:4,117-UNIMOD:510	0.08	28.0	2	2	2
PRT	sp|Q9UMX5|NENF_HUMAN	Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	55-UNIMOD:510,65-UNIMOD:21,69-UNIMOD:510	0.09	28.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	null	179-UNIMOD:510,179-UNIMOD:21,193-UNIMOD:510	0.03	28.0	1	1	1
PRT	sp|P62979|RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	144-UNIMOD:510,144-UNIMOD:4,145-UNIMOD:4,148-UNIMOD:21,149-UNIMOD:4,152-UNIMOD:510,156-UNIMOD:510,55-UNIMOD:510,63-UNIMOD:510	0.15	27.0	2	2	2
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	44-UNIMOD:510,48-UNIMOD:21,54-UNIMOD:21	0.10	27.0	3	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	870-UNIMOD:510,878-UNIMOD:21,879-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	418-UNIMOD:510,435-UNIMOD:21,441-UNIMOD:510	0.05	27.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	112-UNIMOD:510,121-UNIMOD:21,125-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	14-UNIMOD:510	0.06	27.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	140-UNIMOD:510,144-UNIMOD:21,152-UNIMOD:510	0.09	27.0	1	1	1
PRT	sp|Q9Y2Z0-2|SGT1_HUMAN	Isoform 2 of Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	280-UNIMOD:510,285-UNIMOD:21,293-UNIMOD:510	0.05	27.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	97-UNIMOD:510,99-UNIMOD:21,101-UNIMOD:4	0.06	27.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	9-UNIMOD:510,21-UNIMOD:510	0.16	27.0	1	1	1
PRT	sp|P40429|RL13A_HUMAN	60S ribosomal protein L13a OS=Homo sapiens OX=9606 GN=RPL13A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	null	192-UNIMOD:510,192-UNIMOD:21,197-UNIMOD:510,198-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|E9PAV3|NACAM_HUMAN	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	null	1977-UNIMOD:510,1982-UNIMOD:21,1990-UNIMOD:510	0.01	27.0	1	1	0
PRT	sp|Q8N9T8|KRI1_HUMAN	Protein KRI1 homolog OS=Homo sapiens OX=9606 GN=KRI1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	196-UNIMOD:510,202-UNIMOD:21,207-UNIMOD:510	0.02	26.0	1	1	1
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	223-UNIMOD:510	0.05	26.0	1	1	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	97-UNIMOD:510,101-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|P49321-2|NASP_HUMAN	Isoform 2 of Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	197-UNIMOD:510,201-UNIMOD:21,208-UNIMOD:510	0.03	26.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	1068-UNIMOD:510,1070-UNIMOD:4,1073-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	512-UNIMOD:510,527-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	29-UNIMOD:510,36-UNIMOD:21,42-UNIMOD:510	0.04	26.0	1	1	1
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	49-UNIMOD:510,49-UNIMOD:35,53-UNIMOD:21,55-UNIMOD:21	0.12	26.0	2	1	0
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	22-UNIMOD:510,25-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	591-UNIMOD:510,599-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	85-UNIMOD:510,89-UNIMOD:21,93-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|P18615-3|NELFE_HUMAN	Isoform 2 of Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	138-UNIMOD:510,140-UNIMOD:21,172-UNIMOD:510,177-UNIMOD:21	0.06	26.0	2	2	2
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	null	2-UNIMOD:510,4-UNIMOD:21,13-UNIMOD:510	0.07	26.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	20-UNIMOD:510,22-UNIMOD:21,30-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	378-UNIMOD:510,384-UNIMOD:21,391-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|P13674-3|P4HA1_HUMAN	Isoform 3 of Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	137-UNIMOD:510,141-UNIMOD:21,150-UNIMOD:510,277-UNIMOD:510,282-UNIMOD:21	0.05	25.0	2	2	2
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	111-UNIMOD:510,113-UNIMOD:21,117-UNIMOD:21,115-UNIMOD:21	0.07	25.0	3	1	0
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	70-UNIMOD:510,75-UNIMOD:21	0.11	25.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	1089-UNIMOD:510,1094-UNIMOD:21,1099-UNIMOD:510	0.01	25.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	825-UNIMOD:510,827-UNIMOD:21,839-UNIMOD:510	0.01	25.0	2	2	2
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	342-UNIMOD:510,348-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	240-UNIMOD:510,246-UNIMOD:21,250-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	null	95-UNIMOD:510,99-UNIMOD:21,105-UNIMOD:510	0.03	25.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	367-UNIMOD:510,369-UNIMOD:4,373-UNIMOD:21,383-UNIMOD:35,386-UNIMOD:510,728-UNIMOD:510,728-UNIMOD:4,730-UNIMOD:21,668-UNIMOD:510,671-UNIMOD:21,676-UNIMOD:510,732-UNIMOD:21	0.05	25.0	5	3	1
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	126-UNIMOD:510,129-UNIMOD:35,134-UNIMOD:21,136-UNIMOD:35,135-UNIMOD:21,140-UNIMOD:35	0.05	25.0	2	1	0
PRT	sp|Q9Y5S9|RBM8A_HUMAN	RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	null	50-UNIMOD:510,54-UNIMOD:21	0.11	25.0	1	1	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	237-UNIMOD:510,241-UNIMOD:21,246-UNIMOD:510,238-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|P60174-4|TPIS_HUMAN	Isoform 3 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	125-UNIMOD:510,127-UNIMOD:21,136-UNIMOD:4,137-UNIMOD:510	0.08	24.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	61-UNIMOD:510,65-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	8-UNIMOD:510,23-UNIMOD:510	0.05	24.0	1	1	1
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	54-UNIMOD:510,56-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	4-UNIMOD:510,6-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q9UKK9|NUDT5_HUMAN	ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	15-UNIMOD:510,16-UNIMOD:21,27-UNIMOD:510	0.06	24.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	205-UNIMOD:510,209-UNIMOD:21	0.10	24.0	1	1	1
PRT	sp|P21980-2|TGM2_HUMAN	Isoform 2 of Protein-glutamine gamma-glutamyltransferase 2 OS=Homo sapiens OX=9606 GN=TGM2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	365-UNIMOD:510,369-UNIMOD:21,370-UNIMOD:4,371-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q99543-2|DNJC2_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	null	268-UNIMOD:510,274-UNIMOD:21,276-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P13929-3|ENOB_HUMAN	Isoform 3 of Beta-enolase OS=Homo sapiens OX=9606 GN=ENO3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	33-UNIMOD:510,44-UNIMOD:21,54-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	158-UNIMOD:510,169-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	519-UNIMOD:510,521-UNIMOD:21,532-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	173-UNIMOD:510,176-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P43487-2|RANG_HUMAN	Isoform 2 of Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	58-UNIMOD:510,60-UNIMOD:21,68-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	635-UNIMOD:510,637-UNIMOD:21,639-UNIMOD:21,644-UNIMOD:510	0.01	23.0	1	1	1
PRT	sp|Q96GX9|MTNB_HUMAN	Methylthioribulose-1-phosphate dehydratase OS=Homo sapiens OX=9606 GN=APIP PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	52-UNIMOD:510,57-UNIMOD:21,65-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	209-UNIMOD:510,214-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	57-UNIMOD:510,59-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	143-UNIMOD:510,146-UNIMOD:21,147-UNIMOD:21,152-UNIMOD:510	0.05	23.0	1	1	1
PRT	sp|Q9UK59-2|DBR1_HUMAN	Isoform 2 of Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	297-UNIMOD:510,301-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	70-UNIMOD:510,76-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|O96019-2|ACL6A_HUMAN	Isoform 2 of Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	21-UNIMOD:510,27-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	140-UNIMOD:510,149-UNIMOD:21,157-UNIMOD:510,158-UNIMOD:510	0.08	23.0	1	1	1
PRT	sp|Q86UK7-2|ZN598_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZNF598 OS=Homo sapiens OX=9606 GN=ZNF598	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	296-UNIMOD:510,306-UNIMOD:21	0.02	23.0	2	2	2
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	110-UNIMOD:510,116-UNIMOD:21,120-UNIMOD:510	0.06	23.0	1	1	1
PRT	sp|Q00059|TFAM_HUMAN	Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	160-UNIMOD:510,165-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	226-UNIMOD:510,232-UNIMOD:21,235-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	551-UNIMOD:510,566-UNIMOD:21,569-UNIMOD:510	0.03	23.0	1	1	1
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	5-UNIMOD:510,9-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	null	291-UNIMOD:510,291-UNIMOD:21,297-UNIMOD:21,299-UNIMOD:510	0.02	23.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	247-UNIMOD:510,248-UNIMOD:21,250-UNIMOD:21,257-UNIMOD:510	0.04	23.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	null	183-UNIMOD:510,192-UNIMOD:21,194-UNIMOD:35	0.08	23.0	1	1	0
PRT	sp|Q9NRX4|PHP14_HUMAN	14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	111-UNIMOD:510,112-UNIMOD:510,116-UNIMOD:21	0.13	22.0	1	1	1
PRT	sp|P22492|H1T_HUMAN	Histone H1t OS=Homo sapiens OX=9606 GN=H1-6 PE=2 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	69-UNIMOD:510,75-UNIMOD:21,79-UNIMOD:510	0.06	22.0	1	1	1
PRT	sp|P28074-3|PSB5_HUMAN	Isoform 3 of Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	123-UNIMOD:510,133-UNIMOD:21	0.09	22.0	1	1	1
PRT	sp|O94906-2|PRP6_HUMAN	Isoform 2 of Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	97-UNIMOD:510,105-UNIMOD:21,110-UNIMOD:510	0.02	22.0	1	1	1
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	145-UNIMOD:510,152-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	49-UNIMOD:510,55-UNIMOD:21,58-UNIMOD:510,59-UNIMOD:510	0.08	22.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	74-UNIMOD:510,95-UNIMOD:510,101-UNIMOD:4	0.23	22.0	2	2	2
