T: Majority protein IDs	Entry Name	Protein names	Gene Names	Organism	Gene Ontology (biological process)	Gene Ontology (cellular component)	Gene Ontology (molecular function)	T: Peptide sequences	N: Q-value	N: Score	Mild 1_1	Mild 1_2	Mild 1_3	Mild 2_1	Mild 2_2	Mild 2_3	Mild 3_1	Mild 3_2	Mild 3_3	Mild 4_1	Mild 4_2	Mild 4_3	Mild 5_1	Mild 5_2	Mild 5_3	Mild 6_1	Mild 6_2	Mild 6_3	Mild 7_1	Mild 7_2	Mild 7_3	Mild 8_1	Mild 8_2	Mild 8_3	Mild 9_1	Mild 9_2	Mild 9_3	Normal 1_1	Normal 1_2	Normal 1_3	Normal 2_1	Normal 2_2	Normal 2_3	Normal 3_1	Normal 3_2	Normal 3_3	Normal 4_1	Normal 4_2	Normal 4_3	Normal 5_1	Normal 5_2	Normal 5_3	Normal 6_1	Normal 6_2	Normal 6_3	Normal 7_1	Normal 7_2	Normal 7_3	Normal 8_1	Normal 8_2	Normal 8_3	Severe 1_1	Severe 1_2	Severe 1_3	Severe 2_1	Severe 2_2	Severe 2_3	Severe 3_1	Severe 3_2	Severe 3_3	Severe 4_1	Severe 4_2	Severe 4_3	Severe 5_1	Severe 5_2	Severe 5_3	Severe 6_1	Severe 6_2	Severe 6_3	Severe 7_1	Severe 7_2	Severe 7_3	Severe 8_1	Severe 8_2	Severe 8_3
A0A0A1E476	A0A0A1E476_HORSE	Immmunoglobulin lambda light chain variable region	IGL	Equus caballus (Horse)				ASGVPDRFSGSK	0	42.472	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	846.91	713.02	803.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	507.04	967.24	925.3	468.18	0	0	506.99	415.79	408.22	0	0	0	386.79	349.63	0	0	333.49	0	0	0	0	0	0	0
A0A0A1E6G5	A0A0A1E6G5_HORSE	Immmunoglobulin lambda light chain variable region	IGL	Equus caballus (Horse)				ASGVPDRFSGSK	0	12.408	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	430.07	0	0	0	0	0	0	0	0	0	836.47	587.38	511.72	0	0	0	0	0	0	0	0	0
A0A0A1E6R9	A0A0A1E6R9_HORSE	Immmunoglobulin lambda light chain variable region	IGL	Equus caballus (Horse)				LLIYEGNK	0.97302	0.050694	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	576.26	0	0	0	0	0	0	0	0
A0A0A1E976	A0A0A1E976_HORSE	Immmunoglobulin lambda light chain variable region	IGL	Equus caballus (Horse)				LLIYSASSR	0	87.889	0	532.59	0	0	0	0	0	0	0	0	950.14	977.74	945.91	967.49	1001.5	2825.8	2297.6	1885.3	561.01	3272.8	0	0	0	585.9	0	0	0	1663.2	1864.8	1810.4	1150.5	1176	1088.6	2953.1	3152.7	2674.1	739.5	2390.6	2860.2	3722.6	3809.8	4059.1	1124.9	1133.7	942.76	802.52	738.76	1849.5	1919.3	2155.6	2068.7	633.18	5093.6	5407.9	500.56	1685.3	0	0	0	0	0	703.63	832.27	0	0	0	3246.2	3262	3275.8	1216.9	1551.6	2238.8	543.69	0	0
A0A0A1E9B4	A0A0A1E9B4_HORSE	Immmunoglobulin lambda light chain variable region	IGL	Equus caballus (Horse)				ASGVPDRFSGSK	0	43.264	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1901.7	1586.5	2782	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	503.59	0	0	0	0	0	468.28	0	0	0	0	0	0	0	0	563.14	553.76	491.65	0	0	0	0	0	0	570.93	0	382.69	0	0	0	0	0	0	0	0	0
A0A2L1K035	A0A2L1K035_HORSE	KCNQ2		Equus caballus (Horse)		plasma membrane [GO:0005886]	voltage-gated potassium channel activity [GO:0005249]	GVAAKGK	0.69667	0.62677	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	441.54	374.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GRS8	A0A3Q2GRS8_HORSE	UDP-glucose glycoprotein glucosyltransferase 1	UGGT1	Equus caballus (Horse)	ER-associated misfolded protein catabolic process [GO:0071712]; protein N-linked glycosylation via asparagine [GO:0018279]	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]	UDP-glucose:glycoprotein glucosyltransferase activity [GO:0003980]; unfolded protein binding [GO:0051082]	IKSHIQQLR	0.98817	-1.6069	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	381.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	482.12	0	0	0	0	0	0	0	0	0	0	0	0	311.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GS39	A0A3Q2GS39_HORSE	Ribosomal protein S23	RPS23	Equus caballus (Horse)	translation [GO:0006412]	cytosolic small ribosomal subunit [GO:0022627]; ribosome [GO:0005840]	structural constituent of ribosome [GO:0003735]	WHDKQYKK	0.96075	-0.010438	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	709.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GSJ9	A0A3Q2GSJ9_HORSE	Cytoplasmic linker associated protein 2	CLASP2	Equus caballus (Horse)	regulation of cellular component organization [GO:0051128]			VGAGASK	0.95904	0.22133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	555.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GSK4	A0A3Q2GSK4_HORSE	Nuclear factor of activated T cells 5	NFAT5	Equus caballus (Horse)		nucleus [GO:0005634]	DNA-binding transcription factor activity [GO:0003700]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]	KSPMLCGQYPVKCEGK	0.76327	0.51622	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	793.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GSR3	A0A3Q2GSR3_HORSE	Mitogen-activated protein kinase kinase kinase 19	MAP3K19	Equus caballus (Horse)	signal transduction [GO:0007165]		ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	SGLLTIPR	0.89436	0.43155	0	2335.5	0	0	2080	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12612	0	0	0	0
A0A3Q2GSR7	A0A3Q2GSR7_HORSE	Crystallin beta-gamma domain containing 3	CRYBG3	Equus caballus (Horse)			structural constituent of eye lens [GO:0005212]	KPNDFSSSAPDAK	0.25714	0.93306	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2035	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	826.25	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GT04	A0A3Q2GT04_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	CDC42BPA	Equus caballus (Horse)	cytoskeleton organization [GO:0007010]; phosphorylation [GO:0016310]	cytoplasm [GO:0005737]; lamellipodium [GO:0030027]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	APTTCPVPPEQTK	0.97664	0.06472	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	518.03	0	0	0	0	0	0	0	0	0	0	0	1117.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1090	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GT15	A0A3Q2GT15_HORSE	Dipeptidyl peptidase 9	DPP9	Equus caballus (Horse)	proteolysis [GO:0006508]		serine-type peptidase activity [GO:0008236]	LSRDSKNEAQK	0.96659	-0.073798	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	647.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GT26	A0A3Q2GT26_HORSE	Ataxin 7 like 2	ATXN7L2	Equus caballus (Horse)				GKPSGCR	0.98551	-1.4574	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1026.1	0	0	0	0	0	0	1133	0	0	0	0	0	0	0	0	0	0	547.9	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GTB8	A0A3Q2GTB8_HORSE	Pumilio RNA binding family member 2	PUM2	Equus caballus (Horse)			RNA binding [GO:0003723]	LDSRFRK	0.98	-0.26899	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7209.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	903.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GTF2	A0A3Q2GTF2_HORSE	Ig-like domain-containing protein	LOC100069287	Equus caballus (Horse)		membrane [GO:0016020]		ITYSSLTFK	0.97483	0.10702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1627.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GTK6	A0A3Q2GTK6_HORSE	Coiled-coil domain containing 88C	CCDC88C	Equus caballus (Horse)	cytoskeleton-dependent intracellular transport [GO:0030705]	cytoplasm [GO:0005737]		ALVKLIKPK	0.9866	-3.2007	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	334.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GTM2	A0A3Q2GTM2_HORSE	NOP58 ribonucleoprotein	NOP58	Equus caballus (Horse)	ribosomal small subunit biogenesis [GO:0042274]; snoRNA localization [GO:0048254]	box C/D RNP complex [GO:0031428]; Cajal body [GO:0015030]; cytosol [GO:0005829]; fibrillar center [GO:0001650]; pre-snoRNP complex [GO:0070761]; small-subunit processome [GO:0032040]	ATPase binding [GO:0051117]; snoRNA binding [GO:0030515]; TFIID-class transcription factor complex binding [GO:0001094]	AEKYEHKSEVK	0.96496	-0.08426	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	799.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GTU3	A0A3Q2GTU3_HORSE	ADAM metallopeptidase domain 20	ADAM20	Equus caballus (Horse)	male gonad development [GO:0008584]; proteolysis [GO:0006508]	external side of plasma membrane [GO:0009897]; plasma membrane [GO:0005886]; sperm head plasma membrane [GO:1990913]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	HIVHMKVKK	0.97488	-0.19503	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1505.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GU90	A0A3Q2GU90_HORSE	Extended synaptotagmin 2	ESYT2	Equus caballus (Horse)	endoplasmic reticulum-plasma membrane tethering [GO:0061817]; lipid transport [GO:0006869]	endoplasmic reticulum membrane [GO:0005789]; plasma membrane [GO:0005886]	lipid binding [GO:0008289]; metal ion binding [GO:0046872]	DTYLKGLVKGK	0.97342	-0.19312	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	403.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GUB2	A0A3Q2GUB2_HORSE	SEL1L family member 3	SEL1L3	Equus caballus (Horse)				FPRFLNR	0.98824	-1.7684	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	946.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GUC2	A0A3Q2GUC2_HORSE	Uncharacterized protein		Equus caballus (Horse)	cell chemotaxis [GO:0060326]; defense response to bacterium [GO:0042742]	extracellular space [GO:0005615]	CCR6 chemokine receptor binding [GO:0031731]; chemoattractant activity [GO:0042056]	CLLPTEKCFR	0.98853	-1.8842	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	966.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GUR6	A0A3Q2GUR6_HORSE	Fibronectin type-III domain-containing protein	LOC111775907	Equus caballus (Horse)		membrane [GO:0016020]		MLLELTGSPK	0.96563	-0.11005	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	767.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GUT2	A0A3Q2GUT2_HORSE	Solute carrier family 2 member 9	SLC2A9	Equus caballus (Horse)		plasma membrane [GO:0005886]	hexose transmembrane transporter activity [GO:0015149]	RVQRNVR	0.96693	-0.082015	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	802.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GV00	A0A3Q2GV00_HORSE	Lysosomal associated membrane protein 1	LAMP1	Equus caballus (Horse)	establishment of protein localization to organelle [GO:0072594]	late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; plasma membrane [GO:0005886]		AAPSGAR	0.95447	0.22578	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	668.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GV01	A0A3Q2GV01_HORSE	Kelch like family member 13	KLHL13	Equus caballus (Horse)	protein ubiquitination [GO:0016567]; regulation of cytokinesis [GO:0032465]	Cul3-RING ubiquitin ligase complex [GO:0031463]	cullin family protein binding [GO:0097602]; ubiquitin-protein transferase activity [GO:0004842]	TGRGDQGAQGVRR	0.97119	-0.060739	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1103.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GV77	A0A3Q2GV77_HORSE	URB2 ribosome biosis homolog	URB2	Equus caballus (Horse)				LVAQFDTLGR	0.25352	0.93029	0	0	0	0	0	0	0	0	0	0	0	0	0	0	410.1	0	0	0	0	0	0	0	0	0	0	0	0	1683.6	0	0	0	0	0	0	0	0	0	0	0	2613.3	0	0	0	0	0	0	0	0	0	0	0	0	2262.8	0	0	0	0	0	1995.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GVH4	A0A3Q2GVH4_HORSE	Platelet-derived growth factor subunit B (PDGF-2) (Platelet-derived growth factor B chain) (Platelet-derived growth factor beta polypeptide)	PDGFB	Equus caballus (Horse)	platelet-derived growth factor receptor signaling pathway [GO:0048008]; positive regulation of cell division [GO:0051781]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [GO:0051897]; positive regulation of protein autophosphorylation [GO:0031954]	extracellular space [GO:0005615]; membrane [GO:0016020]	growth factor activity [GO:0008083]; platelet-derived growth factor receptor binding [GO:0005161]	AGGGGNR	0.98814	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	187.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GVN5	A0A3Q2GVN5_HORSE	LRRC37A/B like protein 1 C-terminal domain-containing protein	LOC100063851	Equus caballus (Horse)		membrane [GO:0016020]		KELAQHR	0.98562	-2.8392	0	0	0	0	0	0	0	972.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3845.8	0	0	0	0	0	0	0	0	0	0	0	0	0	584.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GVR3	A0A3Q2GVR3_HORSE	TOPBP1 interacting checkpoint and replication regulator	TICRR	Equus caballus (Horse)	DNA replication [GO:0006260]; mitotic DNA replication checkpoint signaling [GO:0033314]; response to ionizing radiation [GO:0010212]	nucleus [GO:0005634]		SVKRGLPR	0.98408	-0.98803	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	317.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GVZ6	A0A3Q2GVZ6_HORSE	Tight junction protein 1	TJP1	Equus caballus (Horse)		bicellular tight junction [GO:0005923]; plasma membrane [GO:0005886]		RPLNQKTIRR	0.9791	-0.3697	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1937.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GW48	A0A3Q2GW48_HORSE	Ubiquitin-associated domain-containing protein 1 (Kip1 ubiquitination-promoting complex protein 2)	UBAC1	Equus caballus (Horse)	protein ubiquitination [GO:0016567]			APTPLPK	0.94293	0.24662	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7011.5	0	0	0	0	0	0	0	0	524.86	407.96	598.12	589.55	564.67	516.53	21382	522.7	0	0	0	345.95	278.23	339.73	0	5733.4	0	0	0	0	0	0	11955	6237.8	6754.8	0	3672.9	4431.4	4607.6	0	329.22	0	0	0	0	0	0	2745.1	0	0	0	0	0	0	0	0	0
A0A3Q2GWL4	A0A3Q2GWL4_HORSE	Rap guanine nucleotide exchange factor 2 (Cyclic nucleotide ras GEF) (Neural RAP guanine nucleotide exchange protein) (PDZ domain-containing guanine nucleotide exchange factor 1) (RA-GEF-1) (Ras/Rap1-associating GEF-1)	RAPGEF2	Equus caballus (Horse)	proteolysis [GO:0006508]; small GTPase mediated signal transduction [GO:0007264]		guanyl-nucleotide exchange factor activity [GO:0005085]	EALSNLREHQLR	0.97418	-0.19439	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	585.72	0	0	0	0	0	0	0	0	0	0	0	0	4960.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	677.43	0	0	0	0	1286.6	0	0	0	0	0	0	0	0	0
A0A3Q2GWN8	A0A3Q2GWN8_HORSE	Ring finger protein 213	RNF213	Equus caballus (Horse)		cytoplasm [GO:0005737]	ATP hydrolysis activity [GO:0016887]; metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]	ELLQLMER	0.98321	-0.92956	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1309.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	962.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GWY9	A0A3Q2GWY9_HORSE	guanylate kinase (EC 2.7.4.8)	GUK1	Equus caballus (Horse)	phosphorylation [GO:0016310]	cytosol [GO:0005829]; photoreceptor inner segment [GO:0001917]	ATP binding [GO:0005524]; guanylate kinase activity [GO:0004385]	LSHGCLFLDTTR	0.9747	0.098936	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	468.76	0	0	364.98	0	0	545.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GX64	A0A3Q2GX64_HORSE	5'-nucleotidase (EC 3.1.3.5) (Ecto-5'-nucleotidase)	NT5E	Equus caballus (Horse)		side of membrane [GO:0098552]	hydrolase activity [GO:0016787]; nucleotide binding [GO:0000166]	GLEQVCQR	0.96078	-0.0039357	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	755.85	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GX70	A0A3Q2GX70_HORSE	Pecanex-like protein	PCNX1	Equus caballus (Horse)		membrane [GO:0016020]		LWELLHKLR	0.98648	-3.2949	0	0	0	0	0	0	0	0	0	0	2779.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GX83	A0A3Q2GX83_HORSE	Rotatin	RTTN	Equus caballus (Horse)	cilium organization [GO:0044782]	centrosome [GO:0005813]; ciliary basal body [GO:0036064]		LQAKTILK	0.70811	0.58199	0	0	0	0	0	0	0	0	0	0	0	0	0	336.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2533	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	399.31	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GXD3	A0A3Q2GXD3_HORSE	hexokinase (EC 2.7.1.1)	HK1	Equus caballus (Horse)	glycolytic process [GO:0006096]; hexose metabolic process [GO:0019318]; intracellular glucose homeostasis [GO:0001678]	cytosol [GO:0005829]; mitochondrial outer membrane [GO:0005741]	ATP binding [GO:0005524]; glucose binding [GO:0005536]; hexokinase activity [GO:0004396]	THPQYSRRFHK	0.96775	-0.16853	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	474.76	0	0	0	0	0	0	0	0	0	0	0	525.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GXK8	A0A3Q2GXK8_HORSE	N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14)	METTL14	Equus caballus (Horse)	forebrain radial glial cell differentiation [GO:0021861]; mRNA destabilization [GO:0061157]; mRNA methylation [GO:0080009]; spermatogenesis [GO:0007283]; stem cell population maintenance [GO:0019827]	nucleus [GO:0005634]; RNA N6-methyladenosine methyltransferase complex [GO:0036396]	mRNA binding [GO:0003729]; S-adenosylmethionine-dependent methyltransferase activity [GO:0008757]	GGGRGGA	0.68852	0.586	928.58	0	0	1626.8	1564.7	1478.5	1252.8	1237.4	1361.9	795.74	1112.9	1495.7	1114.9	1207.7	1153.9	0	0	0	0	1215.6	1095.2	1196.4	0	0	0	0	0	1313.2	1326.6	1309.1	1507.3	0	0	0	0	0	1206	1316.7	1256.3	0	0	0	1171	1361.2	1089.9	0	0	0	1173.3	1128	1144.5	0	1638.1	1408.9	0	0	1211.2	1006.7	0	0	1414.2	1516.1	0	0	0	0	0	1220.9	1107.4	0	1205.5	1388.1	0	0	55003
A0A3Q2GXP6	A0A3Q2GXP6_HORSE	RAR related orphan receptor A	RORA	Equus caballus (Horse)		nucleus [GO:0005634]	nuclear receptor activity [GO:0004879]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	HLKLLSTSLWLDR	0.93393	0.26727	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	586.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GXU6	A0A3Q2GXU6_HORSE	A-kinase anchoring protein 6	AKAP6	Equus caballus (Horse)				DELPPNPK	0.98908	-1.6836	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1175.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GXX0	A0A3Q2GXX0_HORSE	Neurexin 2	NRXN2	Equus caballus (Horse)		membrane [GO:0016020]		GLDPMGK	0.96923	-0.042282	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6687.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GXY8	A0A3Q2GXY8_HORSE	Ubiquitin specific peptidase 43	USP43	Equus caballus (Horse)			cysteine-type deubiquitinase activity [GO:0004843]	SISMKVPTPSRAK	0.97444	-0.19766	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	521.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GXZ4	A0A3Q2GXZ4_HORSE	receptor protein-tyrosine kinase (EC 2.7.10.1)	EPHA8	Equus caballus (Horse)		plasma membrane [GO:0005886]	ATP binding [GO:0005524]; ephrin receptor activity [GO:0005003]	GVGPLSK	0.98812	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6815.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4891.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GY76	A0A3Q2GY76_HORSE	Neurexophilin	NXPH1	Equus caballus (Horse)		extracellular region [GO:0005576]	signaling receptor binding [GO:0005102]	LLSQTFR	0.95936	-0.018999	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1560	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GYK0	A0A3Q2GYK0_HORSE	RAS protein activator like 2	RASAL2	Equus caballus (Horse)			GTPase activator activity [GO:0005096]	LEDSEERLR	0.98813	-1.7767	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	494.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GYN0	A0A3Q2GYN0_HORSE	Aly/REF export factor	ALYREF	Equus caballus (Horse)	mRNA export from nucleus [GO:0006406]	nuclear speck [GO:0016607]; nucleus [GO:0005634]	mRNA binding [GO:0003729]	AGSQGGR	0.98347	-0.79347	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	634.74	510.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	435.64	0	0	0	0	0	0	0	0	0	0	0	0	0	389.04	0	0	0	0	0	0	0	0
A0A3Q2GYT0	A0A3Q2GYT0_HORSE	Platelet-derived growth factor D	PDGFD	Equus caballus (Horse)	platelet-derived growth factor receptor signaling pathway [GO:0048008]; positive regulation of cell division [GO:0051781]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [GO:0051897]; positive regulation of protein autophosphorylation [GO:0031954]	extracellular space [GO:0005615]; membrane [GO:0016020]	growth factor activity [GO:0008083]; platelet-derived growth factor receptor binding [GO:0005161]	ITSRTNQIKITFK	0.98831	-1.1455	0	0	0	0	0	0	0	0	0	0	0	428.8	581.13	723.2	0	0	0	0	0	0	0	0	0	0	0	0	0	662	0	0	872.35	865.04	0	0	0	0	512.28	650.92	1171.2	0	0	0	0	0	0	0	0	596.57	0	0	0	0	0	326	0	0	0	0	0	523.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GYV3	A0A3Q2GYV3_HORSE	FAT atypical cadherin 2	FAT2	Equus caballus (Horse)	cell-cell adhesion [GO:0098609]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	adherens junction [GO:0005912]; plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]	LSILTPRHR	0.97271	-0.1822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	533.34	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GZH7	A0A3Q2GZH7_HORSE	Olfactory receptor family 52 subfamily J member 3E	OR52J3E	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	ERVFRIFIK	0.97292	-0.19587	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1171.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GZR9	A0A3Q2GZR9_HORSE	GTP-binding protein 8	GTPBP8	Equus caballus (Horse)			GTP binding [GO:0005525]; metal ion binding [GO:0046872]	IEYLSSAER	0.96083	-0.0019656	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2227.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2GZV2	A0A3Q2GZV2_HORSE	KRIT1 ankyrin repeat containing	KRIT1	Equus caballus (Horse)		cytoskeleton [GO:0005856]		LNGQLMPTER	0.96769	0.02271	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	813.34	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	437.6	0	0	0	0	0	674.7	0	0	0	0	0
A0A3Q2H0K3	A0A3Q2H0K3_HORSE	Internexin neuronal intermediate filament protein alpha	INA	Equus caballus (Horse)	cellular response to leukemia inhibitory factor [GO:1990830]; intermediate filament organization [GO:0045109]; neurofilament cytoskeleton organization [GO:0060052]; postsynaptic modulation of chemical synaptic transmission [GO:0099170]	cytoplasm [GO:0005737]; cytoplasmic ribonucleoprotein granule [GO:0036464]; intermediate filament [GO:0005882]; neurofilament [GO:0005883]; postsynaptic intermediate filament cytoskeleton [GO:0099160]; Schaffer collateral - CA1 synapse [GO:0098685]	structural constituent of postsynaptic intermediate filament cytoskeleton [GO:0099184]	EYQDLLNVK	0.98529	-2.3076	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5457	0	0	0	0	0	0	733.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H0L1	A0A3Q2H0L1_HORSE	Ankyrin repeat domain 17	ANKRD17	Equus caballus (Horse)			RNA binding [GO:0003723]	NNTITTTSSK	0.91944	0.30819	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	641.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H0T4	A0A3Q2H0T4_HORSE	RAP1 GTPase activating protein 2	RAP1GAP2	Equus caballus (Horse)	regulation of small GTPase mediated signal transduction [GO:0051056]		GTPase activator activity [GO:0005096]	FAKLEDR	0.98614	-0.86442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1601.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H0T5	A0A3Q2H0T5_HORSE	ADAM metallopeptidase domain 32	ADAM32	Equus caballus (Horse)	binding of sperm to zona pellucida [GO:0007339]; cell adhesion [GO:0007155]; male gonad development [GO:0008584]; proteolysis [GO:0006508]	plasma membrane [GO:0005886]	metalloendopeptidase activity [GO:0004222]	ISTVGEADELLSRFSDWK	0.93846	0.25494	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	725.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	670.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H0Y7	A0A3Q2H0Y7_HORSE	Mitochondrial carrier 1	MTCH1	Equus caballus (Horse)	positive regulation of apoptotic process [GO:0043065]; protein insertion into mitochondrial outer membrane [GO:0045040]	membrane [GO:0016020]; mitochondrion [GO:0005739]	membrane insertase activity [GO:0032977]	YLSVQVSR	0.96619	0.0046012	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1123.5	0	0	0	0
A0A3Q2H142	A0A3Q2H142_HORSE	Ubiquitin protein ligase E3 component n-recognin 4	UBR4	Equus caballus (Horse)			calmodulin binding [GO:0005516]; zinc ion binding [GO:0008270]	EKDPLAALRVR	0.98804	-1.072	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1533.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3256.1	0	1445.3	0	419.38	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	464.73	0	0	0	0	0	0
A0A3Q2H170	A0A3Q2H170_HORSE	Envelope glycoprotein	LOC106781761	Equus caballus (Horse)		membrane [GO:0016020]		DSSEVAPTASCGDNK	0.95876	-0.012738	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	623.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H194	A0A3Q2H194_HORSE	Spermatogenesis associated 13	SPATA13	Equus caballus (Horse)	filopodium assembly [GO:0046847]; lamellipodium assembly [GO:0030032]	cytosol [GO:0005829]	guanyl-nucleotide exchange factor activity [GO:0005085]	DICEGYIR	0.98585	-2.0507	0	0	0	0	0	0	0	0	0	0	0	0	0	312.89	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	467.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H1A3	A0A3Q2H1A3_HORSE	Coiled-coil domain containing 18	CCDC18	Equus caballus (Horse)				FSKPSHTAFFKSKK	0.98009	-0.38355	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	319.76	0	385.68	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H1N7	A0A3Q2H1N7_HORSE	V-type proton ATPase subunit C	ATP6V1C2	Equus caballus (Horse)		"proton-transporting V-type ATPase, V1 domain [GO:0033180]"	"proton-transporting ATPase activity, rotational mechanism [GO:0046961]"	LWGWGPRR	0.98961	-1.2653	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4727.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	532.55	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H1R0	A0A3Q2H1R0_HORSE	Zinc finger translocation associated	ZFTA	Equus caballus (Horse)				DGGADLK	0.95089	0.24084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	696.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H1U5	A0A3Q2H1U5_HORSE	Transcription factor BTF3	BTF3L4	Equus caballus (Horse)				EAGPAVSRGPRSR	0.89665	0.43193	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2665.9	0	0	0	0	599.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H209	A0A3Q2H209_HORSE	Poly(U)-binding-splicing factor PUF60 (60 kDa poly(U)-binding-splicing factor)	PUF60	Equus caballus (Horse)	"mRNA processing [GO:0006397]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]; RNA splicing [GO:0008380]"	nucleus [GO:0005634]	RNA binding [GO:0003723]	VIIYQEK	0.97075	0.035155	550.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H2E9	A0A3Q2H2E9_HORSE	Rho guanine nucleotide exchange factor 28	ARHGEF28	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]; metal ion binding [GO:0046872]	DAAPPCTK	0.41463	0.68116	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	787.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H2M3	A0A3Q2H2M3_HORSE	Cation channel sperm associated auxiliary subunit gamma	CATSPERG	Equus caballus (Horse)		CatSper complex [GO:0036128]; sperm principal piece [GO:0097228]		SRAPGHSGQHVQPAGGR	0.98706	-1.8309	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	437.64	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H2P6	A0A3Q2H2P6_HORSE	BOS complex subunit NCLN (Nicalin)	NCLN	Equus caballus (Horse)	regulation of signal transduction [GO:0009966]	endoplasmic reticulum membrane [GO:0005789]		NAVLNTEAR	0.96888	0.028478	0	0	0	0	705.82	0	0	0	0	0	0	0	0	0	0	0	0	0	533.68	0	0	0	819.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	572.56	0	0	0	0	0	0	0	0	600.4	0	0	0	0	0	0	690.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H2R9	A0A3Q2H2R9_HORSE	Poly(A) binding protein cytoplasmic 1 like	PABPC1L	Equus caballus (Horse)		cytoplasmic stress granule [GO:0010494]; cytosol [GO:0005829]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]	mRNA 3'-UTR binding [GO:0003730]; poly(A) binding [GO:0008143]; poly(U) RNA binding [GO:0008266]	GVNLYVKNLDDSIDDEK	0.97985	-0.36153	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	318.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H308	A0A3Q2H308_HORSE	E3 ubiquitin-protein ligase (EC 2.3.2.26)	SMURF2	Equus caballus (Horse)	protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511]		ubiquitin protein ligase activity [GO:0061630]	DLWKRLMIK	0.98836	-1.8052	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	557.53	690.05	0	0	426.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H3D3	A0A3Q2H3D3_HORSE	Hook microtubule tethering protein 3	HOOK3	Equus caballus (Horse)	cytoplasmic microtubule organization [GO:0031122]; cytoskeleton-dependent intracellular transport [GO:0030705]	cytoplasm [GO:0005737]; microtubule [GO:0005874]	microtubule binding [GO:0008017]	EKLIRLQHENK	0.96498	-0.12042	0	0	0	0	0	0	0	0	0	0	0	0	299.03	0	0	0	0	0	0	0	0	0	0	0	0	0	0	300.84	0	0	0	0	0	0	335	0	0	0	0	0	329.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	332.76	324.31	0	0	314.91	0	0	0	0	0	0	0	0
A0A3Q2H3H0	A0A3Q2H3H0_HORSE	Transcription factor AP-2-alpha (AP-2 transcription factor) (Activating enhancer-binding protein 2-alpha) (Activator protein 2)	TFAP2A	Equus caballus (Horse)		nucleoplasm [GO:0005654]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	SPRPERTGK	0.98813	-1.0414	0	0	0	0	557.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	855.58	0	0	0