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	239-UNIMOD:510,244-UNIMOD:21,249-UNIMOD:510	0.05	22.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	117-UNIMOD:510,121-UNIMOD:21,125-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|P38159-2|RBMX_HUMAN	Isoform 2 of RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	113-UNIMOD:510,116-UNIMOD:35,121-UNIMOD:21,123-UNIMOD:35,127-UNIMOD:35	0.05	22.0	1	1	0
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	156-UNIMOD:510,163-UNIMOD:21,165-UNIMOD:510	0.03	22.0	1	1	1
PRT	sp|Q15631|TSN_HUMAN	Translin OS=Homo sapiens OX=9606 GN=TSN PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	204-UNIMOD:510,210-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	12-UNIMOD:510,19-UNIMOD:21,27-UNIMOD:510,117-UNIMOD:510,119-UNIMOD:21,127-UNIMOD:510,128-UNIMOD:510	0.14	22.0	2	2	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	930-UNIMOD:510,936-UNIMOD:21,941-UNIMOD:510,719-UNIMOD:510,720-UNIMOD:510,722-UNIMOD:21,729-UNIMOD:510	0.02	22.0	2	2	2
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	92-UNIMOD:510,95-UNIMOD:510,104-UNIMOD:21,105-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	294-UNIMOD:510,302-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	109-UNIMOD:510,120-UNIMOD:21,121-UNIMOD:510	0.04	22.0	1	1	0
PRT	sp|P55209-3|NP1L1_HUMAN	Isoform 3 of Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	null	65-UNIMOD:510,65-UNIMOD:21,69-UNIMOD:21,75-UNIMOD:510	0.04	22.0	1	1	1
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	null	42-UNIMOD:510,46-UNIMOD:21,53-UNIMOD:510	0.02	22.0	1	1	0
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	300-UNIMOD:510,313-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q96F63|CCD97_HUMAN	Coiled-coil domain-containing protein 97 OS=Homo sapiens OX=9606 GN=CCDC97 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	132-UNIMOD:510,135-UNIMOD:21,136-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	69-UNIMOD:510,75-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4,73-UNIMOD:21	0.20	21.0	2	1	0
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	216-UNIMOD:510,221-UNIMOD:510,228-UNIMOD:21,234-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	125-UNIMOD:510	0.01	21.0	1	1	1
PRT	sp|P33993-2|MCM7_HUMAN	Isoform 2 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	97-UNIMOD:510,102-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	25-UNIMOD:510	0.03	21.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	36-UNIMOD:510,38-UNIMOD:21,44-UNIMOD:510	0.08	21.0	1	1	1
PRT	sp|Q9Y3U8|RL36_HUMAN	60S ribosomal protein L36 OS=Homo sapiens OX=9606 GN=RPL36 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	46-UNIMOD:510,48-UNIMOD:4,53-UNIMOD:21	0.11	21.0	1	1	1
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	382-UNIMOD:510,388-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P19105|ML12A_HUMAN	Myosin regulatory light chain 12A OS=Homo sapiens OX=9606 GN=MYL12A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	151-UNIMOD:510,155-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q9NZB2-2|F120A_HUMAN	Isoform B of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	2-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	44-UNIMOD:510	0.12	21.0	1	1	1
PRT	sp|P06493-2|CDK1_HUMAN	Isoform 2 of Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	10-UNIMOD:510,15-UNIMOD:21,20-UNIMOD:510	0.05	21.0	1	1	1
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	686-UNIMOD:510,700-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	134-UNIMOD:510,142-UNIMOD:510,145-UNIMOD:21,154-UNIMOD:510	0.07	21.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	129-UNIMOD:510,130-UNIMOD:4,136-UNIMOD:21,91-UNIMOD:510,94-UNIMOD:4	0.15	21.0	2	2	2
PRT	sp|P23434|GCSH_HUMAN	Glycine cleavage system H protein, mitochondrial OS=Homo sapiens OX=9606 GN=GCSH PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	137-UNIMOD:510,138-UNIMOD:4,139-UNIMOD:21,146-UNIMOD:510	0.06	21.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	21-UNIMOD:510,29-UNIMOD:21,30-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	9-UNIMOD:510	0.10	21.0	1	1	1
PRT	sp|P07711-3|CATL1_HUMAN	Isoform 2 of Procathepsin L OS=Homo sapiens OX=9606 GN=CTSL	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	50-UNIMOD:510,57-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	null	135-UNIMOD:510,139-UNIMOD:21,148-UNIMOD:510	0.04	21.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	47-UNIMOD:510,58-UNIMOD:510	0.02	21.0	1	1	1
PRT	sp|P09234|RU1C_HUMAN	U1 small nuclear ribonucleoprotein C OS=Homo sapiens OX=9606 GN=SNRPC PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	4-UNIMOD:510,6-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:21	0.12	21.0	1	1	1
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	null	149-UNIMOD:510,149-UNIMOD:21,159-UNIMOD:510,160-UNIMOD:510	0.05	21.0	1	1	0
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	156-UNIMOD:510,166-UNIMOD:4,167-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q8NEE6|DRC6_HUMAN	Dynein regulatory complex subunit 6 OS=Homo sapiens OX=9606 GN=FBXL13 PE=2 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	722-UNIMOD:21,726-UNIMOD:21,729-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9H2G9|GO45_HUMAN	Golgin-45 OS=Homo sapiens OX=9606 GN=BLZF1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	null	321-UNIMOD:510,324-UNIMOD:21,329-UNIMOD:4,331-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	207-UNIMOD:510,214-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	448-UNIMOD:510,450-UNIMOD:510,467-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q6PCE3|PGM2L_HUMAN	Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	166-UNIMOD:510,171-UNIMOD:35,175-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P25685|DNJB1_HUMAN	DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	47-UNIMOD:510,52-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|O75223-3|GGCT_HUMAN	Isoform 3 of Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	55-UNIMOD:510,62-UNIMOD:21,65-UNIMOD:510	0.13	20.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	110-UNIMOD:510,114-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|Q9UI15|TAGL3_HUMAN	Transgelin-3 OS=Homo sapiens OX=9606 GN=TAGLN3 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	183-UNIMOD:510,190-UNIMOD:21,194-UNIMOD:35	0.08	20.0	1	1	0
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	295-UNIMOD:510,305-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	210-UNIMOD:510,216-UNIMOD:21,218-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|P62312|LSM6_HUMAN	U6 snRNA-associated Sm-like protein LSm6 OS=Homo sapiens OX=9606 GN=LSM6 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	67-UNIMOD:510,72-UNIMOD:21,77-UNIMOD:510	0.15	20.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	118-UNIMOD:510,120-UNIMOD:21,122-UNIMOD:21,126-UNIMOD:510	0.05	20.0	1	1	1
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	940-UNIMOD:510,942-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	47-UNIMOD:510,50-UNIMOD:21,58-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|P13987|CD59_HUMAN	CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	79-UNIMOD:510,87-UNIMOD:21,88-UNIMOD:4,89-UNIMOD:4,90-UNIMOD:510,91-UNIMOD:510	0.11	20.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	380-UNIMOD:510,388-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	181-UNIMOD:510,188-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q14257|RCN2_HUMAN	Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 PE=1 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	306-UNIMOD:510,311-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	46-UNIMOD:510,52-UNIMOD:21	0.12	20.0	1	1	1
PRT	sp|O43852-5|CALU_HUMAN	Isoform 5 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	103-UNIMOD:510,106-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q9BZE4-3|GTPB4_HUMAN	Isoform 3 of GTP-binding protein 4 OS=Homo sapiens OX=9606 GN=GTPBP4	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	410-UNIMOD:510,415-UNIMOD:35,418-UNIMOD:510,423-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	225-UNIMOD:510,226-UNIMOD:21,242-UNIMOD:510,227-UNIMOD:21	0.05	20.0	2	1	0
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	227-UNIMOD:510,233-UNIMOD:21,237-UNIMOD:510	0.02	20.0	1	1	1
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	120-UNIMOD:510,127-UNIMOD:21,132-UNIMOD:510	0.03	20.0	1	1	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	null	1760-UNIMOD:510,1765-UNIMOD:21,1768-UNIMOD:510	0.00	20.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	110-UNIMOD:510,115-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	null	144-UNIMOD:510,154-UNIMOD:21,156-UNIMOD:510	0.03	20.0	1	1	0
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	null	486-UNIMOD:510,490-UNIMOD:35,496-UNIMOD:510	0.02	20.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDQQDDDGGEGNN	1	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510	ms_run[2]:scan=5069	49.107	2	2226.9361	2226.9361	R	-	228	248
PSM	EAAGEGPALYEDPPDQK	2	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	43.0	1-UNIMOD:510,10-UNIMOD:21,17-UNIMOD:510	ms_run[2]:scan=2322	28.134	2	1933.8983	1933.8983	K	T	36	53
PSM	AEDGSVIDYELIDQDAR	3	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4843	47.132	2	2021.9043	2021.9043	R	D	198	215
PSM	DNLTLWTSDQQDDDGGEGNN	4	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:510	ms_run[2]:scan=4957	48.109	2	2226.9361	2226.9361	R	-	228	248
PSM	QQLSAEELDAQLDAYNAR	5	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=4320	42.809	2	2147.9949	2147.9949	K	M	236	254