A0A3Q2H440	A0A3Q2H440_HORSE	Inhibitor of Bruton tyrosine kinase	IBTK	Equus caballus (Horse)				IFPAHKYILAVR	0.96637	0.19158	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	863.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H455	A0A3Q2H455_HORSE	Family with sequence similarity 184 member A	FAM184A	Equus caballus (Horse)				AMLTERDQVIK	0.98623	-3.3197	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1264.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H4B9	A0A3Q2H4B9_HORSE	Synaptotagmin 14	SYT14	Equus caballus (Horse)				EIGLGISNNGRNDLK	0.98725	-1.8503	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	900.13	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H4P1	A0A3Q2H4P1_HORSE	Mitogen-activated protein kinase kinase kinase kinase 3 (EC 2.7.11.1)	MAP4K3	Equus caballus (Horse)	intracellular signal transduction [GO:0035556]; phosphorylation [GO:0016310]	cytoplasm [GO:0005737]	ATP binding [GO:0005524]; MAP kinase kinase kinase kinase activity [GO:0008349]; protein serine kinase activity [GO:0106310]	MLEFQPER	0.77706	0.50977	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1277.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1168	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H4X7	A0A3Q2H4X7_HORSE	Solute carrier organic anion transporter family member 5A1	SLCO5A1	Equus caballus (Horse)	transmembrane transport [GO:0055085]	membrane [GO:0016020]		NPVHLDQNDPR	0.2807	0.84955	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	573.07	630.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2055.3	0	0	0	691.64	0	0	0	0	0	0	0	0	0	0	0	0	0	574.57	0
A0A3Q2H552	A0A3Q2H552_HORSE	YTH domain containing 2	YTHDC2	Equus caballus (Horse)			ATP binding [GO:0005524]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724]	SDQSSVK	0.75312	0.54993	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	357.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	284	0	263.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H589	A0A3Q2H589_HORSE	Solute carrier family 7 member 13	LOC111772269 LOC111772062 LOC111774899	Equus caballus (Horse)		membrane [GO:0016020]	transmembrane transporter activity [GO:0022857]	TRGNFQLQR	0.98868	-1.8921	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	830.32	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H5C5	A0A3Q2H5C5_HORSE	G protein-coupled receptor kinase (EC 2.7.11.-)	GRK4	Equus caballus (Horse)	phosphorylation [GO:0016310]; signal transduction [GO:0007165]		ATP binding [GO:0005524]; G protein-coupled receptor kinase activity [GO:0004703]	LEVPFPEIPPNVVK	0.74811	0.55487	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2116.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1173.1	0	0	0	0	0	4311.6	0	1111.7	1057	0	0	0	0	0	0	0	0	0	1839.6	0	3619.7	0	0	0	0	0	0
A0A3Q2H5K2	A0A3Q2H5K2_HORSE	Podocan like 1	PODNL1	Equus caballus (Horse)				VPRGALSR	0.98817	-1.7172	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1549.9	0	0	0	1478.8	0	0	0	0	2365.2	0	0	0	0	0	5061.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1678.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H5S1	A0A3Q2H5S1_HORSE	Dynein axonemal heavy chain 10	DNAH10	Equus caballus (Horse)		axoneme [GO:0005930]; dynein complex [GO:0030286]; microtubule [GO:0005874]; motile cilium [GO:0031514]	ATP binding [GO:0005524]	DTYGPPMGK	0.98051	-0.49717	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	399.84	0	1108.1	0	0	450.21	0	449.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	466.71	0	0	0	0
A0A3Q2H5S5	A0A3Q2H5S5_HORSE	Tyrosine-protein phosphatase non-receptor type 13 (EC 3.1.3.48)	PTPN13	Equus caballus (Horse)	dephosphorylation [GO:0016311]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	protein tyrosine phosphatase activity [GO:0004725]	VLPSGRYTGSK	0.98686	-1.8537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	709.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H5Y3	A0A3Q2H5Y3_HORSE	YME1 like 1 ATPase	YME1L1	Equus caballus (Horse)	proteolysis [GO:0006508]		ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent peptidase activity [GO:0004176]; metalloendopeptidase activity [GO:0004222]	AQALTQKTNVR	0.98552	-2.9983	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	679.78	605.44	582.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	654.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H661	A0A3Q2H661_HORSE	ABC transporter domain-containing protein	LOC111767402	Equus caballus (Horse)		membrane [GO:0016020]	ATP binding [GO:0005524]	SSLSLAFFR	0.96841	0.16034	0	0	0	0	0	0	0	972.58	0	0	0	0	0	0	0	842.62	0	892.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H6C2	A0A3Q2H6C2_HORSE	Copine 6	CPNE6	Equus caballus (Horse)	cellular response to calcium ion [GO:0071277]	plasma membrane [GO:0005886]	calcium-dependent phospholipid binding [GO:0005544]	CVLAEVPR	0.96888	-0.034487	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1453.6	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H6K1	A0A3Q2H6K1_HORSE	PAS domain-containing protein	PASD1	Equus caballus (Horse)	circadian regulation of gene expression [GO:0032922]; negative regulation of circadian rhythm [GO:0042754]; negative regulation of DNA-templated transcription [GO:0045892]; regulation of transcription by RNA polymerase II [GO:0006357]	CLOCK-BMAL transcription complex [GO:1990513]		EHVRALFAKLR	0.98081	-0.21375	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	776.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H6R9	A0A3Q2H6R9_HORSE	N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14)	METTL14	Equus caballus (Horse)	forebrain radial glial cell differentiation [GO:0021861]; mRNA destabilization [GO:0061157]; mRNA methylation [GO:0080009]; spermatogenesis [GO:0007283]; stem cell population maintenance [GO:0019827]	nucleus [GO:0005634]; RNA N6-methyladenosine methyltransferase complex [GO:0036396]	mRNA binding [GO:0003729]; S-adenosylmethionine-dependent methyltransferase activity [GO:0008757]	GGRGGAHR	0.9859	-2.9628	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2409.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H705	A0A3Q2H705_HORSE	Ig-like domain-containing protein		Equus caballus (Horse)				DNTYSLSSTLTLPK	0	13.34	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1863.4	706.48	739.93	0	0	0	0	0	0	0	0	0	0	0	0	537.06	549.64	0	968.81	0	0	0	2011.6	0	1115.6	1451.2	658.11	0	0	0	0	0	0	0	0	0	553.08	1278.5	1073.9	0	0	0	0	1692.1	1399.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H7D9	A0A3Q2H7D9_HORSE	GOLD domain-containing protein		Equus caballus (Horse)	endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; Golgi organization [GO:0007030]; intracellular protein transport [GO:0006886]	COPI vesicle coat [GO:0030126]; COPII-coated ER to Golgi transport vesicle [GO:0030134]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; Golgi apparatus [GO:0005794]		KGPGRPR	0.98321	-0.71263	1579.4	1707.5	1791	1517.6	1385.6	1729.8	1617.1	1685.8	1789.9	2365.3	2923.1	3266.6	1278.2	0	1376.7	2402.2	0	0	1361.8	1609.5	1538.3	1385.6	1292.6	1551.3	1208.8	1154.8	1203.6	1784.3	0	0	3588.1	3435.5	3476.3	3893.7	0	4462.6	1592.6	2169.2	2015.7	0	1064.4	1138.3	1285.4	1363.2	1237.2	0	1855.4	1847	2407.3	2626	2331.8	1392.7	1383	1653.5	789.95	923.55	817.93	1653.8	0	0	1270.1	1434.7	1318.6	541.29	0	0	1191.5	1157.7	1242.5	3009.5	3048.6	2458.6	2163.5	2177.7	1991
A0A3Q2H7G3	A0A3Q2H7G3_HORSE	Vertnin	VRTN	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]	sequence-specific DNA binding [GO:0043565]	GEVGEGAAKAMGR	0.98485	-2.1255	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	429.27
A0A3Q2H7H2	A0A3Q2H7H2_HORSE	"Kazrin, periplakin interacting protein"	KAZN	Equus caballus (Horse)		cornified envelope [GO:0001533]; cytosol [GO:0005829]; desmosome [GO:0030057]; nuclear speck [GO:0016607]		ALAKEKDLLER	0.97008	-0.067958	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1217.9	1151.9	1126.5	0	0	0	0	0	0	0	0	0	0	0	0	505.14	583.11	539.45
A0A3Q2H7N9	A0A3Q2H7N9_HORSE	ALS2 C-terminal like	ALS2CL	Equus caballus (Horse)				HLWPLKDLK	0.9885	-1.874	0	0	0	0	0	0	0	0	0	0	0	1104.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1647	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H7P1	A0A3Q2H7P1_HORSE	Catenin alpha like 1	CTNNAL1	Equus caballus (Horse)	cell adhesion [GO:0007155]; Rho protein signal transduction [GO:0007266]	cytoplasm [GO:0005737]	actin filament binding [GO:0051015]; cadherin binding [GO:0045296]	VGEAIANENWDLK	0.97124	0.040769	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	393.08	0	0	732.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H7Q3	A0A3Q2H7Q3_HORSE	NADH:ubiquinone oxidoreductase complex assembly factor 5	NDUFAF5	Equus caballus (Horse)			S-adenosylmethionine-dependent methyltransferase activity [GO:0008757]	INSLMSQEK	0.96873	-0.097479	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	901.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H7U3	A0A3Q2H7U3_HORSE	Kelch like family member 38	KLHL38	Equus caballus (Horse)				HDLQARKR	0.97008	-0.031368	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	510.54	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H7V2	A0A3Q2H7V2_HORSE	Gem nuclear organelle associated protein 8	GEMIN8	Equus caballus (Horse)	spliceosomal snRNP assembly [GO:0000387]	SMN complex [GO:0032797]		AADLIWQCPFGLPQSEMAAK	0.89139	0.42084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1040.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H866	A0A3Q2H866_HORSE	Adhesion G protein-coupled receptor B1	ADGRB1	Equus caballus (Horse)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; cell surface receptor signaling pathway [GO:0007166]; engulfment of apoptotic cell [GO:0043652]; negative regulation of angiogenesis [GO:0016525]	dendrite [GO:0030425]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]	G protein-coupled receptor activity [GO:0004930]	ATDISFPMKGWR	0.26	0.90546	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	715.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	368.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H8K7	A0A3Q2H8K7_HORSE	Centrosomal protein kizuna (Polo-like kinase 1 substrate 1)	KIZ	Equus caballus (Horse)	spindle organization [GO:0007051]	cell projection [GO:0042995]; centrosome [GO:0005813]; cytoplasm [GO:0005737]		QIEYETQIR	0.69231	0.58637	0	0	0	0	0	0	1106	1078.2	0	553.42	0	1461.5	0	2382.6	2301.3	0	2694.7	2817.2	0	0	0	0	0	637.27	0	0	0	2792	2655.2	2515.1	6578.5	6347.1	6299.7	2000.4	2049.2	0	1259.8	4200	3957.3	0	2799.6	2918.9	1245.7	1256.5	1288.3	0	2616.5	2531.1	2160.6	0	0	0	2500.2	0	0	851.53	0	0	2860.2	2820	0	0	0	813.12	0	0	0	1422.1	0	0	0	0	0	1092	0
A0A3Q2H8M3	A0A3Q2H8M3_HORSE	RBR-type E3 ubiquitin transferase (EC 2.3.2.31)	RNF144A	Equus caballus (Horse)	positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; protein polyubiquitination [GO:0000209]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytoplasm [GO:0005737]; Golgi apparatus [GO:0005794]; ubiquitin ligase complex [GO:0000151]	ubiquitin conjugating enzyme binding [GO:0031624]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]	ATVLPLAFR	0.96509	-0.092669	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4169.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H8Y0	A0A3Q2H8Y0_HORSE	Zinc finger MYND-type containing 8	ZMYND8	Equus caballus (Horse)	chromatin organization [GO:0006325]; regulation of DNA-templated transcription [GO:0006355]		metal ion binding [GO:0046872]	DRLIAEVK	0.98685	-2.5898	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1841.6	0	0	0	0	0	0
A0A3Q2H8Y8	A0A3Q2H8Y8_HORSE	5'-nucleotidase (EC 3.1.3.5) (Ecto-5'-nucleotidase)	NT5E	Equus caballus (Horse)	nucleotide catabolic process [GO:0009166]	side of membrane [GO:0098552]	metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]; XMP 5'-nucleosidase activity [GO:0106411]	RARPGPGSAPPRPPAR	0.70358	0.62284	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1259.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H9R2	A0A3Q2H9R2_HORSE	DUF4629 domain-containing protein		Equus caballus (Horse)				VEEKPMMPKMK	0.98822	-1.8052	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	911.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2H9V5	A0A3Q2H9V5_HORSE	Golgin subfamily A conserved domain-containing protein	GOLGA2	Equus caballus (Horse)		cis-Golgi network [GO:0005801]		LLVLLTKK	0.97952	-0.48283	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	645.24	0	724.56	0	682.25	0	0	0	951.63	0	0	0	0	0	0	993.89	0	733.51	0	0	0	0	0	0	0	868.57	0	0	0	0	0	0	0	0	0	606.27	0	0	0	0	0	0	0	0	0	0	0	0	899.51	0	0	783.21	0	0	0	0
A0A3Q2HA25	A0A3Q2HA25_HORSE	RING-type E3 ubiquitin transferase (EC 2.3.2.27)	MARCHF7	Equus caballus (Horse)	protein autoubiquitination [GO:0051865]	nucleus [GO:0005634]	ubiquitin binding [GO:0043130]; ubiquitin conjugating enzyme binding [GO:0031624]; zinc ion binding [GO:0008270]	QIVFCVHILFPLGSSCIK	0.89589	0.43363	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	560.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HA26	A0A3Q2HA26_HORSE	SURP and G-patch domain containing 2	SUGP2	Equus caballus (Horse)	mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	nucleus [GO:0005634]	RNA binding [GO:0003723]	AMLYARAVR	0.98172	-0.54366	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	418.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	584.65	2221.3	0	0	0	0	0	586.53	0	0	0	0	773.56	0	0	0	0	0	0	0	1232.4	0	0	0	0	1304.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HB78	A0A3Q2HB78_HORSE	Non-histone chromosomal protein HMG-17 (High mobility group nucleosome-binding domain-containing protein 2)	HMGN2	Equus caballus (Horse)	chromatin organization [GO:0006325]	chromatin [GO:0000785]; nucleus [GO:0005634]	chromatin binding [GO:0003682]; nucleosomal DNA binding [GO:0031492]	KAEGDAK	0.60915	0.64803	0	483.84	480.98	410.94	0	0	561.11	566.98	518.59	0	615.39	593.48	529.87	607.18	663.08	0	0	0	396.65	602.36	527.87	510.19	425.63	454.81	469.24	432.81	489.62	0	0	0	0	0	0	0	0	0	0	0	680.47	0	0	0	0	435.03	470.41	0	0	0	466.52	534.71	583.78	669.06	746.41	656.99	601.52	0	707.12	0	0	0	598.57	715.73	0	664.63	681.05	556.95	665.05	0	0	768.63	756.41	642.91	517.12	651.22	613.33
A0A3Q2HB99	A0A3Q2HB99_HORSE	Regulator of G-protein signaling 8	RGS8	Equus caballus (Horse)				AALLMPRR	0.98227	-0.63783	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4245.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HBN9	A0A3Q2HBN9_HORSE	Nuclear receptor subfamily 1 group I member 3 (Constitutive androstane receptor)	NR1I3	Equus caballus (Horse)		nucleus [GO:0005634]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	VGAWRLHGK	0.99083	-1.2353	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	513.48	0	0	0	0	0	0	0	0
A0A3Q2HBS5	A0A3Q2HBS5_HORSE	Structural maintenance of chromosomes flexible hinge domain containing 1	SMCHD1	Equus caballus (Horse)	chromosome organization [GO:0051276]; double-strand break repair [GO:0006302]	chromosome [GO:0005694]	ATP binding [GO:0005524]	ESELGDRVLK	0.98588	-2.8923	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	835.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	574.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HBV4	A0A3Q2HBV4_HORSE	"3'(2'),5'-bisphosphate nucleotidase 1 (EC 3.1.3.7) (Bisphosphate 3'-nucleotidase 1)"	BPNT1	Equus caballus (Horse)	phosphatidylinositol phosphate biosynthetic process [GO:0046854]		"3'(2'),5'-bisphosphate nucleotidase activity [GO:0008441]; metal ion binding [GO:0046872]"	LVASAYSIAQK	0.87342	0.45045	0	0	0	0	0	0	0	0	0	449.2	697.72	0	0	0	0	0	961.37	0	0	0	0	0	0	0	0	0	0	0	0	0	635.08	619.76	0	0	0	0	0	0	0	792.12	688.53	625.11	0	0	0	0	0	0	0	0	415.25	0	0	1009.2	0	0	0	0	0	973.76	0	0	0	0	0	0	0	0	0	591.66	0	611.91	0	0	0
A0A3Q2HBZ7	A0A3Q2HBZ7_HORSE	Centrosomal protein 250	CEP250	Equus caballus (Horse)				IQELETQR	0.98424	-1.1661	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	464.53	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HC76	A0A3Q2HC76_HORSE	Lysine demethylase 4D	LOC100067461	Equus caballus (Horse)	chromatin remodeling [GO:0006338]; regulation of gene expression [GO:0010468]	chromatin [GO:0000785]; nucleus [GO:0005634]	histone H3K9 demethylase activity [GO:0032454]	AGVFTQYHKR	0.88743	0.41922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	663.34	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HCF9	A0A3Q2HCF9_HORSE	Uncharacterized protein		Equus caballus (Horse)				RRTPAPTRPR	0.97356	-0.19537	0	0	0	0	0	0	0	0	1256.4	2235.7	2779.4	0	0	0	0	0	0	0	0	1624.9	0	0	0	0	1021	0	0	0	0	0	0	0	2815.7	0	2860.8	2848.8	0	0	0	0	0	1267.5	0	0	0	0	0	0	583.66	0	0	0	0	0	0	0	1031.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	844.79	0	0	0
A0A3Q2HCG6	A0A3Q2HCG6_HORSE	Large ribosomal subunit protein uL15/eL18 domain-containing protein		Equus caballus (Horse)	translation [GO:0006412]	cytosolic large ribosomal subunit [GO:0022625]; rough endoplasmic reticulum [GO:0005791]	RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]	EVYRHLGK	0.98797	-1.2742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	763.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HCI4	A0A3Q2HCI4_HORSE	Spastin (EC 5.6.1.1)	SPAST SPG4	Equus caballus (Horse)	axonogenesis [GO:0007409]; cytokinetic process [GO:0032506]; endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; metabolic process [GO:0008152]; microtubule severing [GO:0051013]; positive regulation of microtubule depolymerization [GO:0031117]; protein hexamerization [GO:0034214]	axon [GO:0030424]; centrosome [GO:0005813]; endoplasmic reticulum [GO:0005783]; endosome [GO:0005768]; membrane [GO:0016020]; microtubule [GO:0005874]; microtubule cytoskeleton [GO:0015630]; midbody [GO:0030496]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; spindle [GO:0005819]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; isomerase activity [GO:0016853]; microtubule binding [GO:0008017]; microtubule severing ATPase activity [GO:0008568]	FSRALMAAKR	0.97924	-0.34892	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1005.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HCM1	A0A3Q2HCM1_HORSE	Oxysterol-binding protein	OSBPL3	Equus caballus (Horse)	lipid transport [GO:0006869]		lipid binding [GO:0008289]	AVHRLFGK	0.98684	-3.1575	0	0	0	0	0	0	0	0	0	779.92	0	0	0	0	0	0	0	0	0	0	3170.9	0	0	0	0	0	594.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3562.9	0	28623	0	0	0	0	0	0	0	0	0	2767.2	1238.9	0	0	0	0	0	10181	0	0	0	0	0	0	0	0	0	2743.9	0	0	1034.7	0
A0A3Q2HCQ2	A0A3Q2HCQ2_HORSE	Filamin A interacting protein 1	FILIP1	Equus caballus (Horse)				DLKAEVQALK	0.98766	-1.9025	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	809.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HCQ6	A0A3Q2HCQ6_HORSE	Sulfotransferase (EC 2.8.2.-)	LOC100061179	Equus caballus (Horse)			sulfotransferase activity [GO:0008146]	DLKEEILDK	0.98876	-1.142	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4366.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HCT5	A0A3Q2HCT5_HORSE	TBC1 domain family member 15	TBC1D15	Equus caballus (Horse)		cytoplasm [GO:0005737]	GTPase activator activity [GO:0005096]	GGLSHALRK	0.96873	0.012357	0	0	0	0	0	0	346.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HCY0	A0A3Q2HCY0_HORSE	Piccolo presynaptic cytomatrix protein	PCLO	Equus caballus (Horse)		cell projection [GO:0042995]; organelle [GO:0043226]; presynaptic active zone [GO:0048786]	metal ion binding [GO:0046872]	SVSSQQPEK	0.96538	0.014843	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	477.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HD49	A0A3Q2HD49_HORSE	Exonuclease 1 (EC 3.1.-.-)	EXO1	Equus caballus (Horse)	DNA recombination [GO:0006310]; mismatch repair [GO:0006298]	nucleus [GO:0005634]	5'-3' DNA exonuclease activity [GO:0035312]; 5'-flap endonuclease activity [GO:0017108]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]	DASEPTHVRK	0.98744	-1.104	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	725.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HDF4	A0A3Q2HDF4_HORSE	"ADP/ATP translocase (ADP,ATP carrier protein)"	SLC25A5 SLC25A43	Equus caballus (Horse)		membrane [GO:0016020]; mitochondrion [GO:0005739]	ATP:ADP antiporter activity [GO:0005471]	EQGVLSFWR	0.9702	0.029689	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	837.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	806.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HDF8	A0A3Q2HDF8_HORSE	Contactin-1	CNTN1	Equus caballus (Horse)		side of membrane [GO:0098552]		ILIWEDGSLEINNITR	0.87619	0.45053	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3193.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HDM4	A0A3Q2HDM4_HORSE	Mitotic spindle organizing protein 2B	LOC100629189	Equus caballus (Horse)		centrosome [GO:0005813]; cytoplasm [GO:0005737]; spindle [GO:0005819]		LNVVPLAVFQMLK	0.86042	0.47299	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1716.1	0	0	0	0	0	0	0	1393.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HDQ6	A0A3Q2HDQ6_HORSE	Senataxin	SETX	Equus caballus (Horse)	termination of RNA polymerase II transcription [GO:0006369]	nuclear body [GO:0016604]	helicase activity [GO:0004386]; RNA binding [GO:0003723]; transcription termination site sequence-specific DNA binding [GO:0001147]	SVKENSLHK	0.98368	-1.2904	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7592.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HDR3	A0A3Q2HDR3_HORSE	Tetratricopeptide repeat protein 39B	TTC39B	Equus caballus (Horse)	cholesterol homeostasis [GO:0042632]; negative regulation of cholesterol storage [GO:0010887]; regulation of cholesterol efflux [GO:0010874]; regulation of cholesterol metabolic process [GO:0090181]			LGFVRSSR	0.98811	-1.774	0	0	0	0	0	0	0	1020.3	0	0	1548.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2002.8	0	0	0	3044.9	0	0	0	0	0	0	0	0	0	0	0	1040.2	0	1087.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	782.66	609.17	0	0	0	0	0	0	0
A0A3Q2HE52	A0A3Q2HE52_HORSE	Ring finger protein 150	RNF150	Equus caballus (Horse)		membrane [GO:0016020]	metal ion binding [GO:0046872]	AMSLIQACR	0.96078	-0.012879	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1171.8	0	0	0	0	577.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HE69	A0A3Q2HE69_HORSE	SH3 domain and tetratricopeptide repeats 2	SH3TC2	Equus caballus (Horse)	regulation of ERBB signaling pathway [GO:1901184]; regulation of intracellular protein transport [GO:0033157]			ALCLILSK	0.98465	-0.22569	0	0	0	0	0	0	0	0	0	0	2369	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1106.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HED2	A0A3Q2HED2_HORSE	Epithelial cell transforming 2 like	ECT2L	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]	KQLSPLFK	0.98863	-1.0957	0	11718	0	14972	0	0	0	0	0	20555	0	0	0	0	0	0	0	105850	0	0	16068	12292	0	0	0	0	10648	0	0	0	0	73632	0	691.12	0	0	0	43863	0	0	0	116600	3003.5	15260	14656	0	0	0	0	0	0	0	0	14522	0	0	0	0	0	0	0	0	1456.7	0	8721.3	0	16828	0	16153	0	870.19	0	0	0	8847.7
A0A3Q2HEE8	A0A3Q2HEE8_HORSE	N-acetyltransferase domain-containing protein	LOC100072329 LOC111772180 SATL1	Equus caballus (Horse)	spermidine acetylation [GO:0032918]		diamine N-acetyltransferase activity [GO:0004145]; spermidine binding [GO:0019809]	GALDLSSEEGWHLFR	0.79835	0.49955	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	581.32	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1164.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HEF1	A0A3Q2HEF1_HORSE	Transmembrane protein 59 like	TMEM59L	Equus caballus (Horse)		Golgi membrane [GO:0000139]		LKLDLTKL	0.96708	-0.099188	584.6	758.08	729.46	0	877.97	0	0	0	852.24	0	878.97	0	0	812.37	973.29	0	0	0	0	853.66	885.39	0	0	0	935.12	0	0	0	1296.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	859	882.17	0	0	0	0	0	0	0	1002.9	0	0	776.17	0	588.78	0	1097.9	0	0	0	882.4	0	0	0
A0A3Q2HEL0	A0A3Q2HEL0_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	NEK11	Equus caballus (Horse)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	GHLMRTEGK	0.97248	-0.1822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	629.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HEL9	A0A3Q2HEL9_HORSE	Leucine-rich repeat flightless-interacting protein 2	LRRFIP2	Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]			DIYDLKDQIQDVEGRYMQGLK	0.91817	0.30358	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	555.38	0	0	0	0	0	0	0	0	0	0	0	0	0	0	790.37	0	0	0	0	0	0
A0A3Q2HEM2	A0A3Q2HEM2_HORSE	ADAM metallopeptidase domain 19	ADAM19	Equus caballus (Horse)	proteolysis [GO:0006508]	membrane [GO:0016020]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	ALPANPVPGRK	0.98098	-0.55999	0	0	0	0	0	0	0	0	0	0	0	0	0	1204.1	0	0	3125.9	0	0	0	0	1747.5	0	1727.2	0	0	0	0	0	0	3067.1	0	3072.8	0	0	3039	0	0	0	0	0	0	0	1068.8	0	0	0	0	0	0	0	0	0	1843.4	0	0	0	0	0	0	0	1279.2	0	0	0	0	0	0	0	0	0	0	0	1723.5	1724.4
A0A3Q2HFE5	A0A3Q2HFE5_HORSE	Desmoglein 1	DSG1	Equus caballus (Horse)	homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	desmosome [GO:0030057]; plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]	ALNSMGQDLERPLELR	0	4.8194	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	701.35	711.37	531.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HFQ6	A0A3Q2HFQ6_HORSE	Mothers against decapentaplegic homolog (MAD homolog) (Mothers against DPP homolog) (SMAD family member)	SMAD6	Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]; transforming growth factor beta receptor signaling pathway [GO:0007179]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	metal ion binding [GO:0046872]	GAQGAGR	0.95501	0.22221	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	245.66	0	0	0	0	0	0	0	0	394.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	354.76	0	0	0	0	0	0	0	0	318.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HG78	A0A3Q2HG78_HORSE	Transforming growth factor beta receptor 3 like	TGFBR3L	Equus caballus (Horse)	cell migration [GO:0016477]; epithelial to mesenchymal transition [GO:0001837]; regulation of transforming growth factor beta receptor signaling pathway [GO:0017015]; transforming growth factor beta receptor signaling pathway [GO:0007179]	membrane [GO:0016020]	glycosaminoglycan binding [GO:0005539]; transforming growth factor beta receptor activity [GO:0005024]; type II transforming growth factor beta receptor binding [GO:0005114]	GGPLEVPANSR	0.9698	0.17496	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1912.6	1794	0	0	0	0	0	0	0	0	0	0	339.41	731.33	392.11	0	429.25	417.71	789.67	903.21	827.31	0	601.6	0	565.76	540.59	655.98	0	0	0	0	1186.6	1095.8	0	0	0	0	0	0	0	0	0	0	0	413.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HGF6	A0A3Q2HGF6_HORSE	Terminal nucleotidyltransferase 4B	TENT4B	Equus caballus (Horse)		cytosol [GO:0005829]; nucleolus [GO:0005730]; plasma membrane [GO:0005886]	poly(A) RNA polymerase activity [GO:1990817]	IIRVTDEVATYR	0.98883	-1.8974	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	321.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HH91	A0A3Q2HH91_HORSE	NPC intracellular cholesterol transporter 1	NPC1	Equus caballus (Horse)	adult walking behavior [GO:0007628]; cellular response to low-density lipoprotein particle stimulus [GO:0071404]; cellular response to steroid hormone stimulus [GO:0071383]; cholesterol efflux [GO:0033344]; cholesterol homeostasis [GO:0042632]; cholesterol storage [GO:0010878]; cyclodextrin metabolic process [GO:2000900]; endocytosis [GO:0006897]; establishment of protein localization to membrane [GO:0090150]; gene expression [GO:0010467]; intestinal cholesterol absorption [GO:0030299]; intracellular cholesterol transport [GO:0032367]; liver development [GO:0001889]; macroautophagy [GO:0016236]; membrane raft organization [GO:0031579]; negative regulation of macroautophagy [GO:0016242]; negative regulation of TORC1 signaling [GO:1904262]; neurogenesis [GO:0022008]; programmed cell death [GO:0012501]; protein glycosylation [GO:0006486]; response to xenobiotic stimulus [GO:0009410]; sterol metabolic process [GO:0016125]; viral entry into host cell [GO:0046718]	endoplasmic reticulum [GO:0005783]; endosome [GO:0005768]; extracellular region [GO:0005576]; Golgi apparatus [GO:0005794]; lysosomal membrane [GO:0005765]; membrane raft [GO:0045121]; nuclear envelope [GO:0005635]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]	cholesterol binding [GO:0015485]; lipid transporter activity [GO:0005319]	VPAGHRAR	0.99045	-1.6689	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	759.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HHB0	A0A3Q2HHB0_HORSE	Inter-alpha-trypsin inhibitor heavy chain 5	ITIH5	Equus caballus (Horse)	hyaluronan metabolic process [GO:0030212]	extracellular region [GO:0005576]	serine-type endopeptidase inhibitor activity [GO:0004867]	SYLEITPSR	0.96828	-0.097568	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	580.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HHC9	A0A3Q2HHC9_HORSE	Transmembrane protein 165	TMEM165	Equus caballus (Horse)		membrane [GO:0016020]		TSTCPRTSR	0.98843	-1.5816	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1014.4	966.24	0	0	0	0	948.66	0	0	0	0	0	1248	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1183.7	0	1244.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HHS3	A0A3Q2HHS3_HORSE	Insulin like growth factor binding protein like 1	IGFBPL1	Equus caballus (Horse)	cellular response to tumor cell [GO:0071228]; regulation of cell growth [GO:0001558]	extracellular space [GO:0005615]	insulin-like growth factor binding [GO:0005520]	AVPAPVITWRK	0.98572	-0.8518	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	923.37	0	994.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	474.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HIG2	A0A3Q2HIG2_HORSE	DNA-dependent protein kinase catalytic subunit (EC 2.7.11.1)	PRKDC	Equus caballus (Horse)	double-strand break repair [GO:0006302]; double-strand break repair via nonhomologous end joining [GO:0006303]; immunoglobulin V(D)J recombination [GO:0033152]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; phosphorylation [GO:0016310]; regulation of macromolecule metabolic process [GO:0060255]; regulation of nitrogen compound metabolic process [GO:0051171]; regulation of primary metabolic process [GO:0080090]; telomere maintenance [GO:0000723]	nucleolus [GO:0005730]; nucleus [GO:0005634]	ATP binding [GO:0005524]; DNA-dependent protein kinase activity [GO:0004677]; protein serine/threonine kinase activity [GO:0004674]	SCKFSMK	0.98781	-4.9201	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	503.47	0	0	0	0	586.97	0	0	0	591.56	0	0	0	0	1105.7	0	0	0	0	0	0	0	0	1276.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HII6	A0A3Q2HII6_HORSE	Thiopurine S-methyltransferase (EC 2.1.1.67) (Thiopurine methyltransferase)	TPMT	Equus caballus (Horse)	methylation [GO:0032259]; xenobiotic metabolic process [GO:0006805]		S-adenosyl-L-methionine binding [GO:1904047]; thiopurine S-methyltransferase activity [GO:0008119]	LLPPALK	0.96729	0.21339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	770230	0	0	0	351.11	0	0	360.27	0	817200	0	477.08	0	0	0	0	0	391.78	0	0	0	0	1485	5705.1	0	0	0	0	0	0	897120	7271.1	967700	10607	894.8	0	9976.1	0	1489.2	0	0	0	0	5596.1	0	0	874120	0	0	0	0	835430
A0A3Q2HIJ3	A0A3Q2HIJ3_HORSE	DUF4515 domain-containing protein	CCDC121	Equus caballus (Horse)				FKEKAVVEMMK	0.97145	0.043607	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	937.64	0	0	0	0
A0A3Q2HIP9	A0A3Q2HIP9_HORSE	Uncharacterized protein	LOC102148513	Equus caballus (Horse)		acrosomal vesicle [GO:0001669]		ISLLAGTHKKHQVK	0.89744	0.32837	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1474.3	0
A0A3Q2HIU2	A0A3Q2HIU2_HORSE	Golgin B1	GOLGB1	Equus caballus (Horse)		cis-Golgi network [GO:0005801]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; membrane [GO:0016020]		AQLQEYQDK	0.98367	-0.80564	0	0	0	0	0	0	0	0	0	0	458.21	0	0	0	0	2187.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	880.61	0	0	0	0	0	944.6	0	0	0	0	0	1310.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HIX3	A0A3Q2HIX3_HORSE	MAGE domain-containing protein	MAGEB5	Equus caballus (Horse)	negative regulation of transcription by RNA polymerase II [GO:0000122]	nucleus [GO:0005634]		SYDLVSK	0.98916	-1.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1543.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HIX6	A0A3Q2HIX6_HORSE	Maestro heat like repeat family member 9	MROH9	Equus caballus (Horse)				LDKVTYSSLCTR	0.93754	0.24709	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	945.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HIY7	A0A3Q2HIY7_HORSE	Phosphorylated adapter RNA export protein (RNA U small nuclear RNA export adapter protein)	PHAX	Equus caballus (Horse)	protein transport [GO:0015031]; snRNA export from nucleus [GO:0006408]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	RNA binding [GO:0003723]	EYENKKAAR	0.9757	0.1073	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	301.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HJ25	A0A3Q2HJ25_HORSE	Centrosomal protein 128	CEP128	Equus caballus (Horse)				QDQLGLISLQLQEALK	0.98087	-0.2587	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	542.47	0	0	3385.1	2187.9	1960.4	429.87	0	0	785.95	542.25	579.78	690.21	460.43	0	0	0	0	395.42	0	0	0	0	0	324.53	443.17	0	1314.4	699.94	763.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HJ75	A0A3Q2HJ75_HORSE	"5'-nucleotidase, cytosolic II"	NT5C2	Equus caballus (Horse)	adenosine metabolic process [GO:0046085]; allantoin metabolic process [GO:0000255]; dGMP metabolic process [GO:0046054]; GMP metabolic process [GO:0046037]; IMP catabolic process [GO:0006204]; IMP metabolic process [GO:0046040]; negative regulation of defense response to virus by host [GO:0050689]; protein K48-linked ubiquitination [GO:0070936]	cytosol [GO:0005829]	5'-nucleotidase activity [GO:0008253]; ATP binding [GO:0005524]; identical protein binding [GO:0042802]; IMP 5'-nucleotidase activity [GO:0050483]; metal ion binding [GO:0046872]; nucleoside phosphotransferase activity [GO:0050146]; ubiquitin protein ligase activity [GO:0061630]	LPQTHQR	0.98728	-1.5245	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11710	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	782.23	0	0	0	0	0	0	0	0	0	0	1383.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HJF1	A0A3Q2HJF1_HORSE	G protein-coupled receptor 176	GPR176	Equus caballus (Horse)	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway [GO:0007193]; circadian behavior [GO:0048512]; G protein-coupled receptor signaling pathway [GO:0007186]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	TTVFKSVTNR	0.92998	0.26354	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	516.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HJG5	A0A3Q2HJG5_HORSE	TBC1 domain family member 32	TBC1D32	Equus caballus (Horse)	determination of left/right symmetry [GO:0007368]; embryonic digit morphogenesis [GO:0042733]; heart development [GO:0007507]; kidney development [GO:0001822]; lens development in camera-type eye [GO:0002088]; non-motile cilium assembly [GO:1905515]; protein localization to cilium [GO:0061512]; retinal pigment epithelium development [GO:0003406]; roof of mouth development [GO:0060021]; smoothened signaling pathway involved in dorsal/ventral neural tube patterning [GO:0060831]			LQLILDQLDPGQPK	0.76298	0.52351	0	0	0	0	0	0	474.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HJJ7	A0A3Q2HJJ7_HORSE	F-box and leucine rich repeat protein 17	FBXL17	Equus caballus (Horse)				SLSYSLSV	0.96258	-0.0092939	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2298.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HJM3	A0A3Q2HJM3_HORSE	C-type lectin domain-containing protein		Equus caballus (Horse)	positive regulation of natural killer cell mediated cytotoxicity [GO:0045954]; stimulatory C-type lectin receptor signaling pathway [GO:0002223]	external side of plasma membrane [GO:0009897]	transmembrane signaling receptor activity [GO:0004888]	LNSHLLK	0.97245	-0.19188	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27722	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HJR2	A0A3Q2HJR2_HORSE	Synaptotagmin like 2	SYTL2	Equus caballus (Horse)	intracellular protein transport [GO:0006886]		small GTPase binding [GO:0031267]	SAVSPAK	0.98816	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4573.7	0	0	0	0	1159.9	0	1367.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HJU8	A0A3Q2HJU8_HORSE	long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)	ACSBG2	Equus caballus (Horse)				VFSWARATGLK	0.99046	-1.2546	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	620.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HK21	A0A3Q2HK21_HORSE	Fanconi-associated nuclease (EC 3.1.4.1)	FAN1	Equus caballus (Horse)	interstrand cross-link repair [GO:0036297]	nucleus [GO:0005634]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]; phosphodiesterase I activity [GO:0004528]	DQILENSSQK	0.89254	0.43811	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7867.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	857.68	0	771.23	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HK79	A0A3Q2HK79_HORSE	Histone-lysine N-methyltransferase (EC 2.1.1.355)	SUV39H1	Equus caballus (Horse)	methylation [GO:0032259]; rhythmic process [GO:0048511]	"chromosome, centromeric region [GO:0000775]; nucleus [GO:0005634]"	histone H3K9 trimethyltransferase activity [GO:0140949]; zinc ion binding [GO:0008270]	LSCPALGISK	0.9696	0.15009	0	0	0	0	512.89	0	0	0	0	10726	0	0	0	0	0	0	0	0	0	25862	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HKC2	A0A3Q2HKC2_HORSE	Calcium voltage-gated channel auxiliary subunit alpha2delta 3	CACNA2D3	Equus caballus (Horse)				DDVLRNAMVNR	0.98897	-1.6947	0	0	0	0	0	0	0	0	0	444.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	274.01	0	0	0	0	0	0	0	384.88	0	0	0	0	0	590.53	0	0	0	0	0	0	0	0	0	0	0	0	0	445.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	881.23	0	0	0
A0A3Q2HKH6	A0A3Q2HKH6_HORSE	protein-tyrosine-phosphatase (EC 3.1.3.48)	PTPRT	Equus caballus (Horse)	dephosphorylation [GO:0016311]	membrane [GO:0016020]	protein tyrosine phosphatase activity [GO:0004725]	LRLLLSNPEGR	0.98694	-1.9184	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1465.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HKK9	A0A3Q2HKK9_HORSE	Spectrin repeat containing nuclear envelope protein 2	SYNE2	Equus caballus (Horse)		membrane [GO:0016020]	actin binding [GO:0003779]	APGTGDK	0.98465	-0.69608	0	0	0	0	0	0	0	0	0	0	0	0	0	627.81	611.82	0	0	0	0	0	0	0	0	0	348.75	0	0	0	0	0	0	0	821.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	320.6	0	0	0	0	0	0	0	0	0	0	416.2	0	0	0	365.46	455.96	0	0	0	267.4	0	0	0
A0A3Q2HL49	A0A3Q2HL49_HORSE	Differentially expressed in FDCP 8 homolog	DEF8	Equus caballus (Horse)				SLRAAGGSSGRR	0.97298	-0.18345	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	421.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HL58	A0A3Q2HL58_HORSE	Dipeptidyl peptidase 4 (EC 3.4.14.5) (Dipeptidyl peptidase IV) (T-cell activation antigen CD26)	DPP4	Equus caballus (Horse)	cell adhesion [GO:0007155]; proteolysis [GO:0006508]	anchoring junction [GO:0070161]; lamellipodium membrane [GO:0031258]; plasma membrane [GO:0005886]	dipeptidyl-peptidase activity [GO:0008239]; serine-type endopeptidase activity [GO:0004252]	VGTSLEK	0.96199	-0.0047388	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	365.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HLI7	A0A3Q2HLI7_HORSE	Highly divergent homeobox	HDX	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	EVFSLAVSDYPQR	0.99278	-1.2401	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	521.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HLJ9	A0A3Q2HLJ9_HORSE	DUF4549 domain-containing protein	LOC102147786	Equus caballus (Horse)				LTELKSEIEEK	0.96649	-0.16603	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1286.7	0	0	0	757.47	0	0	0	1040.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HLQ3	A0A3Q2HLQ3_HORSE	Testis specific 10 interacting protein	TSGA10IP	Equus caballus (Horse)	cilium organization [GO:0044782]	photoreceptor connecting cilium [GO:0032391]		GPGASQR	0.96891	0.15798	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3503.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	416.88	0	0	0	0	0	659.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HM04	A0A3Q2HM04_HORSE	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase (EC 2.4.1.135)	B3GAT1	Equus caballus (Horse)	protein glycosylation [GO:0006486]	Golgi membrane [GO:0000139]	galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity [GO:0015018]; metal ion binding [GO:0046872]	IPRGTMQRNLALR	0.045455	1.8837	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1478.6	1218.7	0	788.05	585.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1121.2	1036.5	0	888.33	2383.9	0	0	0	0	772.25	0	0	0	1233.3	1120.3	1028.4	0	0	0	0	0	0
A0A3Q2HM47	A0A3Q2HM47_HORSE	Diacylglycerol kinase (DAG kinase) (EC 2.7.1.107)	DGKG	Equus caballus (Horse)	diacylglycerol metabolic process [GO:0046339]; intracellular signal transduction [GO:0035556]; lipid phosphorylation [GO:0046834]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]	plasma membrane [GO:0005886]	ATP binding [GO:0005524]; ATP-dependent diacylglycerol kinase activity [GO:0004143]; calcium ion binding [GO:0005509]	ITEKQVPAK	0.9862	-1.9869	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	613.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	998.48	0	0	0	0	0	748.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HMD7	A0A3Q2HMD7_HORSE	Ubiquinol-cytochrome c reductase core protein 2	UQCRC2	Equus caballus (Horse)	proteolysis [GO:0006508]		metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	LLFYSLK	0.92987	0.28079	0	0	0	0	1172.7	0	464.44	581.54	0	0	0	0	0	0	0	0	0	1929.4	0	0	0	0	0	0	945.22	0	0	0	0	0	0	722.2	0	1462.4	0	996.48	0	0	0	0	1032.7	1175.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2200.2	0	0	634.17	0	1413.5	0	0	0	0	0	0	0	0	628.27	0	0
A0A3Q2HMJ7	A0A3Q2HMJ7_HORSE	SLAM family member 8	SLAMF8	Equus caballus (Horse)	leukocyte chemotaxis involved in inflammatory response [GO:0002232]; regulation of B cell differentiation [GO:0045577]	membrane [GO:0016020]	signaling receptor activity [GO:0038023]	LSPPVVTR	0.98978	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	740.89	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HMK7	A0A3Q2HMK7_HORSE	HECT and RLD domain containing E3 ubiquitin protein ligase family member 6	HERC6	Equus caballus (Horse)		cytosol [GO:0005829]; nucleoplasm [GO:0005654]	ubiquitin-protein transferase activity [GO:0004842]	GINFTPKKIK	0.96139	-0.14865	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	443.03	0	0	0	0	0	0
A0A3Q2HMM3	A0A3Q2HMM3_HORSE	KIAA1755	KIAA1755	Equus caballus (Horse)				GLAVVIDAR	0.96785	-0.052106	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	957.61	0	0	0	0	0	0	0	0	0	0	0	0	0	1214	0	0	0	0	0	0	0	0	0	0	0	0	0	0	896.52	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HMS7	A0A3Q2HMS7_HORSE	Leucine rich repeats and guanylate kinase domain containing	LRGUK	Equus caballus (Horse)				QSFPRENWTLQHR	0.99015	-1.6377	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	649.57	0	0	0	0	332.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HN99	A0A3Q2HN99_HORSE	Dystrophin	DMD	Equus caballus (Horse)		cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; plasma membrane bounded cell projection [GO:0120025]; postsynaptic membrane [GO:0045211]	actin binding [GO:0003779]; zinc ion binding [GO:0008270]	EIDRELQK	0.98645	-3.1162	0	0	0	0	0	0	907.46	0	0	0	0	0	0	0	0	1325	0	0	0	0	0	0	0	0	0	0	0	8685.1	7953.2	7735.8	8946	10002	8062.2	8094.6	7030.1	0	0	0	0	0	938.93	0	0	0	0	0	380.92	1303.4	0	0	0	0	0	0	0	0	0	1827.2	1668.1	0	0	0	0	0	0	0	0	0	0	0	0	838.82	0	0	0
A0A3Q2HNG7	A0A3Q2HNG7_HORSE	STAM binding protein like 1	STAMBPL1	Equus caballus (Horse)			K63-linked deubiquitinase activity [GO:0061578]; metal-dependent deubiquitinase activity [GO:0140492]	AEILKKLEHQR	0.84109	0.48871	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3116.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HNN3	A0A3Q2HNN3_HORSE	Interferon induced transmembrane protein 1	LOC100050560	Equus caballus (Horse)	defense response to virus [GO:0051607]; negative regulation of viral entry into host cell [GO:0046597]; negative regulation of viral genome replication [GO:0045071]; response to interferon-alpha [GO:0035455]; response to interferon-beta [GO:0035456]; response to type II interferon [GO:0034341]; type I interferon-mediated signaling pathway [GO:0060337]	plasma membrane [GO:0005886]		GLLPWCASEPPMR	0.96581	-0.10655	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	540.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HNT6	A0A3Q2HNT6_HORSE	B cell scaffold protein with ankyrin repeats 1	BANK1	Equus caballus (Horse)	signal transduction [GO:0007165]			IFEDFSQNLYR	0.96431	-0.12281	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	700.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HNU8	A0A3Q2HNU8_HORSE	Serpin family A member 5	SERPINA5	Equus caballus (Horse)		extracellular space [GO:0005615]	serine-type endopeptidase inhibitor activity [GO:0004867]	HAQLHLR	0.98997	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	989.03	0	0	0	592.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HNZ1	A0A3Q2HNZ1_HORSE	Putative glycerol kinase 5 (EC 2.7.1.30) (ATP:glycerol 3-phosphotransferase 5)	GK5	Equus caballus (Horse)	glycerol catabolic process [GO:0019563]; phosphorylation [GO:0016310]		glycerol kinase activity [GO:0004370]	EIHIPVR	0.86735	0.46284	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1297.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	395.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HP60	A0A3Q2HP60_HORSE	SHH signaling and ciliosis regulator SDCCAG8	SDCCAG8	Equus caballus (Horse)	centrosome cycle [GO:0007098]; establishment of cell polarity [GO:0030010]; microtubule organizing center organization [GO:0031023]; neuron migration [GO:0001764]; tube formation [GO:0035148]	centriole [GO:0005814]; centrosome [GO:0005813]		SRLKQLDK	0.96686	-0.10056	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1874.7	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HP91	A0A3Q2HP91_HORSE	L antigen family member 3		Equus caballus (Horse)	tRNA threonylcarbamoyladenosine metabolic process [GO:0070525]	EKC/KEOPS complex [GO:0000408]		ALLGGASR	0.985	-1.4894	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1085.7	0	0	0	0	0	0	0	724.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HPV1	A0A3Q2HPV1_HORSE	Solute carrier family 41 member	SLC41A2	Equus caballus (Horse)	magnesium ion transport [GO:0015693]	membrane [GO:0016020]	inorganic cation transmembrane transporter activity [GO:0022890]; monoatomic cation transmembrane transporter activity [GO:0008324]	SRHLPLLF	0.98917	-1.2103	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	338.29	0	0	0	0	0	0	0
A0A3Q2HQ15	A0A3Q2HQ15_HORSE	Taste receptor type 1 member 2 (Sweet taste receptor T1R2)	LOC111771737	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	QRLVVIVQK	0.98837	-1.8759	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	429.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HQ16	A0A3Q2HQ16_HORSE	"Lactosylceramide alpha-2,3-sialyltransferase (EC 2.4.3.9) (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase) (Ganglioside GM3 synthase) (ST3Gal V) (Sialyltransferase 9)"	LOC111771968 LOC111771995	Equus caballus (Horse)	protein glycosylation [GO:0006486]	Golgi apparatus [GO:0005794]; membrane [GO:0016020]	sialyltransferase activity [GO:0008373]	KMPYVDPDRVK	0.96989	-0.178	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1130.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HQD8	A0A3Q2HQD8_HORSE	WD repeat-containing protein 18	WDR18	Equus caballus (Horse)	rRNA processing [GO:0006364]	dynein axonemal particle [GO:0120293]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]		VATASLDQTVK	0.96782	-0.052054	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	631.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	848.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HQL5	A0A3Q2HQL5_HORSE	Cdk5 and Abl enzyme substrate 2	CABLES2	Equus caballus (Horse)	regulation of cell cycle [GO:0051726]			EAPAAAAAR	0.96673	-0.082671	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2728.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HQX0	A0A3Q2HQX0_HORSE	Synaptoporin	SYNPR	Equus caballus (Horse)		membrane [GO:0016020]; synaptic vesicle [GO:0008021]		EPVGRKGER	0.96684	-0.038977	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	470.6	0	0	0	0	0	0	0	0	0	0	0	0	0	3479.5	3685	0	743.61	735.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HR00	A0A3Q2HR00_HORSE	Upstream stimulatory factor 1	USF1	Equus caballus (Horse)	cellular response to insulin stimulus [GO:0032869]; late viral transcription [GO:0019086]; positive regulation of transcription from RNA polymerase II promoter by glucose [GO:0000432]; response to hypoxia [GO:0001666]	chromatin [GO:0000785]; Golgi apparatus [GO:0005794]; nucleoplasm [GO:0005654]; transcription regulator complex [GO:0005667]	"bHLH transcription factor binding [GO:0043425]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; histone deacetylase binding [GO:0042826]; protein heterodimerization activity [GO:0046982]; protein homodimerization activity [GO:0042803]; protein kinase binding [GO:0019901]; protein-containing complex binding [GO:0044877]; sequence-specific double-stranded DNA binding [GO:1990837]"	KSEAPRTTR	0.96414	-0.13207	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	133360	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HR55	A0A3Q2HR55_HORSE	Poly [ADP-ribose] polymerase (PARP) (EC 2.4.2.-)	PARP2	Equus caballus (Horse)	DNA repair [GO:0006281]	nucleus [GO:0005634]	NAD+ ADP-ribosyltransferase activity [GO:0003950]; nucleotidyltransferase activity [GO:0016779]	EGEKEAFREDLHNR	0.97341	0.1452	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2521.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	947.78	0	0	0	0	0	0	0	0	0	0	0	0	0	937.11
A0A3Q2HR96	A0A3Q2HR96_HORSE	"Solute carrier family 25 member 3 (Phosphate carrier protein, mitochondrial) (Phosphate transport protein)"	SLC25A3	Equus caballus (Horse)		mitochondrial inner membrane [GO:0005743]	DNA binding [GO:0003677]; symporter activity [GO:0015293]	FSSVAHLAR	0.96647	-0.082671	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1664.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HRH1	A0A3Q2HRH1_HORSE	RB1 inducible coiled-coil 1	RB1CC1	Equus caballus (Horse)	autophagosome assembly [GO:0000045]; autophagy of mitochondrion [GO:0000422]			DQCISELISR	0.96767	-0.15821	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	661.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	958.33	0	0	0	0	0	0	0	0	0	0	0	0	2973.2	0	0	0	0	3174.7	0	0	0	2934	0
A0A3Q2HRL7	A0A3Q2HRL7_HORSE	Coiled-coil domain containing 60	CCDC60	Equus caballus (Horse)				ITKDKSMGQR	0.98053	-0.50648	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2330.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HS80	A0A3Q2HS80_HORSE	Death inducer-obliterator 1	DIDO1	Equus caballus (Horse)	apoptotic signaling pathway [GO:0097190]; DNA-templated transcription [GO:0006351]		metal ion binding [GO:0046872]	AANPSGK	0.98167	-0.62393	0	0	0	0	0	0	0	0	0	0	584.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	397.9	0	0	0	0	0	0	0	0	0	0	585.95	0	0	0	0	0	473.47	633.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	462.84	0	0	0	0	0	0	0	0	0
A0A3Q2HSF0	A0A3Q2HSF0_HORSE	Endothelin converting enzyme like 1	ECEL1	Equus caballus (Horse)	protein processing [GO:0016485]	plasma membrane [GO:0005886]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	LAYYAYQK	0.87889	0.38908	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	591.13	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2686.5	0	0	0	0	0	0	0	709.11	675.94	0	1613.6	0	0	0	0	0	0	0	0	0	0	0	0	0	1315.1	1724.9	1505.6	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HSL5	A0A3Q2HSL5_HORSE	Sushi domain-containing protein	CD55	Equus caballus (Horse)				GAVIIASGKFGSPAVK	0.92133	0.29028	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	882.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HT47	A0A3Q2HT47_HORSE	CAP-Gly domain containing linker protein 1	CLIP1	Equus caballus (Horse)		cytoskeleton [GO:0005856]		NLLAEKREMILK	0.90878	0.29973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	706.81	0	0	763.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HTC9	A0A3Q2HTC9_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)	retrotransposition [GO:0032197]	ribonucleoprotein complex [GO:1990904]	single-stranded RNA binding [GO:0003727]	ISNLEDGNIK	0.86942	0.45805	0	0	0	0	0	0	0	0	0	0	0	0	854.21	0	0	0	0	2225.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2640.5	0	1989.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HU03	A0A3Q2HU03_HORSE	Dachsous cadherin-related 1	DCHS1	Equus caballus (Horse)	homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]	DGGSPPR	0.98606	-2.5345	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	452.52	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	682.91	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HUF3	A0A3Q2HUF3_HORSE	Zinc finger CCCH-type containing 4	ZC3H4	Equus caballus (Horse)	negative regulation of DNA-templated transcription [GO:0045892]		metal ion binding [GO:0046872]; RNA binding [GO:0003723]	QQEEEERAR	0.97447	0.055403	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	252.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HUP2	A0A3Q2HUP2_HORSE	Coiled-coil domain containing 88B	CCDC88B	Equus caballus (Horse)	cytoskeleton-dependent intracellular transport [GO:0030705]			LQAEKSVLEVQGQELHR	0.98598	-1.4163	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	525.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HUS3	A0A3Q2HUS3_HORSE	Transforming growth factor beta	LOC111771316	Equus caballus (Horse)	embryo development [GO:0009790]; positive regulation of cell division [GO:0051781]; response to chemical [GO:0042221]; tissue development [GO:0009888]	extracellular space [GO:0005615]; membrane [GO:0016020]	growth factor activity [GO:0008083]; transforming growth factor beta receptor binding [GO:0005160]	LESQQSNR	0.99058	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	845.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HUS6	A0A3Q2HUS6_HORSE	RNA-directed DNA polymerase (EC 2.7.7.49)		Equus caballus (Horse)				INIDKMSILSK	0.69304	0.61546	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2313.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1521.8	0	1289.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HUY7	A0A3Q2HUY7_HORSE	Monocarboxylate transporter 1 (Solute carrier family 16 member 1)	SLC16A1	Equus caballus (Horse)		membrane [GO:0016020]	monocarboxylic acid transmembrane transporter activity [GO:0008028]	QFSYMRAR	0.96147	0.23067	0	0	0	0	0	0	376.34	665.13	0	0	330.79	419.13	687.36	747.69	795.44	0	0	0	0	0	414.35	0	0	0	0	0	0	438.73	0	396.5	640.76	638.03	646.71	0	0	0	0	679.75	649.06	648.08	781.38	698.21	375.87	0	0	0	0	0	0	539.34	0	0	0	417.48	0	0	0	913.6	879.34	844.44	0	0	0	0	0	0	0	366.5	389.41	414.41	709.11	726.49	381.21	0	0
A0A3Q2HV15	A0A3Q2HV15_HORSE	Phosphatase and actin regulator	PHACTR1	Equus caballus (Horse)	cell motility [GO:0048870]; stress fiber assembly [GO:0043149]		actin binding [GO:0003779]; protein phosphatase inhibitor activity [GO:0004864]	LTAADKEEER	0.98526	-2.4897	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3561.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	764.75	0	0	0
A0A3Q2HV63	A0A3Q2HV63_HORSE	Oxysterol-binding protein	OSBPL6	Equus caballus (Horse)	lipid transport [GO:0006869]		lipid binding [GO:0008289]	SAFNSIAIEKEKLK	0.74524	0.5376	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1533.4	0	0	0	0	0	541.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HV93	A0A3Q2HV93_HORSE	Coiled-coil domain containing 158	CCDC158	Equus caballus (Horse)				NSASRSFHSSPK	0.97072	0.20424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3087.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HVH4	A0A3Q2HVH4_HORSE	Snf2 related CREBBP activator protein	SRCAP	Equus caballus (Horse)			ATP binding [GO:0005524]; ATP-dependent chromatin remodeler activity [GO:0140658]; DNA binding [GO:0003677]	IAELRKEGFWSLK	0.98506	-1.3004	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1446.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HVU1	A0A3Q2HVU1_HORSE	OBG-type G domain-containing protein		Equus caballus (Horse)	cytoplasmic translation [GO:0002181]	cytoplasm [GO:0005737]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]	ATAHYLGELITPK	0.96385	-0.12404	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	522.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HVW8	A0A3Q2HVW8_HORSE	Dispatched RND transporter family member 1	DISP1	Equus caballus (Horse)		membrane [GO:0016020]		GFEVRPEFK	0.97544	0.074826	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	959.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HW10	A0A3Q2HW10_HORSE	histidine--tRNA ligase (EC 6.1.1.21) (Histidyl-tRNA synthetase)	HARS2	Equus caballus (Horse)	nucleic acid metabolic process [GO:0090304]	cytoplasm [GO:0005737]	histidine-tRNA ligase activity [GO:0004821]	DVRHEMVAK	0.28743	0.85866	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1161	1094.6	0	0	0	0	0	0	0	0	0	0	0	0	0	686.36	0	664.88
A0A3Q2HW47	A0A3Q2HW47_HORSE	HERV-H LTR-associating 2	HHLA2	Equus caballus (Horse)		membrane [GO:0016020]	catalytic activity [GO:0003824]	QDPRYTNR	0.98861	-1.7458	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1294.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HW57	A0A3Q2HW57_HORSE	Smoothelin	SMTN	Equus caballus (Horse)				LGLALEELR	0.89403	0.4092	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	866.13	909.98	1042.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HWC5	A0A3Q2HWC5_HORSE	Pregnancy up-regulated nonubiquitous CaM kinase	PNCK	Equus caballus (Horse)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	IMVSDFGLSK	0.96438	-0.13139	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	413.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HWI6	A0A3Q2HWI6_HORSE	Olfactory receptor	OR8S15	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; odorant binding [GO:0005549]; olfactory receptor activity [GO:0004984]	AALRRTVLK	0.89911	0.43612	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	522.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	661.21	0	0	0	0	0	0	0