PSM	SYELPDGQVITIGNER	6	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:510	ms_run[2]:scan=5047	48.916	2	1823.9478	1823.9478	K	F	239	255
PSM	SSATSGDIWPGLSAYDNSPR	7	sp|Q9NYF8-4|BCLF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=4830	47.034	2	2193.9792	2193.9792	K	S	205	225
PSM	SYELPDGQVITIGNER	8	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4505	44.358	2	1903.9141	1903.9141	K	F	239	255
PSM	SSATSGDIWPGLSAYDNSPR	9	sp|Q9NYF8|BCLF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[1]:scan=4830	47.034196666666666	2	2193.9762	2193.9787	K	S	205	225
PSM	DSSTSPGDYVLSVSENSR	10	sp|P46108-2|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4759	46.443	2	2012.8788	2012.8788	R	V	39	57
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	11	sp|Q9UPR0-2|PLCL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=2459	29.112	3	2847.2212	2847.2212	K	M	445	470
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	12	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,4-UNIMOD:21,26-UNIMOD:510	ms_run[2]:scan=4323	42.831	3	3090.3451	3090.3451	K	E	120	146
PSM	VDATEESDLAQQYGVR	13	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3028	33.173	2	1893.857	1893.8570	K	G	82	98
PSM	YADLTEDQLPSCESLK	14	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=4003	40.398	2	2015.9435	2015.9435	R	D	142	158
PSM	AGEEDEGEEDSDSDYEISAK	15	sp|A2RRP1-2|NBAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,11-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=2488	29.313	2	2321.9221	2321.9221	R	A	463	483
PSM	LGAAPEEESAYVAGEK	16	sp|Q9UNZ2-6|NSF1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,11-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=2579	29.966	2	1767.8604	1767.8604	R	R	46	62
PSM	QYTSPEEIDAQLQAEK	17	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=3953	40.004	2	1996.9667	1996.9667	R	Q	16	32
PSM	STAGDTHLGGEDFDNR	18	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:510	ms_run[2]:scan=1815	24.486	2	1724.7814	1724.7814	K	M	221	237
PSM	SYELPDGQVITIGNER	19	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=4505	44.358155	2	1903.912891	1903.914091	K	F	241	257
PSM	APVAGTCYQAEWDDYVPK	20	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,7-UNIMOD:4,15-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4574	44.869	2	2217.0126	2217.0126	R	L	162	180
PSM	NPDDITNEEYGEFYK	21	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3883	39.496	2	1980.8667	1980.8667	R	S	422	437
PSM	QSDDEVYAPGLDIESSLK	22	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,7-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=5117	49.528	2	2113.014	2113.0140	K	Q	385	403
PSM	SYELPDGQVITIGNER	23	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4797	46.749	2	1903.9141	1903.9141	K	F	239	255
PSM	AAVPSGASTGIYEALELR	24	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=5341	51.692	2	1917.9661	1917.9661	R	D	33	51
PSM	EHVEEISELFYDAK	25	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=5153	49.848	2	1855.8917	1855.8917	K	S	428	442
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	26	sp|Q9UPR0-2|PLCL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=1923	25.265	3	2863.2161	2863.2161	K	M	445	470
PSM	NAEDCLYELPENIR	27	sp|Q9NZ63|TLS1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,5-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=4636	45.405	2	1848.8177	1848.8177	K	V	141	155
PSM	SNSEVVEDISTGFR	28	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3970	40.129	2	1652.7507	1652.7507	R	L	563	577
PSM	TPEELDDSDFETEDFDVR	29	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=5171	49.994	2	2271.9157	2271.9157	R	S	264	282
PSM	TTGFGMIYDSLDYAK	30	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=6110	61.284	2	1908.8294	1908.8294	K	K	69	84
PSM	DSSTSPGDYVLSVSENSR	31	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[1]:scan=4759	46.44314666666667	2	2012.8764	2012.8783	R	V	39	57
PSM	YADLTEDQLPSCESLK	32	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:510	ms_run[1]:scan=4003	40.398455	2	2015.939508	2015.943525	R	D	142	158
PSM	YEGSGEDGGAAAQSLYIANHAY	33	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[1]:scan=4552	44.70539333333333	2	2357.001605	2357.006154	K	-	343	365
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	34	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,2-UNIMOD:510,14-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=3405	35.984	3	3112.2782	3112.2782	K	L	595	622
PSM	DLADELALVDVIEDK	35	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,15-UNIMOD:510	ms_run[2]:scan=6577	68.124	2	1724.972	1724.9720	K	L	43	58
PSM	MDATANDVPSPYEVR	36	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=3041	33.266	2	1777.7806	1777.7806	K	G	434	449
PSM	SVTEQGAELSNEER	37	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510	ms_run[2]:scan=1619	23.087	2	1581.7695	1581.7695	K	N	28	42
PSM	TNGKEPELLEPIPYEFMA	38	sp|P46778|RL21_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,4-UNIMOD:510,14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=5732	56.327	2	2241.0953	2241.0953	R	-	143	161
PSM	VEMYSGSDDDDDFNK	39	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,3-UNIMOD:35,4-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1724	23.833	2	1899.7394	1899.7394	K	L	131	146
PSM	YEGSGEDGGAAAQSLYIANHAY	40	sp|P09972|ALDOC_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=4552	44.705	2	2357.0062	2357.0062	K	-	343	365
PSM	DNLTLWTSDQQDEEAGEGN	41	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510	ms_run[2]:scan=5018	48.676	2	2154.9402	2154.9402	R	-	228	247
PSM	EISEASENIYSDVR	42	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3029	33.181	2	1724.7718	1724.7718	K	G	1781	1795
PSM	ELFDDPSYVNVQNLDK	43	sp|P29353-5|SHC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,8-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=5119	49.543	2	2042.9874	2042.9874	R	A	206	222
PSM	INSSGESGDESDEFLQSR	44	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=3353	35.609	2	2069.8639	2069.8639	R	K	180	198
PSM	MDATANDVPSPYEVR	45	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,1-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=2534	29.646	2	1793.7755	1793.7755	K	G	434	449
PSM	NPDDITNEEYGEFYK	46	sp|P07900-2|HS90A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4015	40.487	2	1980.8667	1980.8667	R	S	422	437
PSM	NPDDITQEEYGEFYK	47	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3958	40.041	2	2074.8486	2074.8486	R	S	292	307
PSM	TSRPENAIIYNNNEDFQVGQAK	48	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:510,10-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=3452	36.326	3	2655.2966	2655.2966	R	V	472	494
PSM	SYELPDGQVITIGNER	49	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[1]:scan=4797	46.74896333333333	2	1903.9123	1903.9136	K	F	239	255
PSM	EAQRDYLDFLDDEEDQGIYQSK	50	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,19-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=5496	53.342	3	2824.2753	2824.2753	R	V	14	36
PSM	GNDISSGTVLSDYVGSGPPK	51	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,13-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4055	40.778	2	2097.0304	2097.0304	K	G	94	114
PSM	GYDVIAQAQSGTGK	52	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,2-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2407	28.745	2	1541.7763	1541.7763	K	T	69	83
PSM	SGDSEVYQLGDVSQK	53	sp|Q04837|SSBP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,7-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3077	33.528	2	1758.835	1758.8350	R	T	67	82
PSM	SNSEVVEDISTGFR	54	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4939	47.975	2	1652.7507	1652.7507	R	L	563	577
PSM	TDLNPDNLQGGDDLDPNYVLSSR	55	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,18-UNIMOD:21	ms_run[2]:scan=5450	52.771	3	2631.1914	2631.1914	K	V	108	131
PSM	YYEGYYAAGPGYGGR	56	sp|Q93052|LPP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2935	32.504	2	1756.7347	1756.7347	R	N	296	311
PSM	SNSEVVEDISTGFR	57	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[1]:scan=3970	40.12941666666667	2	1652.749237	1652.750714	R	L	563	577
PSM	AGGIETIANEYSDR	58	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2979	32.821	2	1608.7245	1608.7245	R	C	20	34
PSM	DNLTLWTSDQQDDDGGEGNN	59	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510	ms_run[2]:scan=5184	50.13	2	2226.9361	2226.9361	R	-	228	248
PSM	ELSDPAGAIIYTSR	60	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=4395	43.435	2	1605.7864	1605.7864	K	F	528	542
PSM	EQLDNQLDAYMSK	61	sp|Q9Y3Y2-4|CHTOP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,10-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3638	37.678	2	1701.7957	1701.7957	K	T	168	181
PSM	KEESEESDDDMGFGLFD	62	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:35	ms_run[2]:scan=4674	45.709	2	2032.8732	2032.8732	K	-	73	90
PSM	NPDDITQEEYGEFYK	63	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4107	41.173	2	1994.8823	1994.8823	R	S	292	307
PSM	RQAVTNPNNTFYATK	64	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,12-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=1555	22.621	2	1871.9567	1871.9567	K	R	107	122
PSM	SPNNLETYEWYNK	65	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3865	39.363	2	1804.8346	1804.8346	K	S	230	243
PSM	TTGFGMIYDSLDYAK	66	sp|P62847-2|RS24_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,6-UNIMOD:35,8-UNIMOD:21,13-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=5434	52.616	2	1924.8243	1924.8243	K	K	69	84
PSM	VERADGYEPPVQESV	67	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2455	29.085	2	1787.8191	1787.8191	K	-	250	265
PSM	CEFQDAYVLLSEK	68	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,1-UNIMOD:4,7-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=5330	51.584	2	1748.8369	1748.8369	K	K	237	250
PSM	LGDVYVNDAFGTAHR	69	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3822	39.037	2	1747.8143	1747.8143	K	A	129	144