A0A3Q2HWL7	A0A3Q2HWL7_HORSE	Transcription factor AP-2-alpha (AP-2 transcription factor) (Activating enhancer-binding protein 2-alpha) (Activator protein 2)	TFAP2A	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	GAGGNVR	0.98393	-0.70524	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	679.62	0	0	0	387.32	0	0	681.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	335.48	0	0	0	0	0	0	0	0	0	321.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HWN6	A0A3Q2HWN6_HORSE	Chromobox 2	CBX2	Equus caballus (Horse)		PRC1 complex [GO:0035102]		DPGAPSK	0.95383	0.23188	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	469.77	0	0	0	0	374.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HWQ6	A0A3Q2HWQ6_HORSE	Complement C3	C3	Equus caballus (Horse)	"complement activation [GO:0006956]; complement activation, alternative pathway [GO:0006957]; complement activation, classical pathway [GO:0006958]; inflammatory response [GO:0006954]"	extracellular space [GO:0005615]	endopeptidase inhibitor activity [GO:0004866]	ACEPGVDYVYK	0	23.529	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2316.6	1846.6	3911.8	0	0	0	0	0	0	0	0	0	538.17	0	0	0	373.79	0	0	0	0	0	0	0	450.73	0	437.37	0	0	0	0	0	0	428.72	1425.3	1662.5	389.87	2211	1957.2	0	0	0	0	0	0	0	357.11	0	0	0	0	867.71	430.28	421.16	0	0	0	0	0	0
A0A3Q2HX21	A0A3Q2HX21_HORSE	Tetratricopeptide repeat domain 7B	TTC7B	Equus caballus (Horse)				AHVLYFK	0.86745	0.46127	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1258.1	0	0	0
A0A3Q2HX53	A0A3Q2HX53_HORSE	Chromosome 5 C1orf87 homolog	C5H1orf87	Equus caballus (Horse)				SLLDVLEMAR	0.96868	-0.042379	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1071	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HX60	A0A3Q2HX60_HORSE	[histone H3]-trimethyl-L-lysine(4) demethylase (EC 1.14.11.67)	KDM5B	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]; histone H3K4me/H3K4me2/H3K4me3 demethylase activity [GO:0034647]; metal ion binding [GO:0046872]	ALIEESEMK	0.96604	-0.10592	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1300.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HX94	A0A3Q2HX94_HORSE	Ninein like	NINL	Equus caballus (Horse)			calcium ion binding [GO:0005509]	IRITIQQLTQR	0.98605	-1.4508	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	529.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	589.23	0	0	0	0	0	0	0	1155.7	0	0	0	0	0	614.1	0	0	0	0	0	0	0	0	0	746.54	0	0	0	0	0	0	0	0	0	0	0	0	0	1234	0	0	0
A0A3Q2HXJ7	A0A3Q2HXJ7_HORSE	DnaJ heat shock protein family (Hsp40) member C8	DNAJC8	Equus caballus (Horse)				IQKSIKVK	0.96716	-0.057327	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	681.61	0	832.32	0	0	0	0	0	0	0	0	0	0	0	1386.1	1185.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	816.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1097.9	0	0	0	0	0	0	0
A0A3Q2HXP5	A0A3Q2HXP5_HORSE	Nuclear factor NF-kappa-B p105 subunit (Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1)	NFKB1	Equus caballus (Horse)	signal transduction [GO:0007165]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	SARTPGG	0.98668	-0.86442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	409.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HXX3	A0A3Q2HXX3_HORSE	Transforming acidic coiled-coil containing protein 1	TACC1	Equus caballus (Horse)	mitotic spindle organization [GO:0007052]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]		DGVNKPVVAK	0.97858	-0.40261	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	343.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HXY7	A0A3Q2HXY7_HORSE	Nectin cell adhesion molecule 3	NECTIN3	Equus caballus (Horse)	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules [GO:0007157]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; viral entry into host cell [GO:0046718]	adherens junction [GO:0005912]; apical junction complex [GO:0043296]; membrane [GO:0016020]		KDYLEEPEKTQWNNVENLNR	0.67898	0.59411	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	599.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HY42	A0A3Q2HY42_HORSE	Transcription factor IIIA	GTF3A	Equus caballus (Horse)				LSGYIPPK	0.74425	0.559	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3056.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1958	0	0	0	1002.5	0	0	0	0	0	0	0	0	0	0	0	0	0	1329.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HYB6	A0A3Q2HYB6_HORSE	DnaJ heat shock protein family (Hsp40) member B2	DNAJB2	Equus caballus (Horse)	chaperone-mediated protein folding [GO:0061077]		Hsp70 protein binding [GO:0030544]; unfolded protein binding [GO:0051082]	AEASGPGAGGR	0.98469	-1.3171	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1146	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HZ36	A0A3Q2HZ36_HORSE	RIPOR family member 3	RIPOR3	Equus caballus (Horse)				LALLGGSPGPRR	0.98353	-0.90823	0	0	0	442.24	0	0	0	0	0	855.23	0	0	0	0	0	0	0	0	0	614.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HZ38	A0A3Q2HZ38_HORSE	EH domain binding protein 1	EHBP1	Equus caballus (Horse)				ITNFTTSWR	0.98742	-1.1956	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	488.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	469.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HZ59	A0A3Q2HZ59_HORSE	Lipid-binding serum glycoprotein N-terminal domain-containing protein		Equus caballus (Horse)			lipid binding [GO:0008289]	TGRWLEEVPPR	0.93273	0.2727	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	599.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HZA1	A0A3Q2HZA1_HORSE	MPN domain containing	MPND	Equus caballus (Horse)			metallopeptidase activity [GO:0008237]	AWHLGKAP	0.98878	-1.7665	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1893.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HZE3	A0A3Q2HZE3_HORSE	Pseudouridine synthase 7 like	PUS7L	Equus caballus (Horse)	pseudouridine synthesis [GO:0001522]		pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]	AVHHFVNKK	0.98647	-3.2055	0	0	0	0	0	0	0	0	1132.6	0	0	0	0	0	0	0	31769	0	0	1008.3	885.17	0	0	0	0	0	0	0	0	0	0	0	941	0	0	0	0	0	0	0	0	0	0	0	0	0	44411	767.35	0	0	51968	0	0	0	7378.9	0	0	2323.2	0	640.23	0	1177.5	0	0	0	0	1474.1	0	0	0	0	0	0	0	0
A0A3Q2HZM7	A0A3Q2HZM7_HORSE	"Tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1"	TANC1	Equus caballus (Horse)				RGVLEPLTNLR	0.98476	-0.84622	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	678.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HZP0	A0A3Q2HZP0_HORSE	IQ motif containing with AAA domain 1 like	IQCA1L	Equus caballus (Horse)			ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]	GYLQRMR	0.9793	-0.2913	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1072.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HZP7	A0A3Q2HZP7_HORSE	Spermatogenesis and oogenesis specific basic helix-loop-helix 2	SOHLH2	Equus caballus (Horse)	spermatogenesis [GO:0007283]	nucleus [GO:0005634]	DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]	ISLLHSSK	0.9901	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	261.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	324.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HZT9	A0A3Q2HZT9_HORSE	Chromosome 4 open reading frame 54	C4orf54	Equus caballus (Horse)				ASAQKTPEKAK	0.96622	-0.15227	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	388.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2HZX0	A0A3Q2HZX0_HORSE	Carnosine N-methyltransferase (EC 2.1.1.22)	CARNMT1	Equus caballus (Horse)			carnosine N-methyltransferase activity [GO:0030735]	EILKNFPKER	0.97368	-0.19968	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	536.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I066	A0A3Q2I066_HORSE	Ral guanine nucleotide dissociation stimulator like 1	RGL1	Equus caballus (Horse)	small GTPase mediated signal transduction [GO:0007264]		guanyl-nucleotide exchange factor activity [GO:0005085]	EPPHFPCLQK	0.96773	-0.051539	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	580.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I0C2	A0A3Q2I0C2_HORSE	Cadherin domain-containing protein	LOC100072343	Equus caballus (Horse)	homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]	EIDSEQLKEPR	0.98765	-1.9011	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	904.86	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I0H8	A0A3Q2I0H8_HORSE	Vir like m6A methyltransferase associated	VIRMA	Equus caballus (Horse)	mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	nucleus [GO:0005634]		DVLKFLAQSQK	0.97943	-0.34767	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	59968	54720	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I0Q4	A0A3Q2I0Q4_HORSE	Zinc finger FYVE domain-containing protein	ZFYVE16	Equus caballus (Horse)		cytosol [GO:0005829]; early endosome membrane [GO:0031901]	1-phosphatidylinositol binding [GO:0005545]; metal ion binding [GO:0046872]	TSIFIKQSAK	0.98782	-1.8673	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	744.25	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I0W0	A0A3Q2I0W0_HORSE	Autophagy related 14	ATG14	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]; protein-containing complex [GO:0032991]		HLVENKIPR	0.98819	-1.9018	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	688.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I0W6	A0A3Q2I0W6_HORSE	"RAB38, member RAS onco family"	RAB38	Equus caballus (Horse)	intracellular protein transport [GO:0006886]; melanosome organization [GO:0032438]	endomembrane system [GO:0012505]; melanosome [GO:0042470]; mitochondrion [GO:0005739]; trans-Golgi network [GO:0005802]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]	APELLLSLPGHHRR	0.68144	0.59005	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5180.3	0	0	0	0	0	0	0
A0A3Q2I0X1	A0A3Q2I0X1_HORSE	Cytosolic carboxypeptidase N-terminal domain-containing protein		Equus caballus (Horse)	proteolysis [GO:0006508]		metallocarboxypeptidase activity [GO:0004181]; zinc ion binding [GO:0008270]	KAFPSQGAHR	0.98348	-0.89108	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	536.37	0	0	0	0	0	0	0
A0A3Q2I118	A0A3Q2I118_HORSE	ATPase family AAA domain containing 2	ATAD2	Equus caballus (Horse)	positive regulation of transcription by RNA polymerase II [GO:0045944]	nucleus [GO:0005634]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; chromatin binding [GO:0003682]; histone binding [GO:0042393]	LIRHRACALR	0.99045	-1.6709	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	367.19	0	298.67	0	0	0	0	329.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	376.37	0	0	0	0	0	0	0
A0A3Q2I192	A0A3Q2I192_HORSE	Formin like 1	FMNL1	Equus caballus (Horse)	cell migration [GO:0016477]; cortical actin cytoskeleton organization [GO:0030866]; regulation of cell shape [GO:0008360]	cytosol [GO:0005829]	actin filament binding [GO:0051015]; small GTPase binding [GO:0031267]	CPPSPRLTPAHSR	0.98548	-2.1004	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	995.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	555.33	0	0	0	0	0	0	0	0	0	945.37	0	0	0	727.3	0	0	520.05	0	366.22	0	0	712.75	0	0	692.41	0	0	0	0	719.05	0	0	602.63	0	632.86	0	0	0
A0A3Q2I1L2	A0A3Q2I1L2_HORSE	Transmembrane protein 43	TMEM43	Equus caballus (Horse)	nuclear membrane organization [GO:0071763]	endoplasmic reticulum lumen [GO:0005788]; Golgi apparatus [GO:0005794]; nuclear inner membrane [GO:0005637]	identical protein binding [GO:0042802]; protein self-association [GO:0043621]	EQKSNAMK	0.98286	-0.9302	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1450.6	1448.7	2539.7	2330.6	2391.1	3558.4	3784.2	4020.4	0	0	0	883.31	0	1012.6	0	0	0	1306.7	0	0	0	0	0	0	0	0	0	0	0	1565.6	0	1365.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I244	A0A3Q2I244_HORSE	Anoctamin	ANO4	Equus caballus (Horse)		plasma membrane [GO:0005886]		TKVFHPVAK	0.99044	-1.252	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	907.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I2E9	A0A3Q2I2E9_HORSE	Albumin	ALB	Equus caballus (Horse)	cellular response to calcium ion starvation [GO:0072732]; negative regulation of mitochondrial depolarization [GO:0051902]	cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; protein-containing complex [GO:0032991]	DNA binding [GO:0003677]; enterobactin binding [GO:1903981]; exogenous protein binding [GO:0140272]; fatty acid binding [GO:0005504]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; oxygen binding [GO:0019825]; protein-folding chaperone binding [GO:0051087]; pyridoxal phosphate binding [GO:0030170]; toxic substance binding [GO:0015643]	ACCDKPLLQK	0	323.31	16053	18645	12011	6121.5	5239.7	5571.7	27768	27424	30092	742.19	11919	12812	28035	28764	25675	71566	67606	67944	16163	70130	62094	11487	11906	12931	7557	6875.8	7986.7	41524	45209	43655	64264	54486	55253	61709	60433	39398	10737	27721	27022	83855	75096	79223	27435	26019	22910	43320	54695	56775	39741	39263	37890	63332	178540	160250	64373	67358	65054	132560	131220	133410	34659	96145	100140	51240	48355	38660	115230	111180	105520	23828	60721	52558	13788	12858	11970
A0A3Q2I2K8	A0A3Q2I2K8_HORSE	Dispatched RND transporter family member 2	DISP2	Equus caballus (Horse)	smoothened signaling pathway [GO:0007224]	membrane [GO:0016020]	transmembrane transporter activity [GO:0022857]	YLARGCAAR	0.98886	-1.0489	0	0	0	0	0	0	0	0	0	0	0	1885.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7027.7	0	0	0	0	0	0	0	0	1289.6	0	0	0	0	5128.8	0	0	0	0	0	0	0	0	0	0	0	0	0	901.23	0	3751.7	0	0	0	0	2192.1	0	0	0	0	0	0	0	0	0	0	1347.5	0
A0A3Q2I2L4	A0A3Q2I2L4_HORSE	Glycine amidinotransferase (EC 2.1.4.1) (L-arginine:glycine amidinotransferase)	GATM	Equus caballus (Horse)	creatine biosynthetic process [GO:0006601]	mitochondrial inner membrane [GO:0005743]	glycine amidinotransferase activity [GO:0015068]	LGISTIK	0.98998	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	461.11	0	0	533.09	531.53	547.34	0	0	0	0	0	0	0	0	0
A0A3Q2I2V8	A0A3Q2I2V8_HORSE	Tyrosine-protein kinase (EC 2.7.10.2)	LYN	Equus caballus (Horse)	dendritic cell differentiation [GO:0097028]; DNA damage response [GO:0006974]; Fc receptor mediated stimulatory signaling pathway [GO:0002431]; innate immune response [GO:0045087]; negative regulation of B cell proliferation [GO:0030889]; negative regulation of mast cell proliferation [GO:0070667]; neuron projection development [GO:0031175]; phosphorylation [GO:0016310]; platelet degranulation [GO:0002576]; positive regulation of dendritic cell apoptotic process [GO:2000670]; regulation of B cell apoptotic process [GO:0002902]; regulation of B cell receptor signaling pathway [GO:0050855]; regulation of mast cell degranulation [GO:0043304]; regulation of platelet aggregation [GO:0090330]; tolerance induction to self antigen [GO:0002513]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	cytoplasm [GO:0005737]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]	ATP binding [GO:0005524]; non-membrane spanning protein tyrosine kinase activity [GO:0004715]; signaling receptor binding [GO:0005102]	VLEEHGEWWRAK	0.89037	0.33097	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1283.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I359	A0A3Q2I359_HORSE	Coiled-coil domain-containing protein	CCDC168	Equus caballus (Horse)				EEDRENIVYVK	0.98754	-3.9342	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	381.18	414.61	431.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2804.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2203	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I389	A0A3Q2I389_HORSE	Polypyrimidine tract binding protein 3	PTBP3	Equus caballus (Horse)	mRNA processing [GO:0006397]; regulation of cell differentiation [GO:0045595]	nucleus [GO:0005634]	RNA binding [GO:0003723]	AGGAAKR	0.98296	-0.89536	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6356.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	341.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	358.39	0	0	0	0	0	10306	0
A0A3Q2I3E2	A0A3Q2I3E2_HORSE	Doublecortin	DCX	Equus caballus (Horse)	axoneme assembly [GO:0035082]; intracellular signal transduction [GO:0035556]; neuron migration [GO:0001764]; retina development in camera-type eye [GO:0060041]	cytoplasm [GO:0005737]; neuron projection [GO:0043005]	microtubule binding [GO:0008017]	ASPTPQKSSAK	0.9867	-3.1059	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1325	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I3M2	A0A3Q2I3M2_HORSE	Unconventional myosin-Id	MYO1D	Equus caballus (Horse)		myosin complex [GO:0016459]	actin binding [GO:0003779]; ATP binding [GO:0005524]; cytoskeletal motor activity [GO:0003774]	HVKWPTPPKVLR	0.37333	0.71939	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	563.27	0	1411.7	0	1367.7	0	0	840.9	0	457.16	0	0	0	0	0	0	0	0	0	1187.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	561.35	0	0	0	0
A0A3Q2I3Q9	A0A3Q2I3Q9_HORSE	Uncharacterized protein		Equus caballus (Horse)	"antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent [GO:0002486]; antigen processing and presentation of endogenous peptide antigen via MHC class Ib [GO:0002476]; immune response [GO:0006955]; positive regulation of T cell mediated cytotoxicity [GO:0001916]"	external side of plasma membrane [GO:0009897]; extracellular space [GO:0005615]	peptide antigen binding [GO:0042605]; signaling receptor binding [GO:0005102]	RRLHRPER	0.96433	-0.093211	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1627.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I3V8	A0A3Q2I3V8_HORSE	Plexin A4	PLXNA4	Equus caballus (Horse)			semaphorin receptor activity [GO:0017154]	GGKNLSLSRFLCWWQNWR	0.91016	0.29752	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	479.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I3X9	A0A3Q2I3X9_HORSE	Transmembrane protein 156	TMEM156	Equus caballus (Horse)		membrane [GO:0016020]		FGNSKASLFHCRVNSR	0.98304	-0.93017	0	0	0	532.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11599	0	0	10999	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I3Z7	A0A3Q2I3Z7_HORSE	Large ribosomal subunit protein uL2 (60S ribosomal protein L8)	RPL8	Equus caballus (Horse)	cytoplasmic translation [GO:0002181]	cytosolic large ribosomal subunit [GO:0022625]; organelle membrane [GO:0031090]; polysomal ribosome [GO:0042788]; postsynaptic density [GO:0014069]	structural constituent of ribosome [GO:0003735]	LSPRWSSGTR	0.9901	-1.2697	425.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I445	A0A3Q2I445_HORSE	ATP binding cassette subfamily E member 1	ABCE1	Equus caballus (Horse)			ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]	KNTHGAVPR	0.98384	-0.79037	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1093.4	0	0	0	0	0	0
A0A3Q2I468	A0A3Q2I468_HORSE	von Willebrand factor C and EGF domains	VWCE	Equus caballus (Horse)			calcium ion binding [GO:0005509]	AVLAPSAILQPLQHPPK	0.9645	-0.12119	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	401.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1177.2
A0A3Q2I4C6	A0A3Q2I4C6_HORSE	Ral transcription factor IIIC subunit 2	GTF3C2	Equus caballus (Horse)	transcription by RNA polymerase III [GO:0006383]	transcription factor TFIIIC complex [GO:0000127]		KIKFWDLR	0.97179	-0.063646	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	718.8	0	0	0	1163.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I4I2	A0A3Q2I4I2_HORSE	Olfactory receptor	OR4X2	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	LWIKTMK	0.98801	-1.7826	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1574.8	0	0	0	0	0	0	0	0
A0A3Q2I4K8	A0A3Q2I4K8_HORSE	Nuclear receptor binding protein 1	NRBP1	Equus caballus (Horse)	intracellular signal transduction [GO:0035556]	cytoplasm [GO:0005737]; endomembrane system [GO:0012505]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	NMDTSAVLAEIPAGPGR	0.97606	0.09668	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	726.64	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	478.4	0	0	0	0	0	0	0	0	0
A0A3Q2I4L0	A0A3Q2I4L0_HORSE	Alpha-actinin-4 (Non-muscle alpha-actinin 4)	ACTN4	Equus caballus (Horse)			actin binding [GO:0003779]; calcium ion binding [GO:0005509]	RGGPKPR	0.98281	-0.74454	0	0	0	0	0	0	0	543.38	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1285.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I4P9	A0A3Q2I4P9_HORSE	Exostosin like glycosyltransferase 3	EXTL3	Equus caballus (Horse)	heparan sulfate proteoglycan biosynthetic process [GO:0015012]; negative regulation of inflammatory response to wounding [GO:0106015]; negative regulation of keratinocyte differentiation [GO:0045617]; positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [GO:0051897]; protein glycosylation [GO:0006486]	endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]; plasma membrane [GO:0005886]	glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase activity [GO:0001888]; magnesium ion binding [GO:0000287]; protein-hormone receptor activity [GO:0016500]	SKITSHMRK	0.96759	0.18449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2489.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I4T5	A0A3Q2I4T5_HORSE	Ankyrin repeat and fibronectin type III domain containing 1	ANKFN1	Equus caballus (Horse)				EAISDSEVAAAKQR	0.98472	-2.1257	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	950.64	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1737.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I532	A0A3Q2I532_HORSE	Pyruvate dehydrogenase E1 subunit alpha 1	PDHA1	Equus caballus (Horse)			"oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor [GO:0016624]"	RKMLAAVSR	0.96175	-0.14694	1603.5	1998.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1919.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1753.3	0	0	0	0	0	1373	0	0	0	0	0	0	0	932.59	0	0	0	0	0	0	1694.8	0	0	0
A0A3Q2I550	A0A3Q2I550_HORSE	Plexin D1	PLXND1	Equus caballus (Horse)			semaphorin receptor activity [GO:0017154]	YRPQLLYIK	0.96314	-0.14076	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1326.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I581	A0A3Q2I581_HORSE	Microtubule associated scaffold protein 2	MTUS2	Equus caballus (Horse)		nucleus [GO:0005634]	microtubule binding [GO:0008017]	IDQNTVVTR	0.9674	-0.029404	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1401.1	0	0	0	8873.8	0	0	0	0	0	5713	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I594	A0A3Q2I594_HORSE	V-type proton ATPase subunit H	ATP6V1H	Equus caballus (Horse)		"vacuolar proton-transporting V-type ATPase, V1 domain [GO:0000221]"	"proton-transporting ATPase activity, rotational mechanism [GO:0046961]"	LEWSPVHK	0.68536	0.61362	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	444.36	0	0	0	0	0	0	0	0	0	0	0	424.69	0	0	9917.7	4287.4	3507.6	0	0	0	634.61	650.23	0	513.25	0	0	0	0	0	0	0	0	0	0	0	578.22	817.28	0	574.53	537.33	0	0	0	0	0	0	0	360.87	315.18	0	0	0	0	0	0	0	0	0	0
A0A3Q2I5B1	A0A3Q2I5B1_HORSE	Histone H1.0 (Histone H1(0))	H1-0 LOC111770994 LOC111771136	Equus caballus (Horse)	chromosome condensation [GO:0030261]; negative regulation of DNA recombination [GO:0045910]; nucleosome assembly [GO:0006334]	nucleosome [GO:0000786]; nucleus [GO:0005634]	double-stranded DNA binding [GO:0003690]; nucleosomal DNA binding [GO:0031492]; structural constituent of chromatin [GO:0030527]	ASKKSTDHPK	0.97378	-0.19537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	937.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I5I6	A0A3Q2I5I6_HORSE	Glutamate ionotropic receptor NMDA type subunit associated protein 1	GRINA	Equus caballus (Horse)	negative regulation of apoptotic signaling pathway [GO:2001234]	endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]		SSRAGRR	0.96529	-0.085534	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2161.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	629.23	0	0	0	0	0	0	0	0
A0A3Q2I5P6	A0A3Q2I5P6_HORSE	O-acyltransferase	SOAT1	Equus caballus (Horse)	cholesterol efflux [GO:0033344]; cholesterol homeostasis [GO:0042632]; cholesterol metabolic process [GO:0008203]; cholesterol storage [GO:0010878]; macrophage derived foam cell differentiation [GO:0010742]; positive regulation of amyloid precursor protein biosynthetic process [GO:0042986]; very-low-density lipoprotein particle assembly [GO:0034379]	endoplasmic reticulum membrane [GO:0005789]	cholesterol binding [GO:0015485]; cholesterol O-acyltransferase activity [GO:0034736]; fatty-acyl-CoA binding [GO:0000062]	IFVVRQSLLELVLEFSLISYAFGK	0.44318	0.65387	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	634.95	854.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I5S2	A0A3Q2I5S2_HORSE	Prolactin regulatory element-binding protein (Mammalian guanine nucleotide exchange factor mSec12)	PREB	Equus caballus (Horse)	endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; protein exit from endoplasmic reticulum [GO:0032527]; protein secretion [GO:0009306]; regulation of COPII vesicle coating [GO:0003400]	endoplasmic reticulum exit site [GO:0070971]; endoplasmic reticulum membrane [GO:0005789]; nucleus [GO:0005634]	GTPase activator activity [GO:0005096]; GTPase binding [GO:0051020]; guanyl-nucleotide exchange factor activity [GO:0005085]	RAASGMGR	0.981	-0.56842	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1547.1	1671	1611.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I5T3	A0A3Q2I5T3_HORSE	Oxysterol-binding protein	OSBPL9	Equus caballus (Horse)	lipid transport [GO:0006869]		lipid binding [GO:0008289]	LSKRQQIMVESIK	0.90093	0.32555	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	354.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I5U8	A0A3Q2I5U8_HORSE	Aminopeptidase O (putative)	AOPEP	Equus caballus (Horse)	proteolysis [GO:0006508]	membrane [GO:0016020]; nucleolus [GO:0005730]	metalloaminopeptidase activity [GO:0070006]; zinc ion binding [GO:0008270]	AVALLWAR	0.97078	0.030449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3691.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I658	A0A3Q2I658_HORSE	Interleukin 17 receptor A	IL17RA	Equus caballus (Horse)		plasma membrane [GO:0005886]	interleukin-17 receptor activity [GO:0030368]	SGALWGHK	0.96874	-0.028225	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2676.2	0	0	0	0	0
A0A3Q2I6E2	A0A3Q2I6E2_HORSE	Formiminotransferase N-terminal subdomain domain-containing protein	LOC100070852	Equus caballus (Horse)			folic acid binding [GO:0005542]; transferase activity [GO:0016740]	AGDVGSR	0.98866	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	248.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I6E7	A0A3Q2I6E7_HORSE	Sulfotransferase (EC 2.8.2.-)	LOC100072708	Equus caballus (Horse)			sulfotransferase activity [GO:0008146]	VTGSLCFDHIR	0.96714	0.0060123	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1697.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I6M5	A0A3Q2I6M5_HORSE	Peptidase A1 domain-containing protein		Equus caballus (Horse)	proteolysis [GO:0006508]		aspartic-type endopeptidase activity [GO:0004190]	VGQGQGL	0.95028	0.23881	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1276.3	0	0	0	0	0	0	0	0	0	0	0	455.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I6P6	A0A3Q2I6P6_HORSE	Thyroid hormone receptor associated protein 3	THRAP3	Equus caballus (Horse)				SDPFAPK	0.98478	-1.3016	0	0	0	0	0	0	0	0	0	460.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2346.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	584.77	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I6X9	A0A3Q2I6X9_HORSE	Zinc finger protein 33B-like	LOC100056282	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]		"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	SVLTAHPK	0.97297	0.051973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1113.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I728	A0A3Q2I728_HORSE	Cell migration inducing hyaluronidase 1	CEMIP	Equus caballus (Horse)		plasma membrane [GO:0005886]	hyalurononglucosaminidase activity [GO:0004415]	KEGRTLNSR	0.97315	0.10515	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	414.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I7L2	A0A3Q2I7L2_HORSE	Zinc finger protein 518B	ZNF518B	Equus caballus (Horse)	positive regulation of transcription by RNA polymerase II [GO:0045944]	nucleus [GO:0005634]		DIGQQLYTPQVNDGPNSLTMSPK	0.96776	0.17976	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	759.44	0	502.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I7Q4	A0A3Q2I7Q4_HORSE	phosphatidylinositol-3-phosphatase (EC 3.1.3.64) (Phosphatidylinositol-3-phosphate phosphatase)	MTMR6	Equus caballus (Horse)	dephosphorylation [GO:0016311]; lipid metabolic process [GO:0006629]		phosphatidylinositol-3-phosphate phosphatase activity [GO:0004438]	TIRGFMVLIEK	0.98806	-1.9019	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	587.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I7S2	A0A3Q2I7S2_HORSE	Laminin subunit alpha 5	LAMA5	Equus caballus (Horse)	cell adhesion [GO:0007155]; regulation of cell adhesion [GO:0030155]; regulation of cell migration [GO:0030334]; regulation of embryonic development [GO:0045995]	basement membrane [GO:0005604]; extracellular region [GO:0005576]; membrane [GO:0016020]	signaling receptor binding [GO:0005102]	FYLQSPEPAR	0.96251	-0.0087491	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	625.74	0
A0A3Q2I854	A0A3Q2I854_HORSE	IF rod domain-containing protein		Equus caballus (Horse)		intermediate filament [GO:0005882]	structural molecule activity [GO:0005198]	MTLDDFR	0	3.7986	0	0	0	0	0	0	0	0	0	0	0	0	825.73	865.22	885.21	1084.1	1908.9	1577.4	0	0	0	0	0	0	0	0	0	0	0	0	1939.2	1762.1	811.2	0	0	0	0	2445.3	2162	659.32	635.64	744.27	680.33	677.32	617.61	0	0	0	838.8	891.05	1372.9	0	1599.2	1530.4	0	0	0	757.52	1954.4	691.69	0	0	0	0	0	0	749.26	736.63	792.72	0	1142.2	1251.3	0	0	0
A0A3Q2I8A2	A0A3Q2I8A2_HORSE	Nudix hydrolase 16 like 1	NUDT16L1	Equus caballus (Horse)				GAGGSAK	0.98331	-0.89382	0	0	0	0	0	0	0	0	0	0	0	0	0	399.36	0	0	0	0	0	0	0	384.85	433.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	451.65	0	0	0	0	0	0
A0A3Q2I8C5	A0A3Q2I8C5_HORSE	Adenosine deaminase RNA specific	ADAR	Equus caballus (Horse)	defense response to virus [GO:0051607]; RNA processing [GO:0006396]		double-stranded RNA adenosine deaminase activity [GO:0003726]; RNA binding [GO:0003723]	FQVVISGR	0.97338	0.051973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2576.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I8D5	A0A3Q2I8D5_HORSE	F-box and WD repeat domain containing 8	FBXW8	Equus caballus (Horse)	cell population proliferation [GO:0008283]; Golgi organization [GO:0007030]; labyrinthine layer blood vessel development [GO:0060716]; positive regulation of dendrite morphogenesis [GO:0050775]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; protein ubiquitination [GO:0016567]; spongiotrophoblast layer development [GO:0060712]	3M complex [GO:1990393]; Cul7-RING ubiquitin ligase complex [GO:0031467]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; perinuclear region of cytoplasm [GO:0048471]; SCF ubiquitin ligase complex [GO:0019005]	ubiquitin-protein transferase activity [GO:0004842]	RVVCFLSTKFR	0.97612	-0.21124	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	339.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I8G7	A0A3Q2I8G7_HORSE	Prostaglandin F2 receptor inhibitor	PTGFRN	Equus caballus (Horse)	lipid droplet organization [GO:0034389]; myoblast fusion involved in skeletal muscle regeneration [GO:0014905]	membrane [GO:0016020]		LENWTDASRVDGVVLEK	0.96729	0.19283	0	0	0	0	0	0	0	0	558.55	0	0	0	0	0	0	0	1817.4	1929.4	0	1071.6	887.19	0	0	0	0	744.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	618.37	0	1810.1	0	0	0	0	0	2695.1	0	0	0	0	0	2200.2	2061.8	0	1545.8	0	0	0	0	1630.6	1413.4	1483.6	0	0	779.44	0	616.47	0
A0A3Q2I8K7	A0A3Q2I8K7_HORSE	Alpha-synuclein	SNCA	Equus caballus (Horse)		axon [GO:0030424]; extracellular region [GO:0005576]; membrane [GO:0016020]; nucleus [GO:0005634]; synapse [GO:0045202]		WEGVNRCRR	0.87063	0.40579	498.87	301.02	0	0	350.44	340.17	380.47	422.42	355.77	0	576.15	440.38	579.64	0	680.48	0	3292.5	0	0	449.52	362.5	0	0	422.96	831.68	544.21	394.2	1273.7	2093.5	2399.1	1212.8	1251.9	1185	1496.4	1616.5	1373.1	380.94	988.88	803.4	2546.7	0	2698	516.1	545.95	623.58	704.66	1818.3	1667.2	521.68	0	0	0	0	0	0	359.38	0	2181	2232.3	2135.3	0	372.97	0	410.13	390.33	871.4	418.49	0	0	1625.1	617.56	490.81	1104.9	318.06	346.59
A0A3Q2I8P5	A0A3Q2I8P5_HORSE	Peroxisome assembly protein 12 (Peroxin-12)	PEX12	Equus caballus (Horse)	"cellular response to reactive oxygen species [GO:0034614]; protein import into peroxisome matrix [GO:0016558]; protein import into peroxisome matrix, receptor recycling [GO:0016562]; protein monoubiquitination [GO:0006513]; protein polyubiquitination [GO:0000209]"	peroxisomal importomer complex [GO:1990429]; peroxisomal membrane [GO:0005778]	ubiquitin ligase activator activity [GO:1990757]; ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]	ITYGKQNK	0.98609	-2.0193	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	953.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I8R9	A0A3Q2I8R9_HORSE	Transmembrane protein 40	TMEM40	Equus caballus (Horse)		membrane [GO:0016020]		HAAGQAR	0.98911	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	345.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I909	A0A3Q2I909_HORSE	Early endosome antigen 1	EEA1	Equus caballus (Horse)				KSLGSADELFK	0.9846	-0.98454	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	326.13	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	418.76	559.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I913	A0A3Q2I913_HORSE	Jumonji and AT-rich interaction domain containing 2	JARID2	Equus caballus (Horse)			DNA binding [GO:0003677]	DVPERSAERTRPK	0.98717	-4.0858	0	0	0	0	0	0	0	0	0	0	0	643.63	0	498.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I947	A0A3Q2I947_HORSE	Telomerase associated protein 1	TEP1	Equus caballus (Horse)	RNA-templated DNA biosynthetic process [GO:0006278]; telomere maintenance via recombination [GO:0000722]	telomerase holoenzyme complex [GO:0005697]	telomerase RNA binding [GO:0070034]	SRPRRRPHPPK	0.92429	0.29434	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	998.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I9F1	A0A3Q2I9F1_HORSE	Ubiquitin specific peptidase 40	USP40	Equus caballus (Horse)			cysteine-type deubiquitinase activity [GO:0004843]	EYKLGRR	0.96992	0.20088	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I9M2	A0A3Q2I9M2_HORSE	ARVCF delta catenin family member	ARVCF	Equus caballus (Horse)	cell-cell adhesion [GO:0098609]			DAEWTTVFK	0.89356	0.41186	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	759.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	772.76	756.6	764.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I9Q3	A0A3Q2I9Q3_HORSE	HECT-type E3 ubiquitin transferase (EC 2.3.2.26)	HERC2	Equus caballus (Horse)	protein ubiquitination [GO:0016567]	cytoplasm [GO:0005737]	ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]	FLILSRNGR	0.98574	-2.7913	0	0	0	0	0	0	0	0	0	0	791.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2207.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2I9Q9	A0A3Q2I9Q9_HORSE	Sorting nexin 13	SNX13	Equus caballus (Horse)		membrane [GO:0016020]	phosphatidylinositol binding [GO:0035091]	EIDWQPYFTTR	0.35945	0.73901	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1023.8	0	0	0	0	0	716.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	373.4	0	0	0	0	0	0	0
A0A3Q2I9W6	A0A3Q2I9W6_HORSE	ADAM metallopeptidase with thrombospondin type 1 motif 20	ADAMTS20	Equus caballus (Horse)	extracellular matrix organization [GO:0030198]; proteolysis [GO:0006508]	extracellular region [GO:0005576]	metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	NNITRDGDYYLNIK	0.98608	-1.1928	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	450.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	374.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IAE8	A0A3Q2IAE8_HORSE	DS cell adhesion molecule like 1	DSCAML1	Equus caballus (Horse)	axon guidance [GO:0007411]; dendrite self-avoidance [GO:0070593]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	axon [GO:0030424]; plasma membrane [GO:0005886]	cell-cell adhesion mediator activity [GO:0098632]	GNVAVFK	0.98866	-1.1462	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	547.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IAG6	A0A3Q2IAG6_HORSE	Calmodulin regulated spectrin associated protein 1	LOC100068095	Equus caballus (Horse)	cytoplasmic microtubule organization [GO:0031122]; negative regulation of microtubule depolymerization [GO:0007026]; neuron projection development [GO:0031175]	cytoplasm [GO:0005737]; microtubule [GO:0005874]	calmodulin binding [GO:0005516]; microtubule minus-end binding [GO:0051011]; spectrin binding [GO:0030507]	ELPYDLEDVMVFWVNK	0.78586	0.50257	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	770.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IAH1	A0A3Q2IAH1_HORSE	WD repeat domain 1	WDR1	Equus caballus (Horse)	actin filament depolymerization [GO:0030042]; locomotion [GO:0040011]; sarcomere organization [GO:0045214]	cortical actin cytoskeleton [GO:0030864]; membrane [GO:0016020]	actin filament binding [GO:0051015]	IIGGDPK	0.94516	0.24264	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	333.97	308.35	277.52	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IAJ1	A0A3Q2IAJ1_HORSE	SH3 domain-containing protein	UBASH3B	Equus caballus (Horse)	collagen-activated tyrosine kinase receptor signaling pathway [GO:0038063]; negative regulation of bone resorption [GO:0045779]; negative regulation of osteoclast differentiation [GO:0045671]; negative regulation of platelet aggregation [GO:0090331]; negative regulation of signal transduction [GO:0009968]; platelet aggregation [GO:0070527]; regulation of release of sequestered calcium ion into cytosol [GO:0051279]		identical protein binding [GO:0042802]; phosphoprotein binding [GO:0051219]; protein tyrosine phosphatase activity [GO:0004725]	VTPRRNR	0.9671	-0.080617	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	618.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IAP0	A0A3Q2IAP0_HORSE	Electron transfer flavoprotein beta subunit lysine methyltransferase (ETFB lysine methyltransferase) (Protein N-lysine methyltransferase METTL20)	ETFBKMT	Equus caballus (Horse)			S-adenosylmethionine-dependent methyltransferase activity [GO:0008757]	ALCLVSRGGVSK	0.97968	-0.28957	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2112.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IAT0	A0A3Q2IAT0_HORSE	RB transcriptional corepressor 1	RB1	Equus caballus (Horse)	cell cycle [GO:0007049]; chromatin organization [GO:0006325]; regulation of cell cycle [GO:0051726]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]		HLPGEFK	0.97367	-0.19955	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3163.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	637.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IAU2	A0A3Q2IAU2_HORSE	Forkhead box C1	FOXC1	Equus caballus (Horse)	anatomical structure morphogenesis [GO:0009653]; cell differentiation [GO:0030154]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	EPPPPPPGR	0.96892	-0.02928	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1248.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IAZ2	A0A3Q2IAZ2_HORSE	Metalloendopeptidase (EC 3.4.24.-)	TLL1	Equus caballus (Horse)	dorsal/ventral pattern formation [GO:0009953]; protein processing [GO:0016485]	extracellular space [GO:0005615]	calcium ion binding [GO:0005509]; metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	AGGLGDHGMSKK	0.9793	-0.37365	0	0	0	0	0	0	0	0	0	907.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	615.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IB06	A0A3Q2IB06_HORSE	Outer dynein arm docking complex subunit 2	ODAD2	Equus caballus (Horse)				VAFGEHNAVAPLVR	0.36715	0.74722	0	533.48	424.72	0	0	0	734.11	799.06	0	0	855.24	761.62	727.44	678.01	730.98	0	0	0	0	657.18	698.88	0	0	0	0	0	427.8	0	1345.8	1321.8	1597.8	1313.2	0	1648.2	0	0	0	676.4	976.31	0	0	851.11	0	680.65	0	0	0	947.89	948.83	0	937.57	0	0	685.75	483.9	395.52	451.41	877.06	756.8	791.76	0	0	659.02	388.09	0	375.34	590.38	572.53	601.38	0	756.64	578.28	0	0	0
A0A3Q2IB07	A0A3Q2IB07_HORSE	WAPL cohesin release factor	WAPL	Equus caballus (Horse)				GGNGSSK	0.94747	0.23726	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	364.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IB75	A0A3Q2IB75_HORSE	SLIT-ROBO Rho GTPase activating protein 2	SRGAP2	Equus caballus (Horse)	signal transduction [GO:0007165]			LQAKHDLLQK	0.98663	-1.9074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1453.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IBA2	A0A3Q2IBA2_HORSE	Cortactin	CTTN	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		ERQEQEEAR	0.97222	-0.19191	0	0	0	0	0	0	0	669.76	0	0	0	568.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1667.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IBD6	A0A3Q2IBD6_HORSE	Glucagon like peptide 2 receptor	GLP2R	Equus caballus (Horse)	cell surface receptor signaling pathway [GO:0007166]	membrane [GO:0016020]	G protein-coupled receptor activity [GO:0004930]	ILKLLISK	0.98605	-2.5146	0	621.77	457.86	0	0	0	0	0	0	0	0	0	0	609.01	0	0	0	0	0	616.44	0	0	0	0	522.9	0	0	0	804.39	0	0	813.05	0	0	0	0	0	0	600.91	679.3	736.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	828.62	0	503.82	0	806.2	0	846.33	0	0	0	0	0	0	685.48
A0A3Q2IBF2	A0A3Q2IBF2_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)		Equus caballus (Horse)	intracellular signal transduction [GO:0035556]; microtubule cytoskeleton organization [GO:0000226]	cytoplasm [GO:0005737]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]; tau-protein kinase activity [GO:0050321]	LSLPADVRR	0.9836	-0.83088	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	754.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IBJ8	A0A3Q2IBJ8_HORSE	C-type lectin domain containing 11A	CLEC11A	Equus caballus (Horse)	ossification [GO:0001503]	extracellular space [GO:0005615]	carbohydrate binding [GO:0030246]; growth factor activity [GO:0008083]	VSFFAWHR	0.98993	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	492.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1098.6	0	0
A0A3Q2IBM2	A0A3Q2IBM2_HORSE	Rho guanine nucleotide exchange factor 17	ARHGEF17	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]	LADILSPR	0.17593	1.1275	0	0	0	0	0	0	0	0	0	0	0	0	0	0	260.16	0	0	0	0	0	0	0	0	769.2	0	0	0	0	357.57	502.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	339.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IBN1	A0A3Q2IBN1_HORSE	Leucine-rich repeat-containing protein 14		Equus caballus (Horse)	negative regulation of apoptotic process [GO:0043066]; negative regulation of cell differentiation [GO:0045596]; negative regulation of DNA-templated transcription [GO:0045892]; positive regulation of cell population proliferation [GO:0008284]	cytoplasm [GO:0005737]		RPRDAKR	0.96903	-0.06842	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	877.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IBR4	A0A3Q2IBR4_HORSE	Uracil phosphoribosyltransferase homolog	UPRT	Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]	ribosylnicotinamide kinase activity [GO:0050262]	LACSNIAKK	0.9835	-0.68932	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1849.4	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IC09	A0A3Q2IC09_HORSE	Lipolysis stimulated lipoprotein receptor	LSR	Equus caballus (Horse)		bicellular tight junction [GO:0005923]; membrane [GO:0016020]		GPALTPIR	0.99031	-1.6693	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1711.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36607	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IC17	A0A3Q2IC17_HORSE	Integrin subunit alpha 7	ITGA7	Equus caballus (Horse)	cell adhesion [GO:0007155]; integrin-mediated signaling pathway [GO:0007229]	integrin complex [GO:0008305]		LWNSTFLEEYSAVK	0.36098	0.75303	0	743.53	523.99	0	0	0	0	0	898.29	0	0	1095	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2972.8	2893.5	0	19834	21140	0	0	0	0	0	0	1844.2	0	0	933.31	1707.9	2020.2	0	0	0	984.5	0	1745.2	0	0	0	0	0	3204.8	3059.7	620.14	0	0	0	0	757.61	0	1325.5	0	0	0	0	0	0	0
A0A3Q2IC23	A0A3Q2IC23_HORSE	Uncharacterized protein		Equus caballus (Horse)				NIPMEKYRK	0.98537	-1.4582	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	900.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IC56	A0A3Q2IC56_HORSE	RNA exonuclease 4	REXO4	Equus caballus (Horse)	rRNA processing [GO:0006364]		3'-5' exonuclease activity [GO:0008408]; nucleic acid binding [GO:0003676]	GAGGGPR	0.97425	0.099296	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	609.39	0	0	0	0	0	0	456.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IC86	A0A3Q2IC86_HORSE	EF-hand domain-containing protein	TCHH	Equus caballus (Horse)	intermediate filament organization [GO:0045109]		metal ion binding [GO:0046872]	DLKWQWQPEK	0.98831	-1.6047	0	0	0	0	0	0	0	0	0	0	0	0	0	954.65	0	0	0	0	0	0	0	571.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2865.1	0	0	0	0	0	0	0	0	0	0	0	0	0	1855.3	0	0	0	0	0	0	0	0	0	0	0	0	1071.5
A0A3Q2ICX5	A0A3Q2ICX5_HORSE	Myosin XVIIIA	MYO18A	Equus caballus (Horse)	DNA metabolic process [GO:0006259]	myosin complex [GO:0016459]	"actin binding [GO:0003779]; ATP binding [GO:0005524]; ATP-dependent activity, acting on DNA [GO:0008094]; cytoskeletal motor activity [GO:0003774]; DNA binding [GO:0003677]"	AAKFGSLAK	0.98559	-2.0598	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2391.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2ID13	A0A3Q2ID13_HORSE	FHF complex subunit HOOK interacting protein 2A	FHIP2A	Equus caballus (Horse)				VVGDLMVRIQR	0.98691	-1.8247	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1151.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	539.45
A0A3Q2ID33	A0A3Q2ID33_HORSE	F-box and leucine rich repeat protein 13	FBXL13	Equus caballus (Horse)				HELQLKRWK	0.98202	-0.25439	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1155.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IDG5	A0A3Q2IDG5_HORSE	NLR family pyrin domain containing 14	NLRP14	Equus caballus (Horse)				SLCHLAAK	0.96927	0.010271	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1771.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IDH1	A0A3Q2IDH1_HORSE	Ankyrin repeat domain 65	ANKRD65	Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]		GALVDAR	0.95499	0.22578	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1450.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	503.23	0	0	0	653.43	25228	0	0	0	0	0	0
A0A3Q2IDN6	A0A3Q2IDN6_HORSE	Cyclin N-terminal domain-containing protein		Equus caballus (Horse)	mitotic cell cycle phase transition [GO:0044772]	cyclin-dependent protein kinase holoenzyme complex [GO:0000307]; cytoplasm [GO:0005737]; nucleus [GO:0005634]	cyclin-dependent protein serine/threonine kinase regulator activity [GO:0016538]	NGLNFERLEVQLKACYCR	0.92195	0.29053	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	679.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IEL5	A0A3Q2IEL5_HORSE	Bromodomain containing 1	BRD1	Equus caballus (Horse)			metal ion binding [GO:0046872]	EVPDYLDHIK	0.9193	0.30819	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	459.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	394.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IEX7	A0A3Q2IEX7_HORSE	CD2 associated protein	CD2AP	Equus caballus (Horse)	actin filament organization [GO:0007015]; negative regulation of small GTPase mediated signal transduction [GO:0051058]; negative regulation of transforming growth factor beta1 production [GO:0032911]; positive regulation of protein localization to nucleus [GO:1900182]; positive regulation of protein secretion [GO:0050714]; regulation of actin cytoskeleton organization [GO:0032956]; synapse organization [GO:0050808]; transforming growth factor beta1 production [GO:0032905]	axon [GO:0030424]; cell-cell junction [GO:0005911]; centriolar satellite [GO:0034451]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; fibrillar center [GO:0001650]; filamentous actin [GO:0031941]; neuromuscular junction [GO:0031594]; plasma membrane [GO:0005886]; ruffle [GO:0001726]; vesicle [GO:0031982]	identical protein binding [GO:0042802]; SH3 domain binding [GO:0017124]	QVPPPAGATR	0.96376	-0.1389	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	788.17	0	0	0	0	0	0
A0A3Q2IF14	A0A3Q2IF14_HORSE	Cytochrome P450 family 20 subfamily A member 1	CYP20A1	Equus caballus (Horse)			"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	IVFYRHLK	0.99217	-1.2258	0	0	0	0	0	0	0	0	0	0	0	0	1305.9	0	1353.2	3361	0	0	0	0	0	1797.8	0	0	0	0	0	0	1555.9	0	2968.2	0	3185.8	0	0	0	0	0	2207.1	0	0	0	0	0	0	0	1746.5	0	0	0	0	0	1872.4	2025.5	0	0	0	0	0	0	0	1371.5	1425.3	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IF41	A0A3Q2IF41_HORSE	Coiled-coil domain containing 141	CCDC141	Equus caballus (Horse)		membrane [GO:0016020]		EVLESITELCASLTELEEK	0.89006	0.33197	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12041	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IHN7	A0A3Q2IHN7_HORSE	ATP binding cassette subfamily C member 5	ABCC5	Equus caballus (Horse)		membrane [GO:0016020]	ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]	GANLSGGQR	0.94452	0.24435	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1084.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IHS4	A0A3Q2IHS4_HORSE	Small integral membrane protein 19	SMIM19	Equus caballus (Horse)		membrane [GO:0016020]		ESPSEPAGR	0.9693	0.16306	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1414	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1640.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IHV3	A0A3Q2IHV3_HORSE	"Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (EC 3.1.3.16) (EC 3.1.3.48) (EC 3.1.3.67)"	PTEN	Equus caballus (Horse)	dephosphorylation [GO:0016311]; lipid metabolic process [GO:0006629]	cell projection [GO:0042995]; nucleus [GO:0005634]	"phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity [GO:0016314]"	AISILQKKPR	0.98777	-1.7241	0	0	0	0	0	0	0	0	0	0	290.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	604.64	479.24	0	0	0	0	0	0	0	0	0	415.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IJ12	A0A3Q2IJ12_HORSE	Microtubule associated protein 1A	MAP1A	Equus caballus (Horse)	microtubule cytoskeleton organization [GO:0000226]	microtubule [GO:0005874]	microtubule binding [GO:0008017]	EKAQGRVGR	0.96682	-0.1691	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2720.9	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2IL83	A0A3Q2IL83_HORSE	Mitogen-activated protein kinase 15 (EC 2.7.11.24)	MAPK15	Equus caballus (Horse)	phosphorylation [GO:0016310]		ATP binding [GO:0005524]; MAP kinase activity [GO:0004707]	GGLLKDVHKR	0.97222	-0.20726	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	348	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KJ78	A0A3Q2KJ78_HORSE	Centrosomal protein 89	CEP89	Equus caballus (Horse)	chemical synaptic transmission [GO:0007268]; cilium assembly [GO:0060271]; mitochondrion organization [GO:0007005]	centriole [GO:0005814]; synapse [GO:0045202]		MLLGFRR	0.98296	-0.81024	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2401.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	468.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KJV7	A0A3Q2KJV7_HORSE	Ataxin 7	ATXN7	Equus caballus (Horse)				IYIWEPLI	0.97135	0.1722	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1054.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KLP6	A0A3Q2KLP6_HORSE	Vacuolar ATPase assembly integral membrane protein vma21		Equus caballus (Horse)	vacuolar proton-transporting V-type ATPase complex assembly [GO:0070072]	cytoplasmic vesicle [GO:0031410]; endoplasmic reticulum membrane [GO:0005789]		IFLLFAGLMVK	0.9659	-0.1562	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	478.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KMV1	A0A3Q2KMV1_HORSE	Helicase with zinc finger 2	HELZ2	Equus caballus (Horse)	regulatory ncRNA-mediated post-transcriptional gene silencing [GO:0035194]	cytosol [GO:0005829]; P granule [GO:0043186]	ATP hydrolysis activity [GO:0016887]; helicase activity [GO:0004386]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]; RNA nuclease activity [GO:0004540]	AYSLHLATR	0.98616	-1.9245	0	0	0	0	0	0	0	0	0	0	799.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	535.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	518.97	0	0	0	0	0	0
A0A3Q2KNF8	A0A3Q2KNF8_HORSE	GB1/RHD3-type G domain-containing protein	LOC100052081	Equus caballus (Horse)	innate immune response [GO:0045087]		GTP binding [GO:0005525]; GTPase activity [GO:0003924]	VKAESAQAAAK	0.9876	-1.0988	0	0	0	0	0	0	0	0	0	0	0	0	0	0	396.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1220.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KNR3	A0A3Q2KNR3_HORSE	Hepatoma-derived growth factor-related protein 2	HDGFL2	Equus caballus (Horse)		nucleus [GO:0005634]		GPPGGGR	0.98649	-1.3742	0	0	0	0	0	0	0	0	0	0	0	0	1440.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1494.9	1401.2	1441.6	2089	2045.8	0	0	3185	0	0	0	1328.9	0	0	0	0	0	0	0	1578.3	1304.5	0	0	0	858.16	515.05	463.41	0	968.16	941.41	557.77	0	0	0	0	0	0	0	0	958.51	0	374.25	0	0	0	1688.3	0	1674.5
A0A3Q2KQE6	A0A3Q2KQE6_HORSE	MAX dimerization protein MGA	MGA	Equus caballus (Horse)	positive regulation of DNA-templated transcription [GO:0045893]	MLL1 complex [GO:0071339]	DNA-binding transcription factor activity [GO:0003700]; protein dimerization activity [GO:0046983]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]	HNKVDNLEADHPSSK	0.98882	-1.8927	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1263.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	522.09	0	0	0	0	0	2806.7	0	0	0	0	0	0	0	0	0	1817.8	0	0	2791.8	0	0	0	0	0	1040.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KQU1	A0A3Q2KQU1_HORSE	Olfactory receptor	OR9Q2	Equus caballus (Horse)	G protein-coupled receptor signaling pathway [GO:0007186]; sensory perception of smell [GO:0007608]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; odorant binding [GO:0005549]; olfactory receptor activity [GO:0004984]	AAGGWAK	0.99027	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	512.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KS00	A0A3Q2KS00_HORSE	Membrane integral NOTCH2 associated receptor 1	MINAR1	Equus caballus (Horse)		membrane [GO:0016020]		QTPWPAK	0.96464	-0.02277	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2459.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KSC1	A0A3Q2KSC1_HORSE	Peptidase S1 domain-containing protein	LOC111775413	Equus caballus (Horse)	proteolysis [GO:0006508]		serine-type endopeptidase activity [GO:0004252]	LSLLENSNR	0.13978	1.2457	30381	12403	11210	15516	15090	15246	25243	30276	29138	21109	18431	15517	25120	24934	24566	108170	111300	107790	17991	27418	19914	12292	13594	13166	11472	10768	11195	101270	133990	133780	76247	75904	70124	138110	145980	130730	17647	45852	37697	116420	120200	119170	18809	15872	18523	75124	114860	117160	27003	27166	26328	7633.5	19314	16251	11085	17355	12423	96609	103930	99179	21787	21888	23245	8867.4	11265	8976.7	19972	19500	18562	13652	24128	22665	16445	9471.2	12829
A0A3Q2KSH7	A0A3Q2KSH7_HORSE	Translation initiation factor eIF-2B subunit alpha (eIF-2B GDP-GTP exchange factor subunit alpha)	EIF2B1	Equus caballus (Horse)			translation initiation factor activity [GO:0003743]	FISLTSLEYSDYSKCK	0.91289	0.30956	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2751.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2137.4
A0A3Q2KSK4	A0A3Q2KSK4_HORSE	Uncharacterized protein		Equus caballus (Horse)				GPGSGRT	0.93438	0.27835	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	667.81	0	0	0	0	1102	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KSM4	A0A3Q2KSM4_HORSE	FERM domain containing 1	FRMD1	Equus caballus (Horse)		cytoskeleton [GO:0005856]		DSGQRPPHR	0.96488	-0.11065	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	987.44	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KSQ7	A0A3Q2KSQ7_HORSE	Solute carrier family 38 member 10	SLC38A10	Equus caballus (Horse)		membrane [GO:0016020]		SGGAAPR	0.98851	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	352.99	489.56	591.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KTG2	A0A3Q2KTG2_HORSE	Teneurin transmembrane protein 4	TENM4	Equus caballus (Horse)	signal transduction [GO:0007165]	cell projection [GO:0042995]; plasma membrane [GO:0005886]		VFAKHTER	0.98782	-1.8074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	884.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KTM7	A0A3Q2KTM7_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	STK32C	Equus caballus (Horse)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	KVEPGFVPNK	0.98663	-1.0074	0	0	0	0	0	0	404.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1713.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	502.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KTM8	A0A3Q2KTM8_HORSE	Aryl hydrocarbon receptor repressor	AHRR	Equus caballus (Horse)			protein dimerization activity [GO:0046983]	KAPSGTVLPPR	0.98304	-0.82824	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	384.52	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KTQ0	A0A3Q2KTQ0_HORSE	Inhibitory synaptic factor family member 2B	INSYN2B	Equus caballus (Horse)				RVKVSHSFLPR	0.98513	-1.4883	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	885.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	497.96	0	0	0
A0A3Q2KUF1	A0A3Q2KUF1_HORSE	Forkhead associated phosphopeptide binding domain 1	FHAD1	Equus caballus (Horse)				SAEGFFVLNK	0.93133	0.28124	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	574.69	483.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	349.54	0	0	0