PSM	NGSEADIDEGLYSR	70	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2565	29.866	2	1638.6987	1638.6987	K	Q	4	18
PSM	NNDGYIDYAEFAK	71	sp|Q8NI22-2|MCFD2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4358	43.127	2	1666.7553	1666.7553	K	S	79	92
PSM	SLYQSAGVAPESFEYIEAHGTGTK	72	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,1-UNIMOD:21,15-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=4996	48.474	3	2769.2612	2769.2612	R	V	275	299
PSM	TAATSVPAYEPLDSLDR	73	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4172	41.66	2	1918.9138	1918.9138	R	R	556	573
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	74	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:510,1-UNIMOD:21	ms_run[2]:scan=4894	47.618	3	3570.4718	3570.4718	R	-	207	238
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	75	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[1]:scan=4894	47.617623333333334	3	3570.4626	3570.4713	R	-	207	238
PSM	ELAEDGYSGVEVR	76	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2529	29.61	2	1536.6921	1536.6921	R	V	28	41
PSM	EVDEQMLNVQNK	77	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2817	31.663	2	1513.8083	1513.8083	K	N	325	337
PSM	GIAAQPLYAGYCNHENM	78	sp|P07686|HEXB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=3250	34.803	2	2037.8538	2037.8538	R	-	540	557
PSM	HIMGQNVADYMR	79	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,10-UNIMOD:21	ms_run[2]:scan=3100	33.695	2	1547.6838	1547.6838	K	Y	198	210
PSM	LAYINPDLALEEK	80	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,3-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4860	47.312	2	1635.8797	1635.8797	R	N	328	341
PSM	SPNNLETYEWYNK	81	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3889	39.538	2	1884.8009	1884.8009	K	S	230	243
PSM	SQEQLAAELAEYTAK	82	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,12-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4629	45.351	2	1798.9026	1798.9026	K	I	413	428
PSM	SSGEIVYCGQVFEK	83	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:4,14-UNIMOD:510	ms_run[2]:scan=3789	38.796	2	1749.8321	1749.8321	K	S	57	71
PSM	SSGPYGGGGQYFAK	84	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2154	26.925	2	1602.6793	1602.6793	R	P	232	246
PSM	SSGPYGGGGQYFAK	85	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2291	27.908	2	1522.713	1522.7130	R	P	232	246
PSM	VADWTGATYQDK	86	sp|O15371-2|EIF3D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,9-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2466	29.163	2	1501.7127	1501.7127	K	R	42	54
PSM	VPTANVSVVDLTCR	87	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=4111	41.203	2	1643.8166	1643.8166	R	L	193	207
PSM	YISPDQLADLYK	88	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:510,11-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4514	44.425	2	1572.8113	1572.8113	R	S	270	282
PSM	ASGNYATVISHNPETK	89	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=1690	23.596954999999998	2	1835.9052	1835.9086	R	K	129	145
PSM	AGGIETIANEYSDR	90	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[1]:scan=2979	32.82109666666667	2	1608.722366	1608.724499	R	C	20	34
PSM	ADRDESSPYAAMLAAQDVAQR	91	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4139	41.42	3	2378.0786	2378.0786	K	C	64	85
PSM	ASGNYATVISHNPETK	92	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1690	23.597	2	1835.9091	1835.9091	R	K	129	145
PSM	DQGTYEDYVEGLR	93	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4140	41.427	2	1657.7085	1657.7085	K	V	82	95
PSM	EAAENSLVAYK	94	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2027	26.019	2	1341.6854	1341.6854	K	A	121	132
PSM	EGLELPEDEEEK	95	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=3009	33.038	2	1483.7566	1483.7566	K	K	539	551
PSM	EGYVPQEEVPVYENK	96	sp|Q9BRP8-2|PYM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=3343	35.538	2	1926.9289	1926.9289	K	Y	33	48
PSM	FVLDDQYTSSTGTK	97	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3153	34.094	2	1708.8233	1708.8233	R	F	506	520
PSM	FVLDDQYTSSTGTK	98	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3793	38.826	2	1788.7897	1788.7897	R	F	506	520
PSM	FYEQMNGPVAGASR	99	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=1776	24.205	2	1655.7227	1655.7227	R	Q	25	39
PSM	GAVYSFDPVGSYQR	100	sp|P20618|PSB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4011	40.458	2	1658.7554	1658.7554	K	D	147	161
PSM	GISEETTTGVHNLYK	101	sp|P23526-2|SAHH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2302	27.986	3	1795.903	1795.9030	R	M	124	139
PSM	GIVDQSQQAYQEAFEISK	102	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=4349	43.062	2	2188.0726	2188.0726	K	K	140	158
PSM	HGSYEDAVHSGALND	103	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=1653	23.33	2	1684.6943	1684.6943	K	-	542	557
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	104	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=3502	36.686	3	3088.3094	3088.3094	K	N	1928	1956
PSM	NGSEADIDEGLYSR	105	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,12-UNIMOD:21	ms_run[2]:scan=2563	29.851	2	1638.6987	1638.6987	K	Q	4	18
PSM	SEAPNWATQDSGFY	106	sp|P60228|EIF3E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=4793	46.707	2	1685.6823	1685.6823	R	-	432	446
PSM	SLYASSPGGVYATR	107	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2548	29.748	2	1541.7339	1541.7339	R	S	51	65
PSM	SPASDTYIVFGEAK	108	sp|Q13765|NACA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4229	42.118	2	1631.812	1631.8120	K	I	114	128
PSM	SSAYESLMEIVK	109	sp|Q14974-2|IMB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5409	52.356	2	1503.7568	1503.7568	R	N	381	393
PSM	TAENATSGETLEENEAGD	110	sp|Q9UQ80-2|PA2G4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510	ms_run[2]:scan=1952	25.478	2	1870.8128	1870.8128	K	-	323	341
PSM	VPVLASSSQSGDSESDSDSYSSR	111	sp|Q9UHI6|DDX20_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=2176	27.085	2	2460.039	2460.0390	R	T	640	663
PSM	YALYDATYETK	112	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,4-UNIMOD:21,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3578	37.237	2	1564.6776	1564.6776	R	E	82	93
PSM	YEQGTGCWQGPNR	113	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=1898	25.089	2	1665.6819	1665.6819	K	S	462	475
PSM	YGGEEEDQPIYLAVK	114	sp|Q9UMX5|NENF_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,11-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=4471	44.056	2	1857.9074	1857.9074	R	G	55	70
PSM	YHTSQSGDEMTSLSEYVSR	115	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4025	40.56	3	2289.9673	2289.9673	R	M	457	476
PSM	YTPSQQGVAFNSGAK	116	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:510,1-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2023	25.99	2	1701.84	1701.8400	R	Q	179	194
PSM	VQDRNGHEGYVPSSYLVEK	117	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=2427	28.88772833333333	3	2404.1094	2404.1133	R	S	211	230
PSM	FVLDDQYTSSTGTK	118	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=3793	38.82584666666667	2	1788.7876	1788.7891	R	F	506	520
PSM	ADRDESSPYAAMLAAQDVAQR	119	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[1]:scan=4139	41.42043666666667	3	2378.0757	2378.0781	K	C	64	85
PSM	VPVLASSSQSGDSESDSDSYSSR	120	sp|Q9UHI6|DDX20_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:510,19-UNIMOD:21	ms_run[1]:scan=2176	27.084681666666665	2	2460.0294	2460.0384	R	T	640	663
PSM	CCLTYCFNKPEDK	121	sp|P62979|RS27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,1-UNIMOD:4,2-UNIMOD:4,5-UNIMOD:21,6-UNIMOD:4,9-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=2798	31.526	2	1915.8768	1915.8768	K	-	144	157
PSM	ELAPYDENWFYTR	122	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=5369	52.019	2	1816.7922	1816.7922	K	A	44	57
PSM	ELISNASDALDK	123	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2918	32.382	2	1342.7616	1342.7616	R	I	42	54
PSM	ELPPDQAEYCIAR	124	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=3094	33.651	2	1674.7537	1674.7537	R	M	870	883
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	125	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,18-UNIMOD:21,24-UNIMOD:510	ms_run[2]:scan=2729	31.033	3	2810.1902	2810.1902	R	E	418	442
PSM	IDFYFDENPYFENK	126	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,10-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=5751	56.576	2	1987.8917	1987.8917	R	V	112	126
PSM	IQALQQQADEAEDR	127	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510	ms_run[2]:scan=2022	25.982	2	1647.8276	1647.8276	K	A	14	28
PSM	LAPDYDALDVANK	128	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=3777	38.709	2	1551.7858	1551.7858	R	I	140	153
PSM	LFQQIYSDGSDEVK	129	sp|Q9Y2Z0-2|SGT1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3326	35.409	2	1775.8655	1775.8655	R	R	280	294
PSM	LYTLVLTDPDAPSR	130	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=4810	46.873	2	1673.849	1673.8490	K	K	63	77
PSM	NSVTPDMMEEMYK	131	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4063	40.837	2	1721.7388	1721.7388	K	K	229	242
PSM	RVSVCAETYNPDEEEEDTDPR	132	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2773	31.345	3	2624.0798	2624.0798	R	V	97	118
PSM	TAFQEALDAAGDK	133	sp|P10599-2|THIO_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=3423	36.116	2	1403.7569	1403.7569	K	L	9	22
PSM	TAGTYTVSVFTK	134	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=4167	41.622	2	1501.7143	1501.7143	R	A	269	281
PSM	TTPSYVAFTDTER	135	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3224	34.607	2	1600.7234	1600.7234	R	L	37	50
PSM	YTEVLKTHGLLV	136	sp|P40429|RL13A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:510,1-UNIMOD:21,6-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4381	43.309	2	1599.8351	1599.8351	K	-	192	204
PSM	YHTSQSGDEMTSLSEYVSR	137	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=4025	40.55966	3	2289.9648	2289.9668	R	M	457	476
PSM	INSSGESGDESDEFLQSR	138	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3353	35.60902333333333	2	2069.8586	2069.8634	R	K	180	198
PSM	NVTELNEPLSNEER	139	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=3373	35.75235333333333	2	1757.8112	1756.8092	K	N	29	43
PSM	SPASDTYIVFGEAK	140	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:510	ms_run[1]:scan=4229	42.11787833333333	2	1631.8103	1631.8115	K	I	1977	1991
PSM	ELAPYDENWFYTR	141	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=5687	55.662744999999994	2	1896.7577	1896.7580	K	A	44	57
PSM	ADRDESSPYAAMLAAQDVAQR	142	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=2999	32.965	3	2394.0735	2394.0735	K	C	64	85
PSM	AEDGSVIDYELIDQDARDLYDAGVK	143	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:21,20-UNIMOD:21,25-UNIMOD:510	ms_run[2]:scan=6233	63.092	3	2997.357	2997.3570	R	R	198	223
PSM	AQEEADYIEWLK	144	sp|Q8N9T8|KRI1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5113	49.499	2	1641.7964	1641.7964	K	G	196	208
PSM	ATAGDTHLGGEDFDNR	145	sp|P48741|HSP77_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510	ms_run[2]:scan=1838	24.654	3	1708.7865	1708.7865	K	L	223	239
PSM	DNLTLWTSDMQGDGEEQNK	146	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,10-UNIMOD:35,19-UNIMOD:510	ms_run[2]:scan=4096	41.078	3	2264.0539	2264.0539	R	E	204	223
PSM	EALTYDGALLGDR	147	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4062	40.83	2	1506.718	1506.7180	K	S	97	110
PSM	EAQLYAAQAHLK	148	sp|P49321-2|NASP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2231	27.476	3	1489.7967	1489.7967	K	L	197	209
PSM	EILVGDVGQTVDDPYATFVK	149	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,15-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=5462	52.912	2	2313.1818	2313.1818	K	M	54	74
PSM	FLCADYAEQDELDYHR	150	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=3828	39.081	3	2157.8927	2157.8927	K	G	1068	1084
PSM	FQSSHHPTDITSLDQYVER	151	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,16-UNIMOD:21	ms_run[2]:scan=3533	36.909	3	2373.0851	2373.0851	R	M	512	531
PSM	GILAADESTGSIAK	152	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3138	33.984	2	1479.7858	1479.7858	K	R	29	43
PSM	ILYSQCGDVMR	153	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=2522	29.559	2	1454.6511	1454.6511	K	A	27	38
PSM	LISWYDNEFGYSNR	154	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=5299	51.284	2	1876.8245	1876.8245	K	V	268	282
PSM	MREDYDSVEQDGDEPGPQR	155	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,1-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=1495	22.189	3	2351.9426	2351.9426	R	S	49	68
PSM	NGQYAEASALYGR	156	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=2558	29.816	2	1512.6822	1512.6822	R	A	22	35
PSM	NNSGEEFDCAFR	157	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,9-UNIMOD:4	ms_run[2]:scan=2941	32.547	2	1478.6309	1478.6309	R	L	591	603
PSM	NSLESYAFNMK	158	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4205	41.902	2	1450.684	1450.6840	K	A	540	551
PSM	RFYEQMNGPVAGASR	159	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=1552	22.599	2	1811.8238	1811.8238	R	Q	24	39
PSM	RNEEYCLLDSSEIHWWR	160	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=5298	51.277	3	2406.0676	2406.0676	R	V	194	211
PSM	SGQVYSFGCNDEGALGR	161	sp|P18754|RCC1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3268	34.935	2	1929.8141	1929.8141	K	D	85	102
PSM	SLYESFVSSSDR	162	sp|P18615-3|NELFE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3834	39.138	2	1489.655	1489.6550	K	L	138	150
PSM	SSGPYGGGGQYFAKPR	163	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1995	25.791	3	1775.8669	1775.8669	R	N	232	248
PSM	VRYSLDPENPTK	164	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1905	25.139	2	1565.8127	1565.8127	M	S	2	14
PSM	SPNNLETYEWYNK	165	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4076	40.93177166666667	2	1884.7969	1884.8004	K	S	230	243
PSM	SPNNLETYEWYNK	166	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4084	40.98976	2	1884.7969	1884.8004	K	S	230	243
PSM	HGSYEDAVHSGALND	167	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[1]:scan=1653	23.329819999999998	2	1684.6921	1684.6937	K	-	542	557
PSM	DNLTLWTSDQQDDDGGEGNN	168	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=5517	53.563	2	2226.9361	2226.9361	R	-	228	248
PSM	DYLDFLDDEEDQGIYQSK	169	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,15-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=6225	62.953	3	2340.0359	2340.0359	R	V	18	36
PSM	ELAPYDENWFYTR	170	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=5537	53.751	2	1816.7922	1816.7922	K	A	44	57
PSM	EVYELLDSPGK	171	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3510	36.743	2	1396.7163	1396.7163	K	V	20	31
PSM	FYEQMNGPVAGASR	172	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,2-UNIMOD:21	ms_run[2]:scan=2668	30.605	2	1639.7278	1639.7278	R	Q	25	39
PSM	HELQANCYEEVK	173	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:4,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1374	21.303	2	1666.7699	1666.7699	K	D	133	145
PSM	IFRDGEEAGAYDGPR	174	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1590	22.876	2	1765.7885	1765.7885	K	T	105	120
PSM	INVYYNEATGGK	175	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2540	29.691	2	1475.7334	1475.7334	R	Y	47	59
PSM	LGDVYVNDAFGTAHR	176	sp|P00558-2|PGK1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3818	39.01	3	1747.8143	1747.8143	K	A	129	144
PSM	LISWYDNEFGYSNR	177	sp|P04406-2|G3P_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=5523	53.607	2	1956.7909	1956.7909	K	V	268	282
PSM	LPSSPVYEDAASFK	178	sp|Q14247-3|SRC8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3877	39.451	2	1657.8277	1657.8277	R	A	378	392
PSM	LQDTYNLDTDTISK	179	sp|P13674-3|P4HA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=3122	33.853	2	1773.871	1773.8710	R	G	137	151
PSM	QVVESAYEVIK	180	sp|P00338-4|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3157	34.121	2	1331.7973	1331.7973	K	L	175	186
PSM	QWYESHYALPLGR	181	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4489	44.24	2	1812.785	1812.7850	R	K	111	124
PSM	RLEAAYLDLQR	182	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3372	35.745	2	1460.7601	1460.7601	R	I	70	81
PSM	SEGSEYEEIPK	183	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1941	25.399	2	1414.6541	1414.6541	R	R	1089	1100
PSM	SLYDEVAAQGEVVR	184	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3996	40.348	2	1648.7922	1648.7922	K	K	825	839
PSM	SWASPVYTEADGTFSR	185	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4434	43.719	2	1886.83	1886.8300	R	L	342	358
PSM	TGLYNYYDDEK	186	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3012	33.06	2	1527.6807	1527.6807	R	E	240	251
PSM	TTPSYVAFTDTER	187	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510	ms_run[2]:scan=3413	36.043	2	1520.7571	1520.7571	R	L	37	50
PSM	YAALYQPLFDK	188	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4814	46.903	2	1475.7738	1475.7738	K	R	95	106
PSM	YISPDQLADLYK	189	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5008	48.602	2	1652.7776	1652.7776	R	S	270	282
PSM	YRCELLYEGPPDDEAAMGIK	190	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:4,7-UNIMOD:21,17-UNIMOD:35,20-UNIMOD:510	ms_run[2]:scan=4254	42.313	3	2490.1484	2490.1484	K	S	367	387
PSM	YRCELLYEGPPDDEAAMGIK	191	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:510,3-UNIMOD:4,7-UNIMOD:21,20-UNIMOD:510	ms_run[2]:scan=4808	46.858	3	2474.1535	2474.1535	K	S	367	387
PSM	GGHMDDGGYSMNFNMSSSR	192	sp|P38159|RBMX_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:510,4-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1715	23.77132166666667	3	2195.7972	2194.7962	R	G	126	145
PSM	MREDYDSVEQDGDEPGPQR	193	sp|Q9Y5S9|RBM8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[1]:scan=1797	24.358748333333335	3	2335.944468	2335.947652	R	S	50	69
PSM	AHAAIRENPVYEK	194	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=1184	19.909	2	1644.8661	1644.8661	K	K	243	256
PSM	EQLDNQLDAYMSK	195	sp|Q9Y3Y2-4|CHTOP_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:35,13-UNIMOD:510	ms_run[2]:scan=2396	28.663	2	1717.7907	1717.7907	K	T	168	181
PSM	GLGTGTLYIAESR	196	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3941	39.916	2	1450.7281	1450.7281	K	L	31	44
PSM	GYFEYIEENK	197	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4034	40.626	2	1438.6694	1438.6694	R	Y	237	247
PSM	HGVVPLATYMR	198	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=2006	25.868	2	1372.6787	1372.6787	K	I	22	33
PSM	IIYGGSVTGATCK	199	sp|P60174-4|TPIS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,12-UNIMOD:4,13-UNIMOD:510	ms_run[2]:scan=1980	25.682	2	1473.7575	1473.7575	R	E	125	138
PSM	IPYENRSNSEVVEDISTGFR	200	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4659	45.601	3	2425.1375	2425.1375	K	L	557	577
PSM	ITPSYVAFTPEGER	201	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3855	39.292	2	1679.802	1679.8020	R	L	61	75
PSM	LIAPVAEEEATVPNNK	202	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,16-UNIMOD:510	ms_run[2]:scan=3086	33.594	2	1762.0149	1762.0149	K	I	8	24
PSM	NFYVEHPEVAR	203	sp|Q92841-1|DDX17_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2679	30.681	2	1473.6866	1473.6866	K	L	54	65
PSM	NQYDNDVTVWSPQGR	204	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=3702	38.153	2	1891.8314	1891.8314	R	I	4	19
PSM	QYIISEELISEGK	205	sp|Q9UKK9|NUDT5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,2-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4914	47.764	2	1655.8696	1655.8696	K	W	15	28
PSM	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	206	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2248	27.597	3	3336.5519	3336.5519	R	Q	205	235