A0A3Q2KUL4	A0A3Q2KUL4_HORSE	Large ribosomal subunit protein mL43	MRPL43	Equus caballus (Horse)	mitochondrial translation [GO:0032543]	mitochondrion [GO:0005739]; ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840]	structural constituent of ribosome [GO:0003735]	CLGAVAMTAR	0.96113	-0.14839	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1400.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KV62	A0A3Q2KV62_HORSE	Protein Wnt	WNT8B	Equus caballus (Horse)	canonical Wnt signaling pathway [GO:0060070]; cell fate commitment [GO:0045165]; neuron differentiation [GO:0030182]	extracellular space [GO:0005615]	cytokine activity [GO:0005125]; frizzled binding [GO:0005109]	EVGAHLK	0.98573	-1.0021	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	441.89	0	511.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KVK5	A0A3Q2KVK5_HORSE	Cationic amino acid transporter C-terminal domain-containing protein	LOC100054068	Equus caballus (Horse)	amino acid transport [GO:0006865]	membrane [GO:0016020]	transmembrane transporter activity [GO:0022857]	LKTLEEPTMEK	0.99061	-1.2546	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1018	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KVL3	A0A3Q2KVL3_HORSE	Family with sequence similarity 228 member A	LOC100071602	Equus caballus (Horse)				LSQGNNRKEK	0.96712	-0.17454	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	495.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	631.96	803.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KVL7	A0A3Q2KVL7_HORSE	Zinc finger CCHC-type containing 2	ZCCHC2	Equus caballus (Horse)			nucleic acid binding [GO:0003676]; phosphatidylinositol binding [GO:0035091]; zinc ion binding [GO:0008270]	SLSSINKKK	0.975	0.10394	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	654.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KWF3	A0A3Q2KWF3_HORSE	Lysosomal acid phosphatase (EC 3.1.3.2)	ACP2	Equus caballus (Horse)	dephosphorylation [GO:0016311]; lysosome organization [GO:0007040]	lysosome [GO:0005764]; membrane [GO:0016020]	acid phosphatase activity [GO:0003993]	AGSSRGK	0.66892	0.63294	0	0	0	0	0	0	0	0	0	0	563.55	0	0	0	0	1125.6	0	0	0	0	690.86	0	0	0	0	0	0	1049.1	0	0	0	0	0	1319.9	0	1199.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	624.72	0	0	0	1215.2	1204.6	1070.1	0	0	0	0	0	0	569.85	0	514.53	0	0	0	0	0	0
A0A3Q2KX77	A0A3Q2KX77_HORSE	Leucine rich repeats and calponin homology domain containing 1	LRCH1	Equus caballus (Horse)				LGVPEGK	0.04	1.6233	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	490.54	0	380.55	455.19	503.07	0	474.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	277.52	0	0	0	0	0	0	495.84	0	0	0	356.45	0	743.34	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KXE4	A0A3Q2KXE4_HORSE	"phosphatidylinositol-4,5-bisphosphate 3-kinase (EC 2.7.1.153)"	PIK3CB	Equus caballus (Horse)	phosphatidylinositol phosphate biosynthetic process [GO:0046854]; phosphatidylinositol-mediated signaling [GO:0048015]; phosphorylation [GO:0016310]		"1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity [GO:0046934]; ATP binding [GO:0005524]"	HSDNIMVK	0.13333	1.1559	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	650.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KXV3	A0A3Q2KXV3_HORSE	Trinucleotide repeat containing 18	TNRC18	Equus caballus (Horse)			chromatin binding [GO:0003682]	APALPPEAR	0.97966	-0.28102	0	941.37	829.68	0	0	698.12	0	0	0	1210.4	1548.4	1519.4	0	0	795.49	0	1671.2	0	0	0	726.85	821.34	745.33	0	579.9	598.12	671.63	1320	0	0	0	1945.5	1799.4	0	0	0	1027	1132.2	1143.8	0	0	0	0	565.83	0	0	0	0	0	989.51	0	0	840.24	880.96	0	0	0	801.81	0	0	0	0	0	0	0	0	782.66	0	0	0	1348.2	0	0	1112.8	1051.1
A0A3Q2KY14	A0A3Q2KY14_HORSE	Tubulin--tyrosine ligase (EC 6.3.2.25)	TTL	Equus caballus (Horse)	microtubule cytoskeleton organization [GO:0000226]; protein modification process [GO:0036211]	spindle microtubule [GO:0005876]	tubulin-tyrosine ligase activity [GO:0004835]	RGLPAAAR	0.98368	-0.72933	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2648.1	0	0	0	0	0
A0A3Q2KYD6	A0A3Q2KYD6_HORSE	Sperm flagellar 2	SPEF2	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		NLIELEEK	0.98843	-1.8956	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	884.49	0	0	0	0	0	0	0	501.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KYS4	A0A3Q2KYS4_HORSE	Leptin receptor gene-related protein (Endospanin-1) (OB-R gene-related protein)	LEPROT	Equus caballus (Horse)	negative regulation of growth hormone receptor signaling pathway [GO:0060400]; negative regulation of protein localization to cell surface [GO:2000009]; negative regulation of receptor signaling pathway via JAK-STAT [GO:0046426]	endosome [GO:0005768]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]	signaling receptor binding [GO:0005102]	MGGRQGR	0.98847	-1.7994	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1170.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2KZS9	A0A3Q2KZS9_HORSE	WD repeat domain 4	WDR4	Equus caballus (Horse)	tRNA (guanine-N7)-methylation [GO:0106004]; tRNA modification [GO:0006400]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; tRNA (m7G46) methyltransferase complex [GO:0106143]; tRNA methyltransferase complex [GO:0043527]	enzyme activator activity [GO:0008047]	GAVSLRAGGGGPGR	0.98445	-0.69359	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	723.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	389.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L009	A0A3Q2L009_HORSE	Myelin and lymphocyte protein	LOC102147863	Equus caballus (Horse)		membrane [GO:0016020]		MAPGGGR	0.95528	0.22332	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	329.66	0	0	0	0
A0A3Q2L0G7	A0A3Q2L0G7_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)	retrotransposition [GO:0032197]	ribonucleoprotein complex [GO:1990904]	single-stranded RNA binding [GO:0003727]	ILYPARVSFR	0.98676	-1.277	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	547.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L0M6	A0A3Q2L0M6_HORSE	HECT domain E3 ubiquitin protein ligase 4	HECTD4	Equus caballus (Horse)			ubiquitin-protein transferase activity [GO:0004842]	LPHLFTR	0.98906	-1.2156	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	287.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1832.3	0	0	0	0	0	2200.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L1L7	A0A3Q2L1L7_HORSE	Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12)	USP37	Equus caballus (Horse)	cell cycle [GO:0007049]; cell division [GO:0051301]; proteolysis [GO:0006508]		cysteine-type deubiquitinase activity [GO:0004843]	RYSFNVALSLNNK	0.88384	0.37871	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	685.83	0
A0A3Q2L1M1	A0A3Q2L1M1_HORSE	Ring finger protein 224	RNF224	Equus caballus (Horse)			metal ion binding [GO:0046872]	TVQDAAARR	0.98242	-0.81143	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1465.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L1R7	A0A3Q2L1R7_HORSE	Potassium channel tetramerization domain containing 17	KCTD17	Equus caballus (Horse)	positive regulation of cilium assembly [GO:0045724]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein homooligomerization [GO:0051260]	Cul3-RING ubiquitin ligase complex [GO:0031463]; cytoplasm [GO:0005737]	cullin family protein binding [GO:0097602]	AGGGWGK	0.94688	0.23726	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	510.58	0	419.99	291.7	0	0	0	452.6	0	0	0	0	0	0	0	0	277.37	0	0	319.82	0	0	0	0	391.47	0	0	813.43	0	0	0	0	0	0	0	0	0	0	0	336.85	0	0	0	0	0	0	0
A0A3Q2L1V3	A0A3Q2L1V3_HORSE	Chromosome 10 C19orf47 homolog	C10H19orf47	Equus caballus (Horse)		nucleoplasm [GO:0005654]; nucleus [GO:0005634]		ARETMVSVTMATSEWIQFFK	0.89489	0.43291	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1843.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L3D0	A0A3Q2L3D0_HORSE	Rap1 GTPase-GDP dissociation stimulator 1	RAP1GDS1	Equus caballus (Horse)		endoplasmic reticulum [GO:0005783]; mitochondrion [GO:0005739]	guanyl-nucleotide exchange factor activity [GO:0005085]	LQDNLSDTLK	0.96247	-0.13331	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1071	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L473	A0A3Q2L473_HORSE	E3 ubiquitin-protein ligase (EC 2.3.2.26)	WWP2	Equus caballus (Horse)	protein ubiquitination [GO:0016567]		transferase activity [GO:0016740]	IALSSMVATR	0.96227	-0.13381	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	501.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L4Y1	A0A3Q2L4Y1_HORSE	diacylglycerol kinase (ATP) (EC 2.7.1.107)	DGKE	Equus caballus (Horse)	glycerolipid metabolic process [GO:0046486]; phosphorylation [GO:0016310]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]	membrane [GO:0016020]	ATP binding [GO:0005524]; ATP-dependent diacylglycerol kinase activity [GO:0004143]; metal ion binding [GO:0046872]	APSLFSSRILNK	0.95319	0.23211	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	538.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	461.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L5R4	A0A3Q2L5R4_HORSE	C-type lectin domain-containing protein		Equus caballus (Horse)	immune response [GO:0006955]			LSLFLAVVFR	0.96598	-0.1523	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4909.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L5S5	A0A3Q2L5S5_HORSE	Ventricular zone expressed PH domain containing 1	VEPH1	Equus caballus (Horse)				KASAEIEFPEK	0.86883	0.40175	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	313.06	0	0	0	0	0	0	0	0
A0A3Q2L707	A0A3Q2L707_HORSE	WDFY family member 4	WDFY4	Equus caballus (Horse)				HGAVTEGHPLR	0.96436	-0.13109	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	575.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L7C1	A0A3Q2L7C1_HORSE	Centrosomal protein 170	CEP170	Equus caballus (Horse)				IDLLAQPRR	0.98412	-1.1721	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1397.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L7I7	A0A3Q2L7I7_HORSE	Multiple EGF like domains 6	MEGF6	Equus caballus (Horse)			calcium ion binding [GO:0005509]	LSGAMHR	0.98527	-1.3195	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	314.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L870	A0A3Q2L870_HORSE	Receptor protein-tyrosine kinase (EC 2.7.10.1)	EGFR	Equus caballus (Horse)	negative regulation of apoptotic process [GO:0043066]; neurogenesis [GO:0022008]; phosphorylation [GO:0016310]; positive regulation of epithelial cell proliferation [GO:0050679]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	basal plasma membrane [GO:0009925]; receptor complex [GO:0043235]	ATP binding [GO:0005524]; epidermal growth factor binding [GO:0048408]; epidermal growth factor receptor activity [GO:0005006]	FRELIIEFSK	0.9899	-1.6753	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	340.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L918	A0A3Q2L918_HORSE	Ig-like domain-containing protein		Equus caballus (Horse)				NTAGRNRVK	0.90756	0.29793	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	616.73	0	0	0	0	664.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L9A9	A0A3Q2L9A9_HORSE	Collapsin response mediator protein 1	CRMP1	Equus caballus (Horse)		cytoplasm [GO:0005737]	"hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [GO:0016810]"	KPFPEYLYQR	0.96461	-0.11706	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	743.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L9G4	A0A3Q2L9G4_HORSE	Regulating synaptic membrane exocytosis 2	RIMS2	Equus caballus (Horse)	exocytosis [GO:0006887]; intracellular protein transport [GO:0006886]	membrane [GO:0016020]; synapse [GO:0045202]	metal ion binding [GO:0046872]; small GTPase binding [GO:0031267]	ISMLRMERPSR	0.98498	-2.1205	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2507.8	0	0	0	0	2479.2	0	0	0	0	1376.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L9G7	A0A3Q2L9G7_HORSE	FHA domain-containing protein	MKI67	Equus caballus (Horse)	cell cycle [GO:0007049]; regulation of chromosome segregation [GO:0051983]; regulation of mitotic nuclear division [GO:0007088]	chromosome [GO:0005694]; nucleus [GO:0005634]		EVLQMPAHAKK	0.98632	-1.9836	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	562.38	0	0	0	0	0	0	0	0	413.22	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2L9L1	A0A3Q2L9L1_HORSE	Nuclear receptor subfamily 4 group A member 2	NR4A2	Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]	nuclear receptor activity [GO:0004879]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	LSQRPRDFQ	0.97099	-0.18077	312.36	0	0	0	0	0	0	0	0	0	0	0	0	0	776.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	942.34	0	0	0	0	0	0	0	1119	0	0	742.78	0	0	0	0	0	0	0	0	0	0	0	604.93	0	0	0	0	0	0	0	0	0	0	0	604.2	0	0	0	383.81
A0A3Q2LAK1	A0A3Q2LAK1_HORSE	t-SNARE domain containing 1	TSNARE1	Equus caballus (Horse)	vesicle-mediated transport [GO:0016192]	membrane [GO:0016020]		LADGVEALNR	0.97639	0.11739	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	867.55	0	0	0	0	1258	0	0	0	0	0	0	0	1899.7	0	0	0	0	0	1166.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LAN4	A0A3Q2LAN4_HORSE	Aminopeptidase (EC 3.4.11.-)	ANPEP	Equus caballus (Horse)	peptide catabolic process [GO:0043171]; proteolysis [GO:0006508]	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]	metalloaminopeptidase activity [GO:0070006]; peptide binding [GO:0042277]; zinc ion binding [GO:0008270]	AKGFFVPK	0.96796	-0.041635	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	949.69	1310.6	1100.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LBC7	A0A3Q2LBC7_HORSE	Protein unc-119 homolog A	UNC119 PIGS	Equus caballus (Horse)	lipoprotein transport [GO:0042953]; mitotic cytokinesis [GO:0000281]; negative regulation of caveolin-mediated endocytosis [GO:2001287]; negative regulation of clathrin-dependent endocytosis [GO:1900186]; nervous system development [GO:0007399]; visual perception [GO:0007601]	centrosome [GO:0005813]; intercellular bridge [GO:0045171]; spindle midzone [GO:0051233]; spindle pole [GO:0000922]	lipid binding [GO:0008289]	IDFVRFKIR	0.97541	0.10394	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	547.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LBE4	A0A3Q2LBE4_HORSE	Insulin like growth factor binding protein acid labile subunit	IGFALS	Equus caballus (Horse)		insulin-like growth factor ternary complex [GO:0042567]; plasma membrane [GO:0005886]		NLPEQVFQGLGK	0.87555	0.39597	0	0	0	0	638.19	502.13	0	0	0	0	533.98	647.76	496.42	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2818.7	2617	0	0	0	0	900.77	872.07	836.44	1451.7	0	0	424.92	0	0	0	0	0	0	0	0	0	0	0	714.43	0	0	1938.9	0	0	1493.7	1269.9	1073.5	0	0	1278.3	1293.1	0	0
A0A3Q2LBF6	A0A3Q2LBF6_HORSE	Very low density lipoprotein receptor	VLDLR	Equus caballus (Horse)	endocytosis [GO:0006897]	membrane [GO:0016020]	calcium ion binding [GO:0005509]	CITLLWK	0.97824	0.067631	0	0	0	0	0	0	0	0	0	0	0	0	543.9	0	0	0	0	0	0	0	947.89	0	0	0	0	0	0	0	0	0	0	0	0	0	0	644.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LBP6	A0A3Q2LBP6_HORSE	Complement factor D (EC 3.4.21.46) (Adipsin) (C3 convertase activator) (Properdin factor D)	CFD	Equus caballus (Horse)	proteolysis [GO:0006508]		serine-type endopeptidase activity [GO:0004252]	EAAVGGGGK	0.96931	0.16207	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	402.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LCS6	A0A3Q2LCS6_HORSE	Ubiquitin specific peptidase 35	USP35	Equus caballus (Horse)			cysteine-type deubiquitinase activity [GO:0004843]	MKEERVK	0.97963	-0.34868	0	0	0	0	0	0	0	0	1256.4	0	0	2922.4	0	0	0	0	0	0	1476.4	0	0	0	0	0	0	0	0	0	1091.5	0	0	0	0	0	0	0	1129.4	0	0	0	0	0	0	0	0	0	0	1208.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	973.12	0	0	1676.8	0	1767.5
A0A3Q2LE32	A0A3Q2LE32_HORSE	Nuclear mitotic apparatus protein 1	NUMA1	Equus caballus (Horse)				ELEELRGK	0.98726	-3.5744	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	491.78	515.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1107.6	1133.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LE61	A0A3Q2LE61_HORSE	GDNF family receptor alpha 4	GFRA4	Equus caballus (Horse)	negative regulation of ossification [GO:0030279]; nervous system development [GO:0007399]; ossification [GO:0001503]	external side of plasma membrane [GO:0009897]; receptor complex [GO:0043235]	glial cell-derived neurotrophic factor receptor activity [GO:0016167]	EGAGQSLPPVR	0.96454	-0.092444	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	371.21	266.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LEH6	A0A3Q2LEH6_HORSE	ATPase family AAA domain containing 3A	ATAD3A	Equus caballus (Horse)			ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]	EYEAAVEQLK	0.13861	1.1783	840.85	0	0	0	0	0	1106	1078.2	1236.6	0	1491.2	0	2291.3	2382.6	2301.3	2731.8	2694.7	2817.2	0	0	1288.7	514.29	1083.8	637.27	438.62	0	0	2792	2655.2	2515.1	0	0	0	2000.4	0	0	1259.8	0	0	3049.3	0	2918.9	1245.7	1256.5	1288.3	2592.6	0	0	2160.6	2011.5	2041	755.09	2838.4	352.28	720.38	851.53	0	953.34	0	0	0	1197.2	1192	813.12	817.26	745.55	1389	1422.1	1369.2	0	0	1966.9	1114.3	1092	1092.8
A0A3Q2LFB3	A0A3Q2LFB3_HORSE	"Actin, alpha cardiac muscle 1 (Alpha-cardiac actin)"	ACTC1	Equus caballus (Horse)	actin filament organization [GO:0007015]; actin-myosin filament sliding [GO:0033275]; cardiac muscle tissue morphogenesis [GO:0055008]; cardiac myofibril assembly [GO:0055003]; heart contraction [GO:0060047]; negative regulation of apoptotic process [GO:0043066]; skeletal muscle thin filament assembly [GO:0030240]	actin filament [GO:0005884]; glutamatergic synapse [GO:0098978]; I band [GO:0031674]; sarcomere [GO:0030017]	ATP binding [GO:0005524]; microfilament motor activity [GO:0000146]; myosin binding [GO:0017022]	AGFAGDDAPR	0.96386	-0.021745	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	420.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LG52	A0A3Q2LG52_HORSE	Nuclear factor related to kappaB binding protein	NFRKB	Equus caballus (Horse)		Ino80 complex [GO:0031011]		DAAARLPNGEGTRAEICELLK	0.93481	0.26679	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	505.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LGS2	A0A3Q2LGS2_HORSE	Neutral sphingomyelinase activation associated factor	NSMAF	Equus caballus (Horse)				APKTSRK	0.98555	-1.4085	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	603.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LHT1	A0A3Q2LHT1_HORSE	LDL receptor related protein 2	LRP2	Equus caballus (Horse)	receptor-mediated endocytosis [GO:0006898]	apical plasma membrane [GO:0016324]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]	calcium ion binding [GO:0005509]; hormone binding [GO:0042562]	DIVVDPK	0.96498	-0.1514	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1547.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LHU8	A0A3Q2LHU8_HORSE	Secretion regulating guanine nucleotide exchange factor	SERGEF	Equus caballus (Horse)				SQEAMDKEKLEGK	0.88427	0.35015	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1615.6	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LIP2	A0A3Q2LIP2_HORSE	Ubiquitin specific peptidase 36	USP36	Equus caballus (Horse)			cysteine-type deubiquitinase activity [GO:0004843]	AASLSYR	0.96832	-0.034804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6204	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LIS9	A0A3Q2LIS9_HORSE	Calcyclin binding protein	CACYBP	Equus caballus (Horse)	heart development [GO:0007507]	nucleus [GO:0005634]	S100 protein binding [GO:0044548]; tubulin binding [GO:0015631]; ubiquitin protein ligase binding [GO:0031625]	VVPGAAAAR	0.96463	-0.11065	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2167.1	0
A0A3Q2LJE4	A0A3Q2LJE4_HORSE	CCHC-type domain-containing protein		Equus caballus (Horse)	virion assembly [GO:0019068]		nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	QLGHWSK	0.9704	-0.029017	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2298.7	2107.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LJH9	A0A3Q2LJH9_HORSE	Decaprenyl diphosphate synthase subunit 2	PDSS2	Equus caballus (Horse)	isoprenoid biosynthetic process [GO:0008299]		transferase activity [GO:0016740]	GVTSAIDLCR	0.99058	-1.2515	0	1362.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3126.5	0	0	0	0	0	1561.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LJQ0	A0A3Q2LJQ0_HORSE	Microtubule-associated protein	MAP4	Equus caballus (Horse)		cytosol [GO:0005829]; microtubule [GO:0005874]; plasma membrane [GO:0005886]	microtubule binding [GO:0008017]	DKILEAPEKMTEK	0.86757	0.46262	0	0	0	0	0	0	0	0	0	0	1160.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3373.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LJT5	A0A3Q2LJT5_HORSE	DAP3 binding cell death enhancer 1	DELE1	Equus caballus (Horse)	extrinsic apoptotic signaling pathway via death domain receptors [GO:0008625]	mitochondrion [GO:0005739]		EPYLDEQRAVK	0.98581	-1.9893	0	0	0	0	0	0	1258.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LKX4	A0A3Q2LKX4_HORSE	Protein disulfide-isomerase A4 (EC 5.3.4.1) (Endoplasmic reticulum resident protein 72)	PDIA4	Equus caballus (Horse)		endoplasmic reticulum lumen [GO:0005788]	protein disulfide isomerase activity [GO:0003756]	LSRTREEL	0.31694	0.81065	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1710.8	0	0	0	0	0	0	0	0	0	0	1254.6	1721.3	0	0	0	0	0	1537.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LL48	A0A3Q2LL48_HORSE	Cohesin subunit SA (SCC3 homolog) (Stromal antigen)	STAG2	Equus caballus (Horse)	cell division [GO:0051301]; chromosome segregation [GO:0007059]; sister chromatid cohesion [GO:0007062]	"chromatin [GO:0000785]; chromosome, centromeric region [GO:0000775]; cohesin complex [GO:0008278]; nucleus [GO:0005634]"		LEKHLDALLR	0.98689	-1.9069	0	0	0	0	0	0	0	1149	0	2235.7	0	0	720.31	0	0	0	0	0	0	0	0	0	1551.5	1585.6	0	1135.8	1118.2	1024.8	1091.5	0	0	0	0	0	0	0	0	0	1174.9	0	0	0	0	0	0	0	0	1208.3	0	0	0	1367.9	0	0	0	0	1031.4	0	0	0	0	0	0	494.04	0	0	0	1078.2	0	0	0	0	0	0	0
A0A3Q2LLK2	A0A3Q2LLK2_HORSE	Coiled-coil domain containing 68	CCDC68	Equus caballus (Horse)				LSLENKLLQLKSNTAYAK	0.44186	0.66194	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	662.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	863.8	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LLN3	A0A3Q2LLN3_HORSE	DM domain-containing protein	LOC111772362	Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]	nucleus [GO:0005634]	metal ion binding [GO:0046872]; sequence-specific DNA binding [GO:0043565]	VHLKRHLAQGLIR	0.97992	-0.21324	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	582.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LLS5	A0A3Q2LLS5_HORSE	Striatin interacting protein 2	STRIP2	Equus caballus (Horse)				LEVVSRERR	0.31892	0.80808	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3380.4	3607.7	3703.6	0	0	0	0	0	0	0	0	0	0	0	0	1847.1	1695.1	1779.5
A0A3Q2LLW9	A0A3Q2LLW9_HORSE	Calcium-transporting ATPase (EC 7.2.2.10)	ATP2C2	Equus caballus (Horse)	calcium ion transmembrane transport [GO:0070588]; intracellular calcium ion homeostasis [GO:0006874]; manganese ion transport [GO:0006828]	endoplasmic reticulum [GO:0005783]; Golgi membrane [GO:0000139]; plasma membrane [GO:0005886]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; P-type calcium transporter activity [GO:0005388]; P-type manganese transporter activity [GO:0140613]	ILLAGPVAEAPL	0.96596	-0.083242	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3008.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LMN8	A0A3Q2LMN8_HORSE	Adhesion G protein-coupled receptor L1	ADGRL1	Equus caballus (Horse)	cell surface receptor signaling pathway [GO:0007166]	membrane [GO:0016020]	G protein-coupled receptor activity [GO:0004930]	GSGSGAK	0.91353	0.30224	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	552.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1272.2	0	0	0	0	0	0	0	0	0	293.88	0	0	0	1456.1	0	0	0	0	253.27	0	0	358.36	0	273.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LNT4	A0A3Q2LNT4_HORSE	High mobility group AT-hook 2	HMGA2	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	WYVHDWRK	0.98147	-0.62107	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	479.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LP08	A0A3Q2LP08_HORSE	Capicua transcriptional repressor	CIC	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	RVPAVQRDSPVIVR	0.98763	-1.7236	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1575.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	513.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LPY1	A0A3Q2LPY1_HORSE	Transmembrane and coiled-coil domain family 3	TMCC3	Equus caballus (Horse)		endomembrane system [GO:0012505]; membrane [GO:0016020]		LEQYHRK	0.98355	-0.2243	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	852.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LQA5	A0A3Q2LQA5_HORSE	Ral transcription factor IIIC subunit 3	GTF3C3	Equus caballus (Horse)	transcription by RNA polymerase III [GO:0006383]	fibrillar center [GO:0001650]; nuclear membrane [GO:0031965]; nucleoplasm [GO:0005654]; transcription factor TFIIIC complex [GO:0000127]	RNA polymerase III general transcription initiation factor activity [GO:0000995]	ALELPPLVVEK	0.97909	-0.28543	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2600.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LQX9	A0A3Q2LQX9_HORSE	UDP-glucose 4-epimerase (EC 5.1.3.2)	GALE	Equus caballus (Horse)	galactose catabolic process via UDP-galactose [GO:0033499]	cytosol [GO:0005829]	protein homodimerization activity [GO:0042803]; UDP-glucose 4-epimerase activity [GO:0003978]; UDP-N-acetylglucosamine 4-epimerase activity [GO:0003974]	ASGKKVK	0.96675	-0.1039	0	0	0	0	0	0	0	0	0	0	586.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LSE0	A0A3Q2LSE0_HORSE	Maestro heat like repeat family member 7		Equus caballus (Horse)		cytoplasm [GO:0005737]		KVLVFPLK	0.9835	-0.69024	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	934.33	0	0	0	0	0	0	1386.1	0	0	0	1262.9	1396.4	0	0	0	0	0	1105.8	0	835.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1227.7	0	0	0	0	0	0	0	0
A0A3Q2LSJ6	A0A3Q2LSJ6_HORSE	Aspartate beta-hydroxylase	ASPH	Equus caballus (Horse)	positive regulation of proteolysis [GO:0045862]	cortical endoplasmic reticulum [GO:0032541]; plasma membrane [GO:0005886]	peptidyl-aspartic acid 3-dioxygenase activity [GO:0062101]	SLIFLIQRR	0.9865	-2.4181	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	392.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LT24	A0A3Q2LT24_HORSE	CASK interacting protein 2	CASKIN2	Equus caballus (Horse)		cytoplasm [GO:0005737]		LVAKVKASK	0.97215	-0.20638	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	934.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3Q2LU55	A0A3Q2LU55_HORSE	Collagen type XX alpha 1 chain	COL20A1	Equus caballus (Horse)		collagen trimer [GO:0005581]; collagen-containing extracellular matrix [GO:0062023]; extracellular region [GO:0005576]		VGLQGPKGWR	0.98701	-1.9062	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	900.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PEA6	A0A5F5PEA6_HORSE	"ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3"	ARAP3	Equus caballus (Horse)	signal transduction [GO:0007165]		GTPase activator activity [GO:0005096]	ESPRVGLLR	0.99101	-1.2368	0	0	0	0	0	0	0	0	1466.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PER0	A0A5F5PER0_HORSE	Neuroligin 1	NLGN1	Equus caballus (Horse)	chemical synaptic transmission [GO:0007268]; modulation of chemical synaptic transmission [GO:0050804]; neuron cell-cell adhesion [GO:0007158]; postsynaptic membrane assembly [GO:0097104]; presynaptic membrane assembly [GO:0097105]; synaptic vesicle endocytosis [GO:0048488]	cell surface [GO:0009986]; plasma membrane [GO:0005886]; presynapse [GO:0098793]; synapse [GO:0045202]	neurexin family protein binding [GO:0042043]; signaling receptor activity [GO:0038023]	ECARKPGKK	0.97541	0.089044	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1171.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PF23	A0A5F5PF23_HORSE	Transaldolase (EC 2.2.1.2)	TALDO1	Equus caballus (Horse)	"carbohydrate metabolic process [GO:0005975]; pentose-phosphate shunt, non-oxidative branch [GO:0009052]"	cytoplasm [GO:0005737]	transaldolase activity [GO:0004801]	RPSAGCTTR	0.96428	-0.11482	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	758.42	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PFM2	A0A5F5PFM2_HORSE	Mitochondrial ribosomal protein S36	MRPS36	Equus caballus (Horse)	2-oxoglutarate metabolic process [GO:0006103]	mitochondrial oxoglutarate dehydrogenase complex [GO:0009353]		SAFSQGSRVK	0.98681	-1.9197	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	632.46	0	0	0	0	0	0	1027.3	0	1208.1	0	0	545.86	0	0	0	0	0	0	0	0	0	0	0	1652.5	0	0	0	0	583.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PFQ1	A0A5F5PFQ1_HORSE	Leucine rich melanocyte differentiation associated		Equus caballus (Horse)	melanocyte differentiation [GO:0030318]			GVLGKCR	0.98815	-1.7843	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1517.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PG55	A0A5F5PG55_HORSE	"MAGI family member, X-linked"	MAGIX	Equus caballus (Horse)				GLPPPAGSSAR	0.97173	-0.060487	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2620.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PGA3	A0A5F5PGA3_HORSE	Integrin subunit beta like 1	ITGBL1	Equus caballus (Horse)				KSNQMCK	0.98346	-0.72386	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	475.04	0	0	0