PSM	SEGTYCCGPVPVR	207	sp|P21980-2|TGM2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=2053	26.206	2	1594.6733	1594.6733	K	A	365	378
PSM	SNSEVVEDISTGFR	208	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=4752	46.391	2	1732.717	1732.7170	R	L	563	577
PSM	STAGDTHLGGEDFDNR	209	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510	ms_run[2]:scan=1801	24.389	3	1724.7814	1724.7814	K	M	221	237
PSM	TLVDNAYSCDPR	210	sp|Q99543-2|DNJC2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=1873	24.907	2	1523.654	1523.6540	R	I	268	280
PSM	TAGTYTVSVFTK	211	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,4-UNIMOD:21,6-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=4167	41.62224166666667	2	1501.7130	1501.7138	R	A	269	281
PSM	FSGWYDADLSPAGHEEAK	212	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,5-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=4166	41.614715000000004	3	2126.9604	2126.9618	R	R	22	40
PSM	HGVVPLATYMR	213	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=2006	25.867813333333334	2	1372.6764	1372.6782	K	I	22	33
PSM	ADRDESSPYAAMLAAQDVAQR	214	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=2999	32.96465833333333	3	2394.0693	2394.0730	K	C	64	85
PSM	AAVPSGASTGIYEALELRDGDK	215	sp|P13929-3|ENOB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4755	46.413	3	2367.1996	2367.1996	R	G	33	55
PSM	CLYASVLTAQPR	216	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=3738	38.429	2	1491.7369	1491.7369	R	L	728	740
PSM	DNSTMGYMMAK	217	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=1760	24.088	2	1411.5859	1411.5859	R	K	613	624
PSM	DNSTMGYMMAK	218	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=1973	25.632	2	1411.5859	1411.5859	R	K	613	624
PSM	DVIELTDDSFDK	219	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=4753	46.399	2	1463.7668	1463.7668	K	N	158	170
PSM	DVTPPPETEVVLIK	220	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4992	48.444	2	1683.9372	1683.9372	K	N	519	533
PSM	DYTYEELLNR	221	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4342	43.01	2	1428.6386	1428.6386	R	V	173	183
PSM	EALQDVEDENQ	222	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=2297	27.952	2	1322.605	1322.6050	K	-	223	234
PSM	EDIYAVEIVGGATR	223	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=4756	46.421	2	1605.7864	1605.7864	K	I	333	347
PSM	ELAEDGYSGVEVR	224	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2985	32.864	2	1616.6585	1616.6585	R	V	28	41
PSM	EQVANSAFVER	225	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510	ms_run[2]:scan=1855	24.777	2	1282.673	1282.6730	K	V	492	503
PSM	FASENDLPEWK	226	sp|P43487-2|RANG_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=4610	45.176	2	1482.7068	1482.7068	R	E	58	69
PSM	GFYIYQEGVK	227	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4298	42.634	2	1430.6561	1430.6561	K	R	635	645
PSM	HELQANCYEEVKDR	228	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:4,8-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=1313	20.856	3	1937.8979	1937.8979	K	C	133	147
PSM	HGDEIYIAPSGVQK	229	sp|Q96GX9|MTNB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2510	29.474	2	1660.8498	1660.8498	K	E	52	66
PSM	IRYESLTDPSK	230	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1932	25.333	2	1455.7647	1455.7647	K	L	54	65
PSM	MREDYDSVEQDGDEPGPQR	231	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=1797	24.359	3	2335.9477	2335.9477	R	S	49	68
PSM	NEEYCLLDSSEIHWWR	232	sp|Q08881|ITK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=5710	56.017	3	2249.9665	2249.9665	R	V	195	211
PSM	NEQDAYAINSYTR	233	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2555	29.797	2	1657.7197	1657.7197	R	S	209	222
PSM	NFYQEHPDLAR	234	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=2130	26.752	2	1502.6768	1502.6768	K	R	57	68
PSM	NKDQGTYEDYVEGLR	235	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,2-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3130	33.912	2	1933.9095	1933.9095	K	V	80	95
PSM	NLQYYDISAK	236	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2978	32.814	2	1441.6568	1441.6568	K	S	143	153
PSM	NQAIYAAVDDDDDDAA	237	sp|Q9UK59-2|DBR1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3561	37.115	2	1794.7046	1794.7046	R	-	297	313
PSM	NVDGVNYASITR	238	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2676	30.661	2	1421.6764	1421.6764	R	N	70	82
PSM	QGGPTYYIDTNALR	239	sp|O96019-2|ACL6A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4155	41.536	2	1681.7925	1681.7925	K	V	21	35
PSM	QTIDNSQGAYQEAFDISKK	240	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,10-UNIMOD:21,18-UNIMOD:510,19-UNIMOD:510	ms_run[2]:scan=3212	34.517	3	2324.1786	2324.1786	K	E	140	159
PSM	QVVESAYEVIK	241	sp|P00338-4|LDHA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3232	34.665	2	1411.7636	1411.7636	K	L	175	186
PSM	QWYESHYALPLGR	242	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4191	41.799	2	1732.8187	1732.8187	R	K	111	124
PSM	RNEGVVGGEDYEEVDR	243	sp|Q86UK7-2|ZN598_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1731	23.882	3	1935.8424	1935.8424	R	Y	296	312
PSM	RTIAQDYGVLK	244	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2199	27.251	2	1410.7908	1410.7909	K	A	110	121
PSM	SAYNVYVAER	245	sp|Q00059|TFAM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=2315	28.083	2	1284.5964	1284.5964	R	F	160	170
PSM	STLNEIYFGK	246	sp|P47756-2|CAPZB_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4046	40.714	2	1318.6847	1318.6847	R	T	226	236
PSM	THSVNGITEEADPTIYSGK	247	sp|O75534-2|CSDE1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,16-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2569	29.893	3	2166.0518	2166.0518	K	V	551	570
PSM	VIGSGCNLDSAR	248	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:4	ms_run[2]:scan=1501	22.235	2	1281.656	1281.6560	R	F	100	112
PSM	VNDGVCDCCDGTDEYNSGVICENTCK	249	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,6-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:21,21-UNIMOD:4,25-UNIMOD:4,26-UNIMOD:510	ms_run[2]:scan=2910	32.324	3	3188.2175	3188.2175	R	E	92	118
PSM	VSRDTLYEAVR	250	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=2390	28.623	2	1421.7128	1421.7128	K	E	5	16
PSM	YIDQEELNK	251	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=1868	24.872	2	1298.6432	1298.6432	K	T	276	285
PSM	YQGVNLYVK	252	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3164	34.171	2	1310.6349	1310.6349	R	N	291	300
PSM	VEIIANDQGNRTTPSYVAFTDTER	253	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=4356	43.11260166666666	3	2890.2964	2890.2994	K	L	26	50
PSM	YLMEEDEDAYKK	254	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,1-UNIMOD:21,3-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=1334	21.012018333333334	3	1810.7855	1810.7869	R	Q	210	222
PSM	SLYDEVAAQGEVVRK	255	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=3426	36.137723333333334	3	1810.9483	1810.9497	K	L	825	840
PSM	TYSYLTPDLWK	256	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,2-UNIMOD:21,4-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=5747	56.545545	2	1613.7453	1613.7451	K	E	247	258
PSM	GASQAGMTGYGMPR	257	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:510,10-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1211	20.11061	2	1512.6294	1512.6309	R	Q	183	197
PSM	QWYESHYALPLGR	258	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=4489	44.24019333333334	2	1812.784169	1812.785005	R	K	111	124
PSM	AKYPDYEVTWANDGY	259	sp|Q9NRX4|PHP14_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4515	44.433	2	1938.8713	1938.8713	K	-	111	126
PSM	ALAAAGYDVEK	260	sp|P22492|H1T_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1961	25.544	2	1254.6534	1254.6534	K	N	69	80
PSM	ASGNYATVISHNPETK	261	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=1673	23.473	3	1835.9091	1835.9091	R	K	129	145
PSM	ASLAYFEDR	262	sp|Q08881|ITK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=3571	37.187	2	1184.5327	1184.5327	K	H	36	45
PSM	DAYSGGAVNLYHVR	263	sp|P28074-3|PSB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2931	32.474	3	1634.7666	1634.7666	R	E	123	137
PSM	DDEEADAIYAALDK	264	sp|O94906-2|PRP6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=5443	52.708	2	1685.771	1685.7710	K	R	97	111
PSM	DGVGMVEYLR	265	sp|Q13242|SRSF9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4359	43.135	2	1251.5783	1251.5783	K	K	145	155
PSM	DNSTMGYMMAK	266	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2054	26.213	2	1331.6196	1331.6196	R	K	613	624
PSM	EAIEGTYIDKK	267	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,10-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=1735	23.911	2	1447.806	1447.8060	K	C	49	60
PSM	EGMNIVEAMER	268	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=4259	42.35	2	1311.6375	1311.6375	K	F	74	85
PSM	EVEIAYSDVAK	269	sp|Q9Y696|CLIC4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2807	31.592	2	1370.7007	1370.7007	K	R	239	250
PSM	EVGVYEALK	270	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2820	31.684	2	1154.6261	1154.6261	K	D	117	126
PSM	GGHMDDGGYSMNFNMSSSR	271	sp|P38159-2|RBMX_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=1102	19.273	3	2210.7917	2210.7917	R	G	113	132
PSM	GIYAYGFEK	272	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=3737	38.422	2	1194.5999	1194.5999	R	P	46	55
PSM	GRNDLMEYAK	273	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1908	25.16	2	1343.6581	1343.6581	K	Q	156	166
PSM	GYFEYIEENK	274	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,5-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3921	39.771	2	1518.6357	1518.6357	R	Y	237	247
PSM	IFRDGEEAGAYDGPR	275	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=1572	22.744	3	1765.7885	1765.7885	K	T	105	120
PSM	INVYYNEATGGK	276	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2560	29.83	2	1555.6997	1555.6997	R	Y	47	59