A0A5F5PGD0	A0A5F5PGD0_HORSE	"DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease"	DIS3	Equus caballus (Horse)		exosome (RNase complex) [GO:0000178]; nucleus [GO:0005634]	RNA binding [GO:0003723]; RNA nuclease activity [GO:0004540]	ESRRHLFTPADK	0.96226	-0.14249	0	0	0	0	0	0	0	0	0	0	0	0	541.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	567.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	534.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	488.81
A0A5F5PGD4	A0A5F5PGD4_HORSE	C2H2-type domain-containing protein	LOC100629361	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]		"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	AFSLHAYLKK	0.98475	-0.84504	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	511.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PGT3	A0A5F5PGT3_HORSE	Vacuolar protein sorting 13 homolog C	VPS13C	Equus caballus (Horse)	lipid transport [GO:0006869]			IQIIGLGTQVSQRPGAQALKVEAK	0.9861	-3.3288	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	662.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	410.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PGZ0	A0A5F5PGZ0_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	DAPK1	Equus caballus (Horse)	cellular response to chemical stimulus [GO:0070887]; macromolecule metabolic process [GO:0043170]; nitrogen compound metabolic process [GO:0006807]; phosphorylation [GO:0016310]; primary metabolic process [GO:0044238]; regulation of response to stimulus [GO:0048583]; response to organic substance [GO:0010033]; response to stress [GO:0006950]; signal transduction [GO:0007165]	cytoplasm [GO:0005737]	ATP binding [GO:0005524]; GTP binding [GO:0005525]; protein serine/threonine kinase activity [GO:0004674]	ALHHYRGR	0.98828	-1.2008	0	0	0	0	0	0	0	0	514.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PH11	A0A5F5PH11_HORSE	Cationic amino acid transporter C-terminal domain-containing protein	LOC100056096	Equus caballus (Horse)		membrane [GO:0016020]	transmembrane transporter activity [GO:0022857]	FSSGSVT	0.9647	0.21339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	360.67
A0A5F5PH74	A0A5F5PH74_HORSE	Pleckstrin homology and RhoGEF domain containing G6	PLEKHG6	Equus caballus (Horse)			GTPase activator activity [GO:0005096]; guanyl-nucleotide exchange factor activity [GO:0005085]	GGLVLDLGR	0.96398	-0.11391	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1327.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PH79	A0A5F5PH79_HORSE	Zinc finger protein 462	ZNF462	Equus caballus (Horse)	positive regulation of transcription by RNA polymerase II [GO:0045944]	nucleus [GO:0005634]		KHPGMKVK	0.27778	0.87283	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3439.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PH83	A0A5F5PH83_HORSE	Zinc finger protein 638	ZNF638	Equus caballus (Horse)	RNA splicing [GO:0008380]	nucleoplasm [GO:0005654]	RNA binding [GO:0003723]; zinc ion binding [GO:0008270]	AGIVSSPK	0.98586	-2.7534	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2783	0	0	0	0	71661	0	0	0	0	0	0	0	0	2796.3	0	0	0	0	0	0	0	0	0	1634.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PHI5	A0A5F5PHI5_HORSE	Olfactomedin 3	OLFM3	Equus caballus (Horse)		extracellular region [GO:0005576]; synapse [GO:0045202]		TLMTKHFQELK	0.98822	-1.869	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1486.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PHR0	A0A5F5PHR0_HORSE	Metaxin 2	MTX2	Equus caballus (Horse)	protein transport [GO:0015031]	SAM complex [GO:0001401]		GAMSAPR	0.98813	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	283.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PHR5	A0A5F5PHR5_HORSE	Adhesion G protein-coupled receptor L2	ADGRL2	Equus caballus (Horse)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; cell surface receptor signaling pathway [GO:0007166]	membrane [GO:0016020]	carbohydrate binding [GO:0030246]; G protein-coupled receptor activity [GO:0004930]	AALPFGLVR	0.98849	-1.1462	0	2878.8	2730.9	0	2821.9	2931.1	0	0	0	0	0	4851.9	0	2473.6	2030.2	0	0	0	2473.5	0	2665.1	0	2449.3	2198	1998.5	0	0	0	0	3406.4	6995.5	0	0	636.62	6509.9	6881.5	0	0	3715.6	0	2228	2568.1	0	2015.5	0	0	0	3263.3	0	3308.4	3349.7	2560.1	359.94	0	0	0	1699	0	506.18	0	2259.1	0	2490.1	1369.9	0	0	0	2216.4	0	0	0	0	0	0	0
A0A5F5PHU1	A0A5F5PHU1_HORSE	Spermatogenesis-associated protein 31E1-like	LOC102147401	Equus caballus (Horse)		membrane [GO:0016020]		TSQGQQQPR	0.87898	0.45092	0	0	0	0	0	0	0	0	1466.8	0	1373.5	1340.1	1714.5	1662.2	1642.8	3344.6	3555.7	0	0	0	1381.4	0	0	0	0	0	0	2076.8	2773.7	2672.9	2361.6	2441.4	2354.8	3000.5	3580.9	2510.6	0	0	1365	2387.9	2269	2214.8	0	0	0	2524.2	3519.2	3135.6	678.15	801.61	672.5	0	1230.7	1358.8	0	0	0	1414	1530.2	0	0	0	1623.8	575.32	528.35	613.21	0	685.29	0	0	0	0	739.01	702.95	658
A0A5F5PHU4	A0A5F5PHU4_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	SIK3	Equus caballus (Horse)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	LGDTDPNFDRLIAECQQLK	0.98388	-0.73317	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1020.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	792.34	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PHY7	A0A5F5PHY7_HORSE	"NPHS2 stomatin family member, podocin"	NPHS2	Equus caballus (Horse)		plasma membrane [GO:0005886]		GGGSPHK	0.98485	-2.1346	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	374.22	0	0	0	0	0	0	0	0	0	465.9	0	0	0	0	0	0	0	0	0	0	0	0	347.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PI03	A0A5F5PI03_HORSE	SFI1 centrin binding protein	C2H1orf167	Equus caballus (Horse)				ILLLFVGKIK	0.983	-0.90948	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1873.5	1582	2184.3	1961.7	2485.6	1807.6	1727.8	1441.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PI08	A0A5F5PI08_HORSE	E3 ubiquitin protein ligase (EC 2.3.2.27)	RNF40	Equus caballus (Horse)	chromatin organization [GO:0006325]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein ubiquitination [GO:0016567]	HULC complex [GO:0033503]; nucleoplasm [GO:0005654]	metal ion binding [GO:0046872]; mRNA 3'-UTR binding [GO:0003730]; protein homodimerization activity [GO:0042803]; ubiquitin protein ligase binding [GO:0031625]; ubiquitin-protein transferase activity [GO:0004842]	EVQAEIGK	0.97896	-0.39938	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	348.47	0	0	0	0	0	0	0	0
A0A5F5PI32	A0A5F5PI32_HORSE	Ig-like domain-containing protein		Equus caballus (Horse)		plasma membrane [GO:0005886]		RPVITGTR	0.97273	0.049574	0	0	0	1988.6	0	0	0	0	0	0	3045.8	3334.8	0	0	0	0	0	0	0	0	1695.2	0	0	0	1249.2	0	0	0	0	0	0	0	0	0	0	0	2267.2	0	2441.9	0	0	0	0	0	0	0	0	0	0	0	2510.5	0	1629.8	0	0	0	0	0	0	0	0	0	0	0	0	0	1502.5	0	1592.2	0	2858.8	0	0	0	0
A0A5F5PID9	A0A5F5PID9_HORSE	Zinc finger protein 362	ZNF362	Equus caballus (Horse)				ALRMAEPR	0.98832	-1.2049	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1316	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PIS4	A0A5F5PIS4_HORSE	Regulator of G protein signaling 14	RGS14	Equus caballus (Horse)	signal transduction [GO:0007165]	cytoplasm [GO:0005737]	GTPase activator activity [GO:0005096]	FVKSPLYR	0.98611	-2.708	0	0	0	0	0	0	0	0	0	0	0	232.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	422.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PIV4	A0A5F5PIV4_HORSE	Unc-13 homolog B	UNC13B	Equus caballus (Horse)	"dense core granule priming [GO:0061789]; neuromuscular junction development [GO:0007528]; presynaptic dense core vesicle exocytosis [GO:0099525]; synaptic transmission, glutamatergic [GO:0035249]; synaptic vesicle docking [GO:0016081]; synaptic vesicle maturation [GO:0016188]; synaptic vesicle priming [GO:0016082]"	neuromuscular junction [GO:0031594]; plasma membrane [GO:0005886]; presynaptic active zone cytoplasmic component [GO:0098831]; presynaptic membrane [GO:0042734]; synaptic vesicle membrane [GO:0030672]; terminal bouton [GO:0043195]	calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516]; diacylglycerol binding [GO:0019992]; phospholipid binding [GO:0005543]; syntaxin-1 binding [GO:0017075]	ASTTLPR	0.9866	-1.4443	0	0	0	0	0	0	0	0	0	445.63	608.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	609.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PIZ5	A0A5F5PIZ5_HORSE	Titin	TTN	Equus caballus (Horse)		organelle [GO:0043226]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	AITQGGKYK	0.98794	-14.338	982.37	0	15827	6013.9	0	0	0	0	0	1552	1088.8	692.28	6000.9	541.69	0	1449.5	3053.9	0	0	0	609.98	5642	584.4	1250.2	0	0	0	708.04	0	0	0	0	599.58	3402	7477.4	1555	0	804.88	750.83	0	0	1291.8	508.31	0	0	976.13	0	25628	4667	1065.2	639.78	0	0	615.6	8482.9	9568.8	10894	0	1875	0	0	0	3599.5	1374.4	0	7079.3	0	2453.8	12428	671.73	636.52	619.41	0	0	20784
A0A5F5PJ68	A0A5F5PJ68_HORSE	SEC14 and spectrin domain containing 1	SESTD1	Equus caballus (Horse)			"phosphatidylinositol-3,4-bisphosphate binding [GO:0043325]; phosphatidylinositol-3,5-bisphosphate binding [GO:0080025]; phosphatidylinositol-3-phosphate binding [GO:0032266]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]; phosphatidylinositol-4-phosphate binding [GO:0070273]; phosphatidylinositol-5-phosphate binding [GO:0010314]"	KKLAFLSGGK	0.98972	-1.6212	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	377.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	586.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PJT4	A0A5F5PJT4_HORSE	Zinc finger protein 84	ZNF84	Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]			PAKGHQPHR	0.98825	-1.081	0	0	453.62	0	0	0	0	0	0	0	0	0	0	0	897.24	0	0	0	0	0	0	0	0	1242.6	0	0	518.77	0	0	0	0	0	2184.3	580.3	0	0	0	0	0	0	0	0	0	735.81	0	0	0	0	1158.4	0	0	0	0	0	0	0	0	0	0	0	529.85	0	0	0	0	0	0	0	0	0	0	0	0	647.21	0
A0A5F5PJU8	A0A5F5PJU8_HORSE	Cellular tumor antigen p53	TP73	Equus caballus (Horse)	apoptotic process [GO:0006915]; cell cycle [GO:0007049]; protein tetramerization [GO:0051262]; rhythmic process [GO:0048511]	centrosome [GO:0005813]; endoplasmic reticulum [GO:0005783]; mitochondrial matrix [GO:0005759]; PML body [GO:0016605]	DNA-binding transcription factor activity [GO:0003700]; metal ion binding [GO:0046872]; transcription cis-regulatory region binding [GO:0000976]	NAAAGKR	0.92494	0.28793	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	683.97	593.91	0	0	0	0	0	0	0	0	623.61	772.68	702.53	681.34	0	0	0	0	0	0	646.47	651.85	837.34	0	0	0	547.41	0	0	590.61	532.28	529.21	0	0	0	0	0	0	918.58	1025.3	834.36	0	0	0	0	0	0	0	0	0	0	610.55	578.08	0	0	0
A0A5F5PK21	A0A5F5PK21_HORSE	FXYD domain-containing ion transport regulator	FXYD2	Equus caballus (Horse)	monoatomic ion transport [GO:0006811]; regulation of monoatomic ion transport [GO:0043269]	membrane [GO:0016020]	ion channel regulator activity [GO:0099106]	GAGGSPK	0.98828	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	430.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	374.74	0	0	0	0	0	0	0
A0A5F5PK66	A0A5F5PK66_HORSE	"alpha-1,2-Mannosidase (EC 3.2.1.-)"	MAN1C1	Equus caballus (Horse)	carbohydrate metabolic process [GO:0005975]	membrane [GO:0016020]	"calcium ion binding [GO:0005509]; mannosyl-oligosaccharide 1,2-alpha-mannosidase activity [GO:0004571]"	EEKRAHYR	0.9848	-0.98803	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	786.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PKB8	A0A5F5PKB8_HORSE	Zinc finger and BTB domain containing 41	ZBTB41	Equus caballus (Horse)				SVRERTTLK	0.88419	0.44806	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	499.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PKN1	A0A5F5PKN1_HORSE	Protocadherin 9	PCDH9	Equus caballus (Horse)	cell adhesion [GO:0007155]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]	SLRWASGTPRVS	0.96232	-0.0044454	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	493.65	0	0	418.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3022	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PKY4	A0A5F5PKY4_HORSE	Protein odr-4 homolog	ODR4	Equus caballus (Horse)		membrane [GO:0016020]		DILNTVADR	0.88968	0.36094	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	992.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PL18	A0A5F5PL18_HORSE	Oxysterol-binding protein	OSBPL5	Equus caballus (Horse)	lipid transport [GO:0006869]	membrane [GO:0016020]	lipid binding [GO:0008289]	ETYRQEK	0.98922	-1.6833	0	0	0	0	0	0	0	0	0	0	680.34	783.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PL43	A0A5F5PL43_HORSE	Solute carrier family 25 member 23	SLC25A23	Equus caballus (Horse)	transmembrane transport [GO:0055085]	mitochondrial inner membrane [GO:0005743]	calcium ion binding [GO:0005509]	EQRLLLLFHSLDR	0.88485	0.35711	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	535	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	703.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1352.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PLD6	A0A5F5PLD6_HORSE	Aldo-keto reductase family 1 member D1	AKR1D1	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	YNKTAAQVALR	0.99058	-1.6579	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3556.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PM24	A0A5F5PM24_HORSE	Dehydrogenase/reductase 2		Equus caballus (Horse)			carbonyl reductase (NADPH) activity [GO:0004090]	LSVMGTVCHVGK	0.86891	0.46133	20197	0	0	0	0	0	0	0	0	0	0	0	50704	0	0	0	0	0	0	0	38953	8077.4	0	8399.3	7621.8	8062.4	8379.7	0	73144	0	0	0	0	0	0	0	5462.3	0	0	0	0	0	28967	0	0	0	0	0	0	0	0	0	0	0	0	0	9161.2	0	0	58775	0	0	0	1490.6	0	0	0	0	0	11227	0	0	0	0	0
A0A5F5PM26	A0A5F5PM26_HORSE	RNA-directed DNA polymerase (EC 2.7.7.49)		Equus caballus (Horse)			catalytic activity [GO:0003824]	YKRVEIISR	0.97136	-0.20125	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1389	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PMA0	A0A5F5PMA0_HORSE	Transmembrane protein 259	TMEM259	Equus caballus (Horse)		membrane [GO:0016020]		RPHRTAR	0.98816	-1.5893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	739.01	0	0
A0A5F5PMB2	A0A5F5PMB2_HORSE	NEDD4 binding protein 2 like 1	N4BP2L1	Equus caballus (Horse)				APGFPAGAHGK	0.96419	-0.13774	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	444.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PMG4	A0A5F5PMG4_HORSE	RNA-directed DNA polymerase (EC 2.7.7.49)		Equus caballus (Horse)				ELKNTILFTIATKR	0.89016	0.33162	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1483.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PMK9	A0A5F5PMK9_HORSE	Zinc finger protein 2	ZNF2	Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]		metal ion binding [GO:0046872]	MAAVSPPAR	0.96515	-0.118	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2941.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PMV7	A0A5F5PMV7_HORSE	Zinc finger protein 709	LOC100065202	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	AFTALSSLR	0.96651	-0.10439	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	754.99	0	0	0	562.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PN35	A0A5F5PN35_HORSE	HECT-type E3 ubiquitin transferase (EC 2.3.2.26)	AREL1	Equus caballus (Horse)	negative regulation of apoptotic process [GO:0043066]; protein K11-linked ubiquitination [GO:0070979]; protein K33-linked ubiquitination [GO:1990390]; regulation of inflammatory response [GO:0050727]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytosol [GO:0005829]	ubiquitin protein ligase activity [GO:0061630]	LLSATTWR	0.98475	-0.84383	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	416.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1064.8	0	0	0	0	0	0	0
A0A5F5PNB0	A0A5F5PNB0_HORSE	von Willebrand factor A domain containing 2	VWA2	Equus caballus (Horse)			calcium ion binding [GO:0005509]	TLETVRELVGNALCWR	0.68111	0.61277	0	0	0	0	0	0	0	0	0	0	0	0	0	815.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PNF0	A0A5F5PNF0_HORSE	Solute carrier family 35 member F6	SLC35F6	Equus caballus (Horse)	negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [GO:1901029]; positive regulation of cell population proliferation [GO:0008284]	membrane [GO:0016020]; mitochondrion [GO:0005739]	transmembrane transporter activity [GO:0022857]	IVTTASAIQLIQR	0.8587	0.4782	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	581.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PNG1	A0A5F5PNG1_HORSE	Pro-opiomelanocortin (Corticotropin-lipotropin)	POMC	Equus caballus (Horse)	calcium-mediated signaling [GO:0019722]; cell-cell signaling [GO:0007267]; cellular pigmentation [GO:0033059]; generation of precursor metabolites and energy [GO:0006091]; glucose homeostasis [GO:0042593]; negative regulation of tumor necrosis factor production [GO:0032720]; neuropeptide signaling pathway [GO:0007218]; positive regulation of cAMP-mediated signaling [GO:0043950]; positive regulation of oxytocin production [GO:0140668]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of appetite [GO:0032098]; regulation of blood pressure [GO:0008217]; regulation of corticosterone secretion [GO:2000852]; regulation of glycogen metabolic process [GO:0070873]; response to melanocyte-stimulating hormone [GO:1990680]	extracellular space [GO:0005615]; secretory granule [GO:0030141]	hormone activity [GO:0005179]; type 1 melanocortin receptor binding [GO:0070996]; type 3 melanocortin receptor binding [GO:0031781]; type 4 melanocortin receptor binding [GO:0031782]	NAHKKGQ	0.95548	0.22755	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	278.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PNK5	A0A5F5PNK5_HORSE	Regulating synaptic membrane exocytosis 1	RIMS1	Equus caballus (Horse)	acrosomal vesicle exocytosis [GO:0060478]; calcium ion-regulated exocytosis of neurotransmitter [GO:0048791]; intracellular protein transport [GO:0006886]; positive regulation of dendrite extension [GO:1903861]; positive regulation of synaptic transmission [GO:0050806]; protein-containing complex assembly [GO:0065003]; regulation of membrane potential [GO:0042391]; regulation of synaptic plasticity [GO:0048167]; regulation of synaptic vesicle exocytosis [GO:2000300]	cytoskeleton of presynaptic active zone [GO:0048788]; presynaptic membrane [GO:0042734]	metal ion binding [GO:0046872]; small GTPase binding [GO:0031267]; transmembrane transporter binding [GO:0044325]	LDPGSAVLVR	0.9659	-0.15607	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1105.9	0	754.14	0	0	0	0	951.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PNM0	A0A5F5PNM0_HORSE	"Multiple inositol polyphosphate phosphatase 1 (EC 3.1.3.62) (EC 3.1.3.80) (2,3-bisphosphoglycerate 3-phosphatase)"	MINPP1	Equus caballus (Horse)				TGPEMQNIVK	0.97203	0.20748	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	504.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PP98	A0A5F5PP98_HORSE	Zinc finger protein 687	ZNF687	Equus caballus (Horse)		nucleus [GO:0005634]		EACLHFSR	0.2	1.0878	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1012.9	0	0	0	691.22	0	0	0	0	0	0	0	0	0	1221.2	3609.1	2874.3	2680.3	0	1567.1	1249.1	794.13	782.7	603.99	1788.2	1347.9	1269.7	625.03	691.43	500.53	0	700.79	0	0	0	0	823.5	1543.8	1206.4	1482.6	1454.5	1284.2	1375.5	1154	1065.9	0	749.39	720.78	846.54	772.99	699.38	1067.7	699.22	674.43	0	0	0	589.73	0	545.92
A0A5F5PPD6	A0A5F5PPD6_HORSE	Large ribosomal subunit protein eL31 (60S ribosomal protein L31)	RPL31	Equus caballus (Horse)	cytoplasmic translation [GO:0002181]	cytosolic large ribosomal subunit [GO:0022625]	structural constituent of ribosome [GO:0003735]	LNDLFKR	0.9825	-0.71987	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2463.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PPU9	A0A5F5PPU9_HORSE	Zinc finger protein 438	ZNF438	Equus caballus (Horse)				ALEGSVERENK	0.98785	-1.8776	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	628.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PQ37	A0A5F5PQ37_HORSE	Interleukin-4 receptor subunit alpha	IL4R	Equus caballus (Horse)	cytokine-mediated signaling pathway [GO:0019221]; production of molecular mediator involved in inflammatory response [GO:0002532]	external side of plasma membrane [GO:0009897]	cytokine receptor activity [GO:0004896]	VTASTLKSR	0.96646	-0.10241	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1540.3	1364.8	0	0	0	0	0	884.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PQD7	A0A5F5PQD7_HORSE	SAM pointed domain containing ETS transcription factor	SPDEF	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	LSRSIRQYYK	0.97917	-0.31737	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	743.86	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PQJ5	A0A5F5PQJ5_HORSE	Solute carrier family 29 member 4	SLC29A4	Equus caballus (Horse)	adenosine transport [GO:0032238]; dopamine uptake [GO:0090494]; epinephrine uptake [GO:0051625]; export across plasma membrane [GO:0140115]; histamine uptake [GO:0051615]; norepinephrine uptake [GO:0051620]; serotonin uptake [GO:0051610]	apical plasma membrane [GO:0016324]; basolateral plasma membrane [GO:0016323]; presynapse [GO:0098793]	efflux transmembrane transporter activity [GO:0015562]; monoamine transmembrane transporter activity [GO:0008504]; monoatomic cation transmembrane transporter activity [GO:0008324]; neurotransmitter transmembrane transporter activity [GO:0005326]; nucleoside transmembrane transporter activity [GO:0005337]; organic acid transmembrane transporter activity [GO:0005342]; organic cation transmembrane transporter activity [GO:0015101]; toxin transmembrane transporter activity [GO:0019534]; xenobiotic transmembrane transporter activity [GO:0042910]	EEGARRR	0.97909	-0.45593	0	0	0	0	0	0	0	0	1466.8	0	1373.5	1340.1	0	1662.2	1642.8	0	3555.7	0	0	0	1381.4	0	0	0	0	0	0	0	0	0	0	2441.4	0	3000.5	3580.9	2510.6	0	1616.6	0	2387.9	0	0	0	0	0	0	3519.2	3135.6	678.15	0	0	0	0	0	0	0	0	1414	0	0	0	0	1623.8	575.32	528.35	613.21	642.5	0	0	0	0	0	739.01	702.95	658
A0A5F5PQP6	A0A5F5PQP6_HORSE	Cache domain containing 1	CACHD1	Equus caballus (Horse)		voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel activity [GO:0005245]	DSSEEDK	0.97061	-0.032923	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1510.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PQX0	A0A5F5PQX0_HORSE	Ankyrin repeat domain 12	ANKRD12	Equus caballus (Horse)				LYSHHTEK	0.98379	-1.2884	0	0	0	0	0	0	0	0	0	2745.4	0	0	0	0	0	0	0	4200.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2498.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2916.8	0	0	0	876.17
A0A5F5PQY7	A0A5F5PQY7_HORSE	Stem-loop binding protein	SLBP	Equus caballus (Horse)			mRNA binding [GO:0003729]	LLINDFGR	0.96578	-0.090866	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1150.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PR65	A0A5F5PR65_HORSE	cAMP-dependent protein kinase inhibitor beta	PKIB	Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]	cAMP-dependent protein kinase inhibitor activity [GO:0004862]	SLGHGILK	0.92432	0.2877	0	0	0	0	0	0	0	0	0	0	974.72	0	0	0	0	0	0	17192	0	0	0	0	4986.6	0	0	0	0	0	0	0	0	0	0	0	0	33582	0	0	0	0	0	0	18342	17512	16533	0	0	0	0	0	0	0	20362	19330	0	0	0	0	0	0	0	658.08	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PRM6	A0A5F5PRM6_HORSE	SEA domain-containing protein	MUC16	Equus caballus (Horse)		membrane [GO:0016020]		LTSLRPEK	0.97605	0.082763	2404.7	0	0	2666.7	2821.9	2931.1	0	2900.9	0	3231.8	0	4851.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4675.4	0	0	0	0	0	0	0	0	0	0	0	1899.4	0	0	0	3145.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3958.1	0	0	2538.4	0	0
A0A5F5PRR2	A0A5F5PRR2_HORSE	Nephrocystin 1	NPHP1	Equus caballus (Horse)				NTLQKLNK	0.98582	-1.4055	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14882	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PRW2	A0A5F5PRW2_HORSE	Pleckstrin homology and RhoGEF domain containing G2	PLEKHG2	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]	DARNFTPGRR	0.88589	0.35425	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	661.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PS34	A0A5F5PS34_HORSE	RUN and FYVE domain containing 2	RUFY2	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		AKLSIKGLIESALSFGR	0.27673	0.87882	458.57	0	611.8	540.22	526.98	461.19	0	0	0	898.82	0	0	688.33	687.46	602.9	0	0	0	457.32	793.48	680.85	711.64	647.41	0	488.59	0	0	0	0	0	0	0	0	0	0	0	525.2	731.09	656.38	0	0	0	0	0	0	0	0	0	812.12	645.92	675.41	0	705.8	0	0	0	917.76	0	0	0	0	2685.2	0	0	0	0	0	0	0	0	1462.4	0	0	0	0
A0A5F5PSE7	A0A5F5PSE7_HORSE	RING-type E3 ubiquitin transferase (EC 2.3.2.27)	MDM4	Equus caballus (Horse)	negative regulation of apoptotic process [GO:0043066]; regulation of cell cycle [GO:0051726]	nucleus [GO:0005634]		AELKPTDTAKER	0.96729	0.17965	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	816.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PSG7	A0A5F5PSG7_HORSE	Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43)	GAP43	Equus caballus (Horse)	axon choice point recognition [GO:0016198]; axon regeneration [GO:0031103]; regulation of growth [GO:0040008]; tissue regeneration [GO:0042246]	cytoplasm [GO:0005737]; dendrite [GO:0030425]; filopodium membrane [GO:0031527]; growth cone membrane [GO:0032584]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]	calmodulin binding [GO:0005516]; lysophosphatidic acid binding [GO:0035727]; phosphatidylinositol phosphate binding [GO:1901981]; phosphatidylserine binding [GO:0001786]	QDERKEER	0.97082	0.04629	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1849.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PSW1	A0A5F5PSW1_HORSE	Class II major histocompatibility complex transactivator	CIITA	Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]		ATP binding [GO:0005524]	LEFALDSLSENK	0.97211	0.032624	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	649.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PT48	A0A5F5PT48_HORSE	Perilipin	PLIN2	Equus caballus (Horse)	lipid storage [GO:0019915]; positive regulation of sequestering of triglyceride [GO:0010890]	cytosol [GO:0005829]; lipid droplet [GO:0005811]		LSEVHSR	0.97	0.033374	0	0	0	0	0	0	0	0	0	0	0	0	0	0	587.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PT97	A0A5F5PT97_HORSE	non-specific protein-tyrosine kinase (EC 2.7.10.2)	ERRFI1	Equus caballus (Horse)		cytoplasm [GO:0005737]	transferase activity [GO:0016740]	SIAGVAAQEIR	0.96486	-0.11705	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	601.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PTC8	A0A5F5PTC8_HORSE	Tenascin XB	TNXB	Equus caballus (Horse)				HIHEYLQR	0.96893	0.010271	0	0	0	0	0	0	0	0	540.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PTW1	A0A5F5PTW1_HORSE	Ubiquitin protein ligase E3 component n-recognin 5	UBR5	Equus caballus (Horse)	DNA repair-dependent chromatin remodeling [GO:0140861]; heterochromatin boundary formation [GO:0033696]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of gene expression [GO:0010628]; positive regulation of protein import into nucleus [GO:0042307]; progesterone receptor signaling pathway [GO:0050847]; protein K48-linked ubiquitination [GO:0070936]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; perinuclear region of cytoplasm [GO:0048471]; protein-containing complex [GO:0032991]	RNA binding [GO:0003723]; ubiquitin binding [GO:0043130]; ubiquitin-ubiquitin ligase activity [GO:0034450]; zinc ion binding [GO:0008270]	CISFLLRHLICMER	0.88033	0.4066	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1555.9	1571	1335.9	0	0	0	0	546.52	0	0	0	0	0	0	1035.6	0	0	709.06	0	0	795.19	1805.7	871.65	0	1137.1	930.69	1436.5	0	0	0	0	1196.1	1584.4	0	0	497.64	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	901.2	0	0	0	0	557.53	569.58	0	0
A0A5F5PU22	A0A5F5PU22_HORSE	Ral transcription factor IIIC subunit 5	GTF3C5	Equus caballus (Horse)	transcription initiation at RNA polymerase III promoter [GO:0006384]	transcription factor TFIIIC complex [GO:0000127]		SKRPALFSSPTKADSGK	0.88681	0.34716	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	529.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PU62	A0A5F5PU62_HORSE	DEAD-box helicase 19B	DDX19B	Equus caballus (Horse)			ATP binding [GO:0005524]; nucleic acid binding [GO:0003676]; RNA helicase activity [GO:0003724]	IQRMLPR	0.98261	-0.73928	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	637.7	0	0	0	0	470.11	0	0	0	0	0	0	0	0	949.19	1052.2	1088	0	0	844.95	0	0	0	0	2037.5	2108.9	2166.5	0	0	0	0	0	1201.6	0	0	0	4577.3	0	0	0	887.54	0	0	497.82	0	0	0	0	0	8153.7	0	0	0	0	0	0	0	0	0	0
A0A5F5PUC8	A0A5F5PUC8_HORSE	Musashi RNA binding protein 2	MSI2	Equus caballus (Horse)		cytoplasm [GO:0005737]	RNA binding [GO:0003723]	LGRERPR	0.98705	-1.1923	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1046.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PUI4	A0A5F5PUI4_HORSE	Dehydrogenase/reductase 2	LOC100055175	Equus caballus (Horse)			catalytic activity [GO:0003824]	SLAVELAPK	0.96814	-0.072387	982.37	0	0	0	0	0	0	0	0	0	0	0	0	0	4909.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4245.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1130.2	0	1092.5