PSM	KEESEESDDDMGFGLFD	277	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=5448	52.756	2	2016.8783	2016.8783	K	-	73	90
PSM	KVEEVVYDLSIR	278	sp|Q15631|TSN_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=4251	42.292	2	1596.8801	1596.8801	K	G	204	216
PSM	LAEQAERYEDMAAFMK	279	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,8-UNIMOD:21,16-UNIMOD:510	ms_run[2]:scan=4204	41.896	3	2049.9577	2049.9577	K	G	12	28
PSM	QEYDESGPSIVHR	280	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510	ms_run[2]:scan=1701	23.676	3	1549.7585	1549.7585	K	K	360	373
PSM	SIAEEQYSDLEK	281	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2443	28.998	2	1558.744	1558.7440	R	E	930	942
PSM	SIYYITGESK	282	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3179	34.279	2	1387.635	1387.6350	K	E	482	492
PSM	SIYYITGESK	283	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=3183	34.309	2	1307.6687	1307.6687	K	E	482	492
PSM	SPSKPLPEVTDEYK	284	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,4-UNIMOD:510,13-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=2070	26.33	3	1770.9541	1770.9541	R	N	92	106
PSM	SSGPYGGGGQYFAKPR	285	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1848	24.726	3	1855.8332	1855.8332	R	N	232	248
PSM	TLTPISAAYAR	286	sp|P31939-2|PUR9_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=2948	32.598	2	1276.6641	1276.6641	K	A	294	305
PSM	TPSSDVLVFDYTK	287	sp|Q09028-4|RBBP4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,12-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4398	43.458	2	1618.8168	1618.8168	K	H	109	122
PSM	VDATEESDLAQQYGVR	288	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=3027	33.167	3	1893.857	1893.8570	K	G	82	98
PSM	VDATEESDLAQQYGVRGYPTIK	289	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,13-UNIMOD:21,18-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=3780	38.73	3	2667.2507	2667.2507	K	F	82	104
PSM	VQDRNGHEGYVPSSYLVEK	290	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2590	30.042	3	2324.1475	2324.1475	R	S	211	230
PSM	YALYDATYETK	291	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3200	34.431	2	1404.7449	1404.7449	R	E	82	93
PSM	YAVLYQPLFDK	292	sp|P55209-3|NP1L1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,5-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=5282	51.134	2	1583.7714	1583.7714	K	E	65	76
PSM	YGVSGYPTLK	293	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2620	30.26	2	1311.619	1311.6190	K	I	95	105
PSM	YHPNFWMDGK	294	sp|Q08881|ITK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,7-UNIMOD:35,10-UNIMOD:510	ms_run[2]:scan=2471	29.195	2	1457.6476	1457.6476	K	W	120	130
PSM	YLMEEDEDAYKK	295	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:510,10-UNIMOD:21,11-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1979	25.675	3	1714.8262	1714.8262	R	Q	210	222
PSM	VQDRNGHEGYVPSSYLVEK	296	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,14-UNIMOD:21,19-UNIMOD:510	ms_run[1]:scan=2590	30.041653333333333	3	2324.1418	2324.1469	R	S	211	230
PSM	SNSEVVEDISTGFR	297	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=4752	46.39118	2	1732.7158	1732.7165	R	L	563	577
PSM	YALYDATYETK	298	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=3339	35.50911666666667	2	1484.7101	1484.7107	R	E	82	93
PSM	ASGNYATVISHNPETK	299	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:510,2-UNIMOD:21,16-UNIMOD:510	ms_run[1]:scan=1673	23.473385	3	1835.9063	1835.9086	R	K	129	145
PSM	VADWTGATYQDK	300	sp|O15371|EIF3D_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,5-UNIMOD:21,12-UNIMOD:510	ms_run[1]:scan=2466	29.162658333333333	2	1501.711882	1501.712660	K	R	42	54
PSM	SNSEVVEDISTGFR	301	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=4752	46.39118	2	1732.716391	1732.717045	R	L	563	577
PSM	AADEEAFEDNSEEYIRR	302	sp|P55060-4|XPO2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2717	30.948	3	2156.9112	2156.9112	R	D	300	317
PSM	AAVPSGASTGIYEALELRDNDK	303	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,22-UNIMOD:510	ms_run[2]:scan=4714	46.018	2	2424.221	2424.2210	R	T	33	55
PSM	ADFYCAEVAR	304	sp|Q96F63|CCD97_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=2629	30.326	2	1314.5528	1314.5528	R	Q	132	142
PSM	AFGESSTESDEEEEEGCGHTHCVR	305	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=1642	23.251	4	2852.0751	2852.0751	R	G	69	93
PSM	ASESSKPWPDATYGTGSASR	306	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:510,13-UNIMOD:21	ms_run[2]:scan=2097	26.519	3	2202.0267	2202.0267	K	A	216	236
PSM	DNNQFASASLDR	307	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2440	28.977	2	1370.6639	1370.6639	K	T	125	137
PSM	DQGTYEDYVEGLR	308	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=3901	39.624	2	1737.6748	1737.6748	K	V	82	95
PSM	DQVANSAFVER	309	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=2173	27.064	2	1268.6573	1268.6573	K	L	622	633
PSM	DVLDVYIEHR	310	sp|P33993-2|MCM7_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3778	38.716	3	1371.6648	1371.6648	K	L	97	107
PSM	EKYIDQEELNK	311	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=1691	23.603	2	1589.8439	1589.8439	K	T	274	285
PSM	EQFLDGDGWTSR	312	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=3975	40.193	2	1443.6843	1443.6843	K	W	25	37
PSM	ESYSVYVYK	313	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2727	31.019	2	1284.6316	1284.6316	K	V	36	45
PSM	EVCGFAPYERR	314	sp|Q9Y3U8|RL36_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=2020	25.968	2	1496.6696	1496.6696	R	A	46	57
PSM	FSPDSQYIDNR	315	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2625	30.296	2	1454.6291	1454.6291	R	S	382	393
PSM	GNFNYIEFTR	316	sp|P19105|ML12A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4328	42.867	2	1373.6229	1373.6229	K	I	151	161
PSM	GVQGFQDYIEK	317	sp|Q9NZB2-2|F120A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3664	37.867	2	1430.7119	1430.7119	M	H	2	13
PSM	GVQYLNEIK	318	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2862	31.982	2	1210.6635	1210.6635	K	D	668	677
PSM	HGVVPLATYMR	319	sp|P46778|RL21_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=3057	33.383	2	1356.6838	1356.6838	K	I	22	33
PSM	HGYIGEFEIIDDHR	320	sp|P62244|RS15A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=4052	40.756	3	1733.8586	1733.8586	K	A	44	58
PSM	HIYYITGETK	321	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,4-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=2139	26.816	2	1451.6775	1451.6775	K	D	612	622
PSM	IGEGTYGVVYK	322	sp|P06493-2|CDK1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2686	30.73	2	1332.7003	1332.7003	K	G	10	21
PSM	KITIADCGQLE	323	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,7-UNIMOD:4	ms_run[2]:scan=2833	31.775	2	1314.749	1314.7490	K	-	95	106
PSM	KLDVEEPDSANSSFYSTR	324	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,15-UNIMOD:21	ms_run[2]:scan=2949	32.605	3	2192.0311	2192.0311	K	S	686	704
PSM	LAEQAERYDDMAACMK	325	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21,14-UNIMOD:4,16-UNIMOD:510	ms_run[2]:scan=2656	30.521	3	2048.9043	2048.9043	K	S	12	28
PSM	NAVITVPAYFNDSQR	326	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=4426	43.663	2	1807.8718	1807.8718	K	Q	188	203
PSM	NGHEGYVPSSYLVEK	327	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,15-UNIMOD:510	ms_run[2]:scan=2891	32.186	2	1825.8924	1825.8924	R	S	215	230
PSM	NGSLDSPGKQDTEEDEEEDEK	328	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:510,12-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=1325	20.948	3	2532.1125	2532.1125	K	D	134	155
PSM	SCAHDWVYE	329	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=2661	30.555	2	1279.4793	1279.4793	K	-	129	138
PSM	SCYEDGWLIK	330	sp|P23434|GCSH_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:4,3-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=4487	44.226	2	1417.6625	1417.6625	K	M	137	147
PSM	SSGPYGGGGQYFAKPR	331	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,2-UNIMOD:21,11-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=1870	24.886	2	1855.8332	1855.8332	R	N	232	248
PSM	STTTGHLIYK	332	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:510	ms_run[2]:scan=1302	20.774	2	1267.685	1267.6850	K	C	21	31
PSM	SYDVPPPPMEPDHPFYSNISK	333	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,17-UNIMOD:21,21-UNIMOD:510	ms_run[2]:scan=4386	43.343	3	2564.1971	2564.1971	R	D	118	139
PSM	TLSDYNIQK	334	sp|P62979|RS27A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,9-UNIMOD:510	ms_run[2]:scan=2057	26.236	2	1148.6714	1148.6714	R	E	55	64
PSM	TNQELQEINR	335	sp|P07355-2|ANXA2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1539	22.509	2	1277.6788	1277.6788	R	V	154	164
PSM	TPVEPEVAIHR	336	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510	ms_run[2]:scan=1892	25.045	3	1280.7301	1280.7301	K	I	9	20
PSM	VFQEPLFYEAPR	337	sp|P07711-3|CATL1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=4887	47.54	2	1608.7802	1608.7802	K	S	50	62
PSM	VPDSTYEMIGGLDK	338	sp|P62195-2|PRS8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,14-UNIMOD:510	ms_run[2]:scan=4346	43.04	2	1671.8103	1671.8103	K	Q	135	149
PSM	VQDRNGHEGYVPSSYLVEK	339	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:510,10-UNIMOD:21,15-UNIMOD:21,19-UNIMOD:510	ms_run[2]:scan=2427	28.888	3	2404.1138	2404.1138	R	S	211	230
PSM	NGHEGYVPSSYLVEK	340	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=2836	31.797653333333333	2	1905.8539	1905.8582	R	S	215	230
PSM	WASPEVFSFSR	341	sp|Q08881|ITK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=5784	57.06520333333333	2	1505.6200	1505.6200	K	Y	524	535
PSM	ELISNSSDALDK	342	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=2343	28.286111666666663	2	1358.7555	1358.7560	R	I	47	59
PSM	VEIIANDQGNR	343	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510	ms_run[1]:scan=1663	23.398936666666668	2	1261.6821	1261.6834	K	T	26	37
PSM	FYCDYCDTYLTHDSPSVR	344	sp|P09234|RU1C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,3-UNIMOD:4,6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=3596	37.36866166666666	3	2411.9624	2411.9647	K	K	4	22
PSM	SAYQEAMDISKK	345	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,1-UNIMOD:21,11-UNIMOD:510,12-UNIMOD:510	ms_run[1]:scan=2462	29.133368333333333	2	1551.809490	1551.810448	R	E	149	161
PSM	TDIQIALPSGCYGR	346	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=4459	43.9432	2	1663.7843	1663.7848	K	V	156	170
PSM	GALELTVKKSTYSSEDQAA	347	sp|Q8NEE6|DRC6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	6-UNIMOD:21,10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=4314	42.76522166666667	2	2236.8950	2236.8938	K	-	717	736
PSM	KIPSTVEFCSTPAEK	348	sp|Q9H2G9|GO45_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=5586	54.34073000000001	2	1887.8282	1886.8342	K	M	321	336
PSM	AFGESSTESDEEEEEGCGHTHCVR	349	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:510,5-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1642	23.25084	4	2852.0701	2852.0746	R	G	69	93
PSM	CLYASVLTAQPR	350	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,1-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=3738	38.42888	2	1491.735731	1491.736919	R	L	728	740
PSM	YALYDATYETK	351	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,4-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=3578	37.236671666666666	2	1564.676632	1564.677594	R	E	82	93
PSM	ASESSKPWPDATYGTGSASR	352	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,6-UNIMOD:510,19-UNIMOD:21	ms_run[1]:scan=2097	26.51856666666667	3	2202.025083	2202.026677	K	A	216	236
PSM	GGHMDDGGYSMNFNMSSSR	353	sp|P38159|RBMX_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:510,4-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=1102	19.27287	3	2210.788211	2210.791687	R	G	126	145
PSM	AAIPPPVYEEQDRPR	354	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=2269	27.749	3	1850.914	1850.9140	K	S	207	222
PSM	APKPDGPGGGPGGSHMGGNYGDDR	355	sp|P35637-2|FUS_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:510,20-UNIMOD:21	ms_run[2]:scan=1094	19.212	4	2400.0591	2400.0591	K	R	448	472
PSM	AVAGVMITASHNR	356	sp|Q6PCE3|PGM2L_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=1586	22.846	3	1455.7118	1455.7118	K	K	166	179
PSM	AVVSENNPCIK	357	sp|Q08881|ITK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:510	ms_run[2]:scan=1985	25.718	2	1377.7	1377.7000	K	H	281	292
PSM	EIAEAYDVLSDPR	358	sp|P25685|DNJB1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4093	41.056	2	1590.7391	1590.7391	K	K	47	60
PSM	ENGLPLEYQEK	359	sp|O75223-3|GGCT_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2914	32.353	2	1466.7331	1466.7331	K	L	55	66
PSM	ENVEYIEREESDGEYDEFGR	360	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21	ms_run[2]:scan=4071	40.896	3	2578.0597	2578.0597	R	K	110	130
PSM	GASQAGMTGYGMPR	361	sp|Q9UI15|TAGL3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=1211	20.111	2	1512.6315	1512.6315	K	Q	183	197
PSM	GDFCIQVGR	362	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:4	ms_run[2]:scan=3088	33.608	2	1084.5548	1084.5548	R	N	91	100
PSM	GDLGIEIPAEK	363	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:510	ms_run[2]:scan=3741	38.451	2	1208.7289	1208.7289	R	V	295	306
PSM	GEPNVSYICSR	364	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2467	29.168	2	1394.6114	1394.6114	R	Y	210	221
PSM	GNNVLYISTQK	365	sp|P62312|LSM6_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=3102	33.709	2	1383.7436	1383.7436	R	R	67	78
PSM	GVAVDYLPER	366	sp|P13674-3|P4HA1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3193	34.381	2	1231.6062	1231.6062	K	Q	277	287
PSM	HMYHSLYLK	367	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,5-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=2244	27.569	2	1418.6495	1418.6495	R	V	118	127
PSM	IEYQFFEDR	368	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=4162	41.585	2	1359.596	1359.5961	R	H	940	949
PSM	ILYSQCGDVMR	369	sp|P60660|MYL6_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=1643	23.256	2	1470.6461	1470.6461	K	A	27	38
PSM	IPYENRSNSEVVEDISTGFR	370	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=4834	47.065	3	2585.0702	2585.0702	K	L	557	577
PSM	IQVLQQQADDAEER	371	sp|P06753-4|TPM3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2024	25.997	2	1641.7958	1641.7958	K	A	14	28
PSM	ISVYYNEATGGK	372	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=2861	31.975	2	1448.7225	1448.7225	R	Y	47	59
PSM	LMIEMDGTENK	373	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:35,11-UNIMOD:510	ms_run[2]:scan=2780	31.397	2	1363.7	1363.7000	K	S	93	104
PSM	LRENELTYYCCKK	374	sp|P13987|CD59_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21,10-UNIMOD:4,11-UNIMOD:4,12-UNIMOD:510,13-UNIMOD:510	ms_run[2]:scan=1970	25.609	3	1957.9892	1957.9892	R	D	79	92
PSM	LYRPGSVAYVSR	375	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21	ms_run[2]:scan=1983	25.704	3	1480.7652	1480.7652	K	S	380	392
PSM	NLDIERPTYTNLNR	376	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21	ms_run[2]:scan=3039	33.251	2	1831.9042	1831.9042	R	L	181	195
PSM	NSVTPDMMEEMYK	377	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:35,12-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=2912	32.338	2	1737.7337	1737.7337	K	K	229	242
PSM	QEYDESGPSIVHR	378	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21	ms_run[2]:scan=1576	22.774	3	1629.7248	1629.7248	K	K	360	373
PSM	QLHDDYFYHDEL	379	sp|Q14257|RCN2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=4014	40.48	2	1707.703	1707.7030	R	-	306	318
PSM	QTQTFTTYSDNQPGVLIQVYEGER	380	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,9-UNIMOD:21,20-UNIMOD:21	ms_run[2]:scan=5295	51.255	3	2967.3153	2967.3153	K	A	424	448
PSM	RISGLIYEETR	381	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21	ms_run[2]:scan=2889	32.172	2	1449.7441	1449.7441	K	G	46	57
PSM	RLAPEYEAAATR	382	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=1462	21.949	2	1460.7237	1460.7237	K	L	62	74
PSM	RNEEYCLLDSSEIHWWR	383	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,5-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=5539	53.766	3	2486.034	2486.0340	R	V	194	211
PSM	RNEGVVGGEDYEEVDRYSR	384	sp|Q86UK7-2|ZN598_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,11-UNIMOD:21	ms_run[2]:scan=2372	28.495	3	2342.0388	2342.0388	R	Q	296	315
PSM	RWIYEDVER	385	sp|O43852-5|CALU_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,4-UNIMOD:21	ms_run[2]:scan=3046	33.303	2	1378.6495	1378.6495	K	Q	103	112
PSM	SAYQEAMDISKK	386	sp|P31947-2|1433S_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,11-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=2462	29.133	2	1551.8104	1551.8104	R	E	117	129
PSM	SFDWGYEER	387	sp|P18615-3|NELFE_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[2]:scan=3942	39.923	2	1301.5178	1301.5178	R	S	172	181
PSM	SLGVDMDDKDDAHYAVQAR	388	sp|Q9BZE4-3|GTPB4_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:35,9-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=2151	26.902	3	2269.0359	2269.0359	R	R	410	429
PSM	SPNNLETYEWYNKSISR	389	sp|Q08881|ITK_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,11-UNIMOD:21,13-UNIMOD:510,14-UNIMOD:21	ms_run[2]:scan=4092	41.048	3	2408.0165	2408.0165	K	D	230	247
PSM	STTPPPAEPVSLPQEPPKPR	390	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,2-UNIMOD:21,18-UNIMOD:510	ms_run[2]:scan=3008	33.031	3	2272.2141	2272.2141	K	V	225	245
PSM	TLNMTTSPEEK	391	sp|P49915-2|GUAA_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,7-UNIMOD:21,11-UNIMOD:510	ms_run[2]:scan=2078	26.387	2	1397.6786	1397.6786	K	R	227	238
PSM	TTEMETIYDLGTK	392	sp|Q9Y230-2|RUVB2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,8-UNIMOD:21,13-UNIMOD:510	ms_run[2]:scan=4413	43.567	2	1648.7943	1648.7943	K	M	120	133
PSM	TWDDDYVLK	393	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,6-UNIMOD:21,9-UNIMOD:510	ms_run[2]:scan=4089	41.026	2	1301.6217	1301.6217	R	R	1760	1769
PSM	YISPDQLADLYK	394	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,12-UNIMOD:510	ms_run[2]:scan=5205	50.35	2	1572.8113	1572.8113	R	S	270	282
PSM	YLMEEDEDAYKK	395	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,3-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1261	20.476	3	1730.8211	1730.8211	R	Q	210	222
PSM	YLMEEDEDAYKK	396	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:510,1-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:510,12-UNIMOD:510	ms_run[2]:scan=1933	25.34	3	1794.7925	1794.7925	R	Q	210	222
PSM	IPYENRSNSEVVEDISTGFR	397	sp|Q08881|ITK_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=4834	47.064636666666665	3	2585.0689	2585.0696	K	L	557	577
PSM	NPDDITQEEYGEFYK	398	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,14-UNIMOD:21,15-UNIMOD:510	ms_run[1]:scan=4124	41.31081	3	1994.8808	1994.8818	R	S	292	307
PSM	DILIQYDR	399	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,6-UNIMOD:21	ms_run[1]:scan=3509	36.73676666666667	2	1148.5685	1148.5686	K	T	110	118
PSM	TPSSDVLVFDYTK	400	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,11-UNIMOD:21,13-UNIMOD:510	ms_run[1]:scan=4398	43.45760833333333	2	1618.8155	1618.8163	K	H	144	157
PSM	NKIYESIEEAK	401	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,2-UNIMOD:510,4-UNIMOD:21,11-UNIMOD:510	ms_run[1]:scan=2294	27.929728333333333	2	1504.8241	1504.8270	K	S	719	730
PSM	STTPPPAEPVSLPQEPPKPR	402	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:510,3-UNIMOD:21,18-UNIMOD:510	ms_run[1]:scan=3008	33.0307	3	2272.2109	2272.2136	K	V	225	245
PSM	DNSTMGYMMAK	403	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20211018	userFasta.sprot_human_20211018	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:510,5-UNIMOD:35,11-UNIMOD:510	ms_run[1]:scan=2054	26.213426666666667	2	1331.617706	1331.619614	R	K	486	497