A0A5F5PUK4	A0A5F5PUK4_HORSE	Signal induced proliferation associated 1 like 3	SIPA1L3	Equus caballus (Horse)	regulation of small GTPase mediated signal transduction [GO:0051056]		GTPase activator activity [GO:0005096]	EQQRTQSRPR	0.98766	-3.832	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	898.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2118.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	674.67	0	0	0	0	0	0	0	1689.3	0	0	0	0	0	0	0	0
A0A5F5PUL1	A0A5F5PUL1_HORSE	Chromosome 1 C15orf62 homolog	C1H15orf62	Equus caballus (Horse)	positive regulation of actin filament polymerization [GO:0030838]; positive regulation of pseudopodium assembly [GO:0031274]; regulation of cell shape [GO:0008360]; Rho protein signal transduction [GO:0007266]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; plasma membrane [GO:0005886]	small GTPase binding [GO:0031267]	LSLGRPGR	0.97378	0.051973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1804	0	0	0	1538.6	0	0	0	0	2729.4	0	3096.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1735.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PVI1	A0A5F5PVI1_HORSE	Fatty acid synthase (EC 1.1.1.100) (EC 1.3.1.39) (EC 2.3.1.38) (EC 2.3.1.39) (EC 2.3.1.41) (EC 2.3.1.85) (EC 3.1.2.14) (EC 4.2.1.59)	FASN	Equus caballus (Horse)	fatty acid biosynthetic process [GO:0006633]	cytoplasm [GO:0005737]	"(3R)-hydroxyacyl-[acyl-carrier-protein] dehydratase activity [GO:0019171]; (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase activity [GO:0008659]; 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity [GO:0004316]; 3-oxoacyl-[acyl-carrier-protein] synthase activity [GO:0004315]; [acyl-carrier-protein] S-acetyltransferase activity [GO:0004313]; [acyl-carrier-protein] S-malonyltransferase activity [GO:0004314]; acyl-[acyl-carrier-protein] hydrolase activity [GO:0016297]; enoyl-[acyl-carrier-protein] reductase (NADPH, A-specific) activity [GO:0047117]; fatty acid synthase activity [GO:0004312]; phosphopantetheine binding [GO:0031177]; S-adenosylmethionine-dependent methyltransferase activity [GO:0008757]"	GLAQALQVK	0.97119	0.20463	0	0	0	772.14	0	0	0	0	0	0	0	0	0	0	0	0	725.61	3128.9	0	0	0	0	0	0	0	0	0	0	5750.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7957.8	0	7540.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1503.1	0	0	0	0	0	0	0	0	0	0
A0A5F5PVI5	A0A5F5PVI5_HORSE	Potassium calcium-activated channel subfamily N member 2	KCNN2	Equus caballus (Horse)		membrane [GO:0016020]	calmodulin binding [GO:0005516]; small conductance calcium-activated potassium channel activity [GO:0016286]	KFLQAIHQARK	0.97321	-0.21048	0	0	0	0	0	0	0	0	0	1526.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PVJ6	A0A5F5PVJ6_HORSE	Spermatosis associated 21	SPATA21	Equus caballus (Horse)			calcium ion binding [GO:0005509]	WLSSVPAR	0.99042	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	349.43
A0A5F5PVJ9	A0A5F5PVJ9_HORSE	RCR-type E3 ubiquitin transferase (EC 2.3.2.33)	MYCBP2	Equus caballus (Horse)	branchiomotor neuron axon guidance [GO:0021785]; central nervous system projection neuron axonogenesis [GO:0021952]; circadian regulation of gene expression [GO:0032922]; negative regulation of protein catabolic process [GO:0042177]; neuromuscular process [GO:0050905]; positive regulation of protein ubiquitination [GO:0031398]; protein K48-linked ubiquitination [GO:0070936]; regulation of axon guidance [GO:1902667]; regulation of cytoskeleton organization [GO:0051493]; regulation of protein localization [GO:0032880]	axon [GO:0030424]; cytosol [GO:0005829]; microtubule cytoskeleton [GO:0015630]; nucleoplasm [GO:0005654]	guanyl-nucleotide exchange factor activity [GO:0005085]; identical protein binding [GO:0042802]; small GTPase binding [GO:0031267]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]	EKYLREK	0.98528	-1.3222	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1356.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PW23	A0A5F5PW23_HORSE	Cationic amino acid transporter C-terminal domain-containing protein	LOC100056225	Equus caballus (Horse)	amino acid transport [GO:0006865]	membrane [GO:0016020]	transmembrane transporter activity [GO:0022857]	LKTLESTRK	0.97347	-0.19664	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1300.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PW48	A0A5F5PW48_HORSE	ADAMTS like 3	ADAMTSL3	Equus caballus (Horse)	extracellular matrix organization [GO:0030198]	extracellular region [GO:0005576]		CIAGSAQETVVLK	0.96823	0.036814	0	0	501.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	611.74	0	0	0	0	0	0
A0A5F5PW54	A0A5F5PW54_HORSE	5-hydroxytryptamine receptor 7 (Serotonin receptor 7)	HTR7	Equus caballus (Horse)	"chemical synaptic transmission [GO:0007268]; circadian rhythm [GO:0007623]; G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger [GO:0007187]; smooth muscle contraction [GO:0006939]; vasoconstriction [GO:0042310]"	dendrite [GO:0030425]; plasma membrane [GO:0005886]; synapse [GO:0045202]	G protein-coupled serotonin receptor activity [GO:0004993]; neurotransmitter receptor activity [GO:0030594]	SLLQCQYR	0.97317	0.041578	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	614.48	0	0	0	0
A0A5F5PW79	A0A5F5PW79_HORSE	Tripartite motif containing 7	TRIM7	Equus caballus (Horse)	antiviral innate immune response [GO:0140374]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	ubiquitin protein ligase activity [GO:0061630]	SQLLPRLHR	0.99132	-1.2494	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1287.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PWL4	A0A5F5PWL4_HORSE	RAB GTPase activating protein 1 like	RABGAP1L	Equus caballus (Horse)				DSLKKQLR	0.92345	0.28783	0	0	0	0	0	0	0	2472.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	489.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PWM4	A0A5F5PWM4_HORSE	Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12)	USP20	Equus caballus (Horse)	endocytosis [GO:0006897]; proteolysis [GO:0006508]	centrosome [GO:0005813]; perinuclear region of cytoplasm [GO:0048471]	cysteine-type deubiquitinase activity [GO:0004843]; zinc ion binding [GO:0008270]	VLRLPEILCIHLK	0.93908	0.25507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1724.9	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PX60	A0A5F5PX60_HORSE	Sterile alpha motif domain containing 11	SAMD11	Equus caballus (Horse)			metal ion binding [GO:0046872]	SLKTLMSK	0.98602	-1.1569	0	0	0	0	0	0	0	0	0	0	0	0	0	598.35	0	0	0	0	0	550.38	492.95	0	0	0	0	0	0	0	735.7	0	0	0	0	905.52	844.69	0	0	581.22	579.59	0	0	0	0	0	0	0	1342.2	694.02	0	0	0	0	0	0	0	0	0	619.78	0	0	0	462.05	0	0	0	0	0	0	0	0	674.85	0	0	0	0
A0A5F5PXH6	A0A5F5PXH6_HORSE	Cytochrome P450 3A (EC 1.14.14.-)	CYP3A89	Equus caballus (Horse)		endoplasmic reticulum membrane [GO:0005789]	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen [GO:0016712]"	DGTVSGA	0.9582	0.22133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	403.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PY36	A0A5F5PY36_HORSE	"TLE family member 3, transcriptional corepressor"	TLE3	Equus caballus (Horse)	negative regulation of cold-induced thermogenesis [GO:0120163]; regulation of DNA-templated transcription [GO:0006355]; Wnt signaling pathway [GO:0016055]	beta-catenin-TCF complex [GO:1990907]; nucleoplasm [GO:0005654]		VEYDKLANEK	0.95208	0.23901	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	512.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PY83	A0A5F5PY83_HORSE	C-type lectin domain-containing protein		Equus caballus (Horse)	immune response [GO:0006955]			GAMEAPK	0.98808	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	443.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PY85	A0A5F5PY85_HORSE	C-type lectin domain-containing protein	LOC100062789	Equus caballus (Horse)		membrane [GO:0016020]		SPFSTSCLERR	0.98365	-0.79141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1043.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PYA5	A0A5F5PYA5_HORSE	Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12)	USP3	Equus caballus (Horse)	proteolysis [GO:0006508]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cysteine-type deubiquitinase activity [GO:0004843]; zinc ion binding [GO:0008270]	QARKYQLSAAWK	0.90885	0.31191	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	695.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PYP1	A0A5F5PYP1_HORSE	RUN domain-containing protein 3A	RUNDC3A	Equus caballus (Horse)				RMSEYITTALR	0.86986	0.39999	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	650.98	0	0	0	0	0
A0A5F5PYX4	A0A5F5PYX4_HORSE	Myosin heavy chain 15	MYH15	Equus caballus (Horse)		cytoplasm [GO:0005737]; myofibril [GO:0030016]; myosin filament [GO:0032982]; myosin II complex [GO:0016460]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; microfilament motor activity [GO:0000146]	ALSTELLKLR	0.98688	-3.4673	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	663.55	0	0	0	0	0	0	0	0	0	0	0	0	0	332.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PYZ2	A0A5F5PYZ2_HORSE	Proline-serine-threonine phosphatase interacting protein 1	PSTPIP1	Equus caballus (Horse)				ISANGQQK	0.98601	-2.9378	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	669.25	0	0	0	0	0	0	0	0	1591.5	0	0	0	0
A0A5F5PZ73	A0A5F5PZ73_HORSE	CASP8 and FADD like apoptosis regulator	CFLAR	Equus caballus (Horse)	regulation of apoptotic process [GO:0042981]			ILKMDKTAVEAHLR	0.96746	0.025799	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	676.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1249.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PZ93	A0A5F5PZ93_HORSE	Tumor necrosis factor ligand superfamily member 6 (Fas antigen ligand)	FASLG	Equus caballus (Horse)	apoptotic process [GO:0006915]; immune response [GO:0006955]	cytoplasmic vesicle lumen [GO:0060205]; extracellular space [GO:0005615]; lysosomal lumen [GO:0043202]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	cytokine activity [GO:0005125]; tumor necrosis factor receptor binding [GO:0005164]	ELAELREVR	0.99087	-1.2375	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	420.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PZH7	A0A5F5PZH7_HORSE	SPATA31/FAM205 domain-containing protein	LOC111772192	Equus caballus (Horse)				RPLGWPR	0.96402	-0.022953	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1338.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PZM8	A0A5F5PZM8_HORSE	Intermediate filament family orphan 1	IFFO1	Equus caballus (Horse)		intermediate filament [GO:0005882]		FRCFLAK	0.99077	-1.2545	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1256.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PZU7	A0A5F5PZU7_HORSE	Uncharacterized protein		Equus caballus (Horse)				ILHTMLR	0.96449	0.19122	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	718.09	1810.1	0	0	0	0	0	0	0	0	1479.6	1444.2	1954.4	0	2061.8	0	634.17	0	1413.5	0	0	0	0	0	0	0	0	0	0	0
A0A5F5PZW4	A0A5F5PZW4_HORSE	Contactin 6	CNTN6	Equus caballus (Horse)				IEVRFPETIQAAK	0.98574	-0.862	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1202.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	819.42	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q029	A0A5F5Q029_HORSE	Tetratricopeptide repeat domain 23 like	TTC23L	Equus caballus (Horse)				AIGNVIAAK	0.97612	0.094985	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13587	0	0	0	0	0	0	0	0	0	1838.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q047	A0A5F5Q047_HORSE	Adenosine kinase (AK) (EC 2.7.1.20) (Adenosine 5'-phosphotransferase)	ADK	Equus caballus (Horse)	AMP salvage [GO:0044209]; phosphorylation [GO:0016310]; purine ribonucleoside salvage [GO:0006166]	nucleus [GO:0005634]	adenosine kinase activity [GO:0004001]; ATP binding [GO:0005524]	NWMLVEKAR	0.98574	-1.3406	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1136.2	0	0	0	0	0	0	0	0	0	1272.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q056	A0A5F5Q056_HORSE	Translation machinery-associated protein 7 (Coiled-coil domain-containing protein 72)	TMA7	Equus caballus (Horse)				AAGKGPLATGGIKK	0.7618	0.52162	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	640.48	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q0P0	A0A5F5Q0P0_HORSE	Exportin 5	XPO5	Equus caballus (Horse)	protein export from nucleus [GO:0006611]; RNA export from nucleus [GO:0006405]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; RNA nuclear export complex [GO:0042565]	nuclear export signal receptor activity [GO:0005049]; RNA binding [GO:0003723]; small GTPase binding [GO:0031267]	IVVEMIKR	0.98111	-0.62571	0	0	2188.5	0	0	0	2452.3	2472.1	2511.7	2745.4	0	0	0	0	0	0	0	0	0	0	0	1851.9	0	0	0	0	0	2498.5	0	0	3593.7	0	0	4815.7	0	0	0	3146.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1220.2	0	0	1526.6	0	1718.7	0	0	0	0	1951.6	0	0	0	0	2648.6	0	0	0
A0A5F5Q112	A0A5F5Q112_HORSE	Interleukin-7 (IL-7)	IL7	Equus caballus (Horse)	immune response [GO:0006955]	extracellular space [GO:0005615]	cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; interleukin-7 receptor binding [GO:0005139]	LLNCTTKEENK	0.98578	-1.2783	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1385.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q129	A0A5F5Q129_HORSE	Poly [ADP-ribose] polymerase (PARP) (EC 2.4.2.-)	PARP3	Equus caballus (Horse)	double-strand break repair [GO:0006302]	nucleolus [GO:0005730]; site of double-strand break [GO:0035861]	NAD+ ADP-ribosyltransferase activity [GO:0003950]; NAD+-protein ADP-ribosyltransferase activity [GO:1990404]; nucleotidyltransferase activity [GO:0016779]	EGEGDRFQAHSK	0.88854	0.36591	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1860.7	0	0	0	0	0	0	0	0	0	0	0	0	0	783.75	0	0	0	0	0	0	0	0	0	0	0	0	772.21	0	0	0	0	869.04	718.83	806.05	0	0	0	0	0	0
A0A5F5Q166	A0A5F5Q166_HORSE	Hypoxia up-regulated protein 1	HYOU1	Equus caballus (Horse)			ATP binding [GO:0005524]; ATP-dependent protein folding chaperone [GO:0140662]	GVGESFK	0.97255	-0.18431	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4401.8	0	0	0	0	0
A0A5F5Q1F8	A0A5F5Q1F8_HORSE	Target of myb1 like 2 membrane trafficking protein	TOM1L2	Equus caballus (Horse)	protein transport [GO:0015031]		phosphatidylinositol binding [GO:0035091]; ubiquitin binding [GO:0043130]	GVEFPMADLDALSPIHTPQR	0.87856	0.39476	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	618.38	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q1M0	A0A5F5Q1M0_HORSE	Zinc finger protein 311	ZNF311	Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]		metal ion binding [GO:0046872]	EKLREEK	0.67771	0.60798	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	798.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q1N4	A0A5F5Q1N4_HORSE	Calsyntenin 1	CLSTN1	Equus caballus (Horse)	homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; postsynaptic membrane [GO:0045211]	amyloid-beta binding [GO:0001540]; calcium ion binding [GO:0005509]; kinesin binding [GO:0019894]; X11-like protein binding [GO:0042988]	SYKATVVEGR	0.9568	0.22356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	486.25	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q1Y2	A0A5F5Q1Y2_HORSE	Hook microtubule tethering protein 2	HOOK2	Equus caballus (Horse)	cytoplasmic microtubule organization [GO:0031122]; cytoskeleton-dependent intracellular transport [GO:0030705]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; microtubule [GO:0005874]	dynein light intermediate chain binding [GO:0051959]; microtubule binding [GO:0008017]	NAGHAER	0.9869	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	347.15	0	0	0	0	0	0	0	0	0	0	0	0	0	268.63	0	0	0	280.87	0	0	0	0
A0A5F5Q238	A0A5F5Q238_HORSE	DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18)	OGG1	Equus caballus (Horse)	base-excision repair [GO:0006284]; nucleotide-excision repair [GO:0006289]		"8-oxo-7,8-dihydroguanine DNA N-glycosylase activity [GO:0034039]; class I DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0140078]; damaged DNA binding [GO:0003684]"	ITGMVER	0.98705	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	819.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q239	A0A5F5Q239_HORSE	Zinc finger and BTB domain containing 10	ZBTB10	Equus caballus (Horse)				NLTNLASNVK	0.96779	0.17932	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	737.07	979.56	0	0	0	0	0	0	0	0	0	0	0	0	1117.5	1215.6	1091	766.2	0	0	0	0	766.03	0	993.23	1125.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	919.51	0	0	0	0	0	0	0	0	0	589.63	0	532.87	446.55	0	0	0
A0A5F5Q274	A0A5F5Q274_HORSE	Large ribosomal subunit protein uL14 (60S ribosomal protein L23)	RPL23	Equus caballus (Horse)	translation [GO:0006412]	ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840]	structural constituent of ribosome [GO:0003735]	GGSSGAK	0.92363	0.28754	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1272.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	273.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q290	A0A5F5Q290_HORSE	Zinc finger protein 296	ZNF296	Equus caballus (Horse)	negative regulation of dendrite development [GO:2000171]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	DNA-binding transcription factor activity [GO:0003700]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]	APKPVGK	0.98321	-0.765	0	0	0	0	0	0	0	0	5045.6	0	0	0	0	0	0	0	0	0	0	4818.4	4435.5	0	0	0	0	0	0	0	0	0	0	9924.8	0	771.49	0	0	0	5235.6	5381.4	0	0	0	0	0	0	0	0	0	0	0	0	3638.3	0	0	0	0	0	0	0	0	0	3734.9	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q297	A0A5F5Q297_HORSE	Storkhead box 2	STOX2	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]			EVCIPEIVGGSK	0.96624	-0.15243	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	588.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	629.07	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q2B5	A0A5F5Q2B5_HORSE	DEAD/H-box helicase 11	DDX11	Equus caballus (Horse)	nucleobase-containing compound metabolic process [GO:0006139]	nucleus [GO:0005634]	"ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [GO:0016818]"	AVNQSIGRAIRHQK	0.97324	-0.19666	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2002.9	0	0	0	0	0	0	0	0	0	0	0	0	0	1486.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1428.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q2C7	A0A5F5Q2C7_HORSE	Cysteine-rich secretory protein 2	CRISP2	Equus caballus (Horse)		extracellular space [GO:0005615]		YEDLVSNCDSLK	0.96542	-0.088069	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	409.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q2K1	A0A5F5Q2K1_HORSE	Ras-related protein Rab-18	RAB18	Equus caballus (Horse)		plasma membrane [GO:0005886]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]	DEDVLTTLK	0.96311	-0.0058504	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	752.51	0	0	0	0	992.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q2N0	A0A5F5Q2N0_HORSE	N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase	NAGPA	Equus caballus (Horse)		membrane [GO:0016020]		MAASMGR	0.98083	-0.58464	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1935.1	0	0	0	339.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q2R1	A0A5F5Q2R1_HORSE	Synaptotagmin like 3	SYTL3	Equus caballus (Horse)	intracellular protein transport [GO:0006886]		small GTPase binding [GO:0031267]	LTLKSPVLKK	0.8748	0.45052	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	168270	189820	200570	211050	160180	0	207310	173090	0	0	0	0	292.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	227310	682.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q347	A0A5F5Q347_HORSE	Nuclear prelamin A recognition factor	NARF	Equus caballus (Horse)		lamin filament [GO:0005638]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	lamin binding [GO:0005521]	GVACPFAALSLAEGR	0.88321	0.37303	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	512.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q3D4	A0A5F5Q3D4_HORSE	Isocitrate dehydrogenase (NAD(+)) 3 catalytic subunit alpha	IDH3A	Equus caballus (Horse)				DLGGNAK	0.8659	0.40419	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	478.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q3H4	A0A5F5Q3H4_HORSE	WASP actin nucleation promoting factor	WAS	Equus caballus (Horse)	actin filament organization [GO:0007015]	nucleus [GO:0005634]	actin binding [GO:0003779]	GGPGALK	0.98748	-1.2702	868.58	0	0	0	0	549.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	832.63	957.09	710.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1429.1	1388.9	1427.7	0	0	0	0	0	0	1155.5	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q3J9	A0A5F5Q3J9_HORSE	Epithelial splicing regulatory protein 1	ESRP1	Equus caballus (Horse)			RNA binding [GO:0003723]	FSDPERVNYK	0.98872	-1.7926	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	441.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q3T6	A0A5F5Q3T6_HORSE	Leucine rich repeat containing 9	LRRC9	Equus caballus (Horse)				IPGSHFPRSNR	0.86364	0.47013	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	688.35	0	0	0	0	0	0	359.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q403	A0A5F5Q403_HORSE	"Inositol 1,4,5-triphosphate receptor associated 1"	IRAG1	Equus caballus (Horse)		cytoplasm [GO:0005737]; membrane [GO:0016020]		ASSTSEARPACGAQASR	0.97419	0.052306	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	479.94	420.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q419	A0A5F5Q419_HORSE	Neuropilin	NRP2	Equus caballus (Horse)	angiogenesis [GO:0001525]; axon guidance [GO:0007411]	membrane [GO:0016020]	heparin binding [GO:0008201]; metal ion binding [GO:0046872]; semaphorin receptor activity [GO:0017154]; vascular endothelial growth factor receptor activity [GO:0005021]	GRSGEIAIDDIR	0.98811	-1.8773	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	908.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q4G0	A0A5F5Q4G0_HORSE	GPN-loop GTPase 3	GPN3	Equus caballus (Horse)		protein-containing complex [GO:0032991]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]	VQSARCRDAK	0.97111	-0.066709	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1499.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5F5Q4K1	A0A5F5Q4K1_HORSE	Keratin 15	KRT15 KRT35	Equus caballus (Horse)		intermediate filament [GO:0005882]	structural molecule activity [GO:0005198]	LAADDFR	0.82306	0.49305	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1036.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A5K1UQD3	A0A5K1UQD3_HORSE	Paired box protein Pax-7	PAX7	Equus caballus (Horse)	anatomical structure development [GO:0048856]	nucleus [GO:0005634]	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]"	AALPGTVPR	0.96883	-0.044561	0	0	0	0	0	0	0	0	0	0	725.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A7R8C3R7	A0A7R8C3R7_HORSE	Interferon 1AH3	IF1AH3	Equus caballus (Horse)	defense response to virus [GO:0051607]	extracellular space [GO:0005615]	cytokine activity [GO:0005125]; cytokine receptor binding [GO:0005126]	LKTEVESK	0.98778	-1.7302	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	738.25	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QWX5	A0A9L0QWX5_HORSE	Major allergen I polypeptide chain 2-like		Equus caballus (Horse)		extracellular region [GO:0005576]		AADQQGHGLPPLCKQSQGQR	0.95847	0.22133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	686.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QWY4	A0A9L0QWY4_HORSE	RING-type E3 ubiquitin transferase (EC 2.3.2.27)	TRIM56	Equus caballus (Horse)		cytoplasm [GO:0005737]	metal ion binding [GO:0046872]	AGWYDEEAR	0.90149	0.32357	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	832.54	0	0	0	0	0	0	0	447.07	0	0	0	0	0	0	0	0	0	0	0	621.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QX76	A0A9L0QX76_HORSE	Uncharacterized protein		Equus caballus (Horse)				KSFQQMVLVK	0.98454	-0.83683	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	583.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QX85	A0A9L0QX85_HORSE	Ig-like domain-containing protein	LOC100054684	Equus caballus (Horse)				GGGGWAHGGEG	0.96293	-0.14116	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2949.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QXG9	A0A9L0QXG9_HORSE	Olfactory receptor		Equus caballus (Horse)	sensory perception of smell [GO:0007608]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	KFSLESLSLLA	0.98811	-1.0319	0	0	0	0	0	0	0	0	0	0	0	489.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	583.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	797.12	0	0	0	0	0	0	0	0	0	0	833	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QXJ3	A0A9L0QXJ3_HORSE	Cardiotrophin like cytokine factor 1	CLCF1	Equus caballus (Horse)		extracellular region [GO:0005576]		AAPLSLPGR	0.97462	0.08602	0	0	0	0	0	0	0	1513.6	1607	0	0	0	0	0	1197.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1029	1195.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1274	1130.8	1015.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QXK5	A0A9L0QXK5_HORSE	Bassoon presynaptic cytomatrix protein	BSN	Equus caballus (Horse)		cell projection [GO:0042995]; organelle [GO:0043226]; presynaptic active zone [GO:0048786]	metal ion binding [GO:0046872]	YISAPEKTGR	0.98706	-1.8351	0	0	0	0	0	0	0	0	0	0	0	805.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1250.1	0	0	0	1155.1	1006	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1304.6	0	0	0	0	619.51	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QXL0	A0A9L0QXL0_HORSE	Piwi like RNA-mediated silencing 1	PIWIL1	Equus caballus (Horse)	regulation of translation [GO:0006417]; regulatory ncRNA-mediated gene silencing [GO:0031047]		RNA binding [GO:0003723]	LTPEQRQR	0.98767	-1.064	0	0	0	0	0	0	854.41	0	0	0	0	0	0	830.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	580.3	0	0	0	0	0	3479.5	0	0	743.61	0	0	0	0	0	0	1035	0	0	684.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QXX3	A0A9L0QXX3_HORSE	mitogen-activated protein kinase kinase kinase (EC 2.7.11.25)	MAP3K15	Equus caballus (Horse)	MAPK cascade [GO:0000165]		ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	LFKLKPPVWYLR	0.93891	0.247	0	0	0	0	0	0	0	0	0	0	2569.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3529.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QY43	A0A9L0QY43_HORSE	NADP-dependent oxidoreductase domain-containing protein	LOC100070491	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	HNRSPGQVALR	0.28402	0.85508	0	0	0	0	0	0	0	0	0	0	0	559.69	0	0	0	0	0	662.8	0	544.57	0	0	0	0	0	0	0	0	950.71	0	3069.2	0	2287.9	0	0	942.63	1756	809.84	699.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	754.08	667.32	683.67	0	0	0	0	0	0	0	0	0	0	0	0	18147	0	0	0	0	994.55
A0A9L0QYD8	A0A9L0QYD8_HORSE	Protein-serine/threonine kinase (EC 2.7.11.-)	PDK4	Equus caballus (Horse)	phosphorylation [GO:0016310]	mitochondrial matrix [GO:0005759]	ATP binding [GO:0005524]; kinase activity [GO:0016301]	LPVFNKSAFK	0.9529	0.22562	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	623.45	565.37	0	0	0	0	0	0
A0A9L0QYG6	A0A9L0QYG6_HORSE	Glutamate receptor	GRIK2	Equus caballus (Horse)	monoatomic ion transmembrane transport [GO:0034220]	postsynaptic membrane [GO:0045211]		AILDLVQFFK	0.97149	0.12998	0	0	0	0	0	507.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QYY8	A0A9L0QYY8_HORSE	GPN-loop GTPase 3	GPN3	Equus caballus (Horse)			GTP binding [GO:0005525]; hydrolase activity [GO:0016787]	MPRYAQLVMGPAGSGK	0.95419	0.22683	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	840.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QZ45	A0A9L0QZ45_HORSE	"PEAK1 related, kinase-activating pseudokinase 1"	PRAG1	Equus caballus (Horse)				HQTIRLNPETLK	0.96997	0.17109	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	554.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QZA5	A0A9L0QZA5_HORSE	SMC5-SMC6 complex localization factor 2	SLF2	Equus caballus (Horse)				EDARLFYR	0.98608	-1.0012	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	294.27	0	0	0	0	0	0	0	0	0	0
A0A9L0QZC2	A0A9L0QZC2_HORSE	Serine/threonine-protein kinase TAO3 (EC 2.7.11.1) (Thousand and one amino acid protein 3)	TAOK3	Equus caballus (Horse)			ATP binding [GO:0005524]	ERFATIK	0.36538	0.74435	0	0	0	0	0	0	0	0	468.68	0	525.25	0	877.58	0	725.26	0	0	0	580.04	0	0	0	0	0	0	0	0	1471.9	1098	1298.1	1896.5	1848.5	1892.4	0	0	0	547	1314.4	1492.4	1131.8	866.94	0	0	0	0	1182.2	1134.5	0	1063.6	1284.5	1319.5	0	745.61	771.11	0	0	0	1586.8	1607.9	2044.8	0	603.96	0	0	0	0	889.67	769.98	901.9	538.17	1084	1009.5	0	0	0
A0A9L0QZC3	A0A9L0QZC3_HORSE	Transmembrane protein 64	TMEM64	Equus caballus (Horse)		membrane [GO:0016020]		ARVGPRHVEPR	0.97467	-0.19513	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	491.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	594.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QZG1	A0A9L0QZG1_HORSE	Centromere protein S		Equus caballus (Horse)	DNA repair [GO:0006281]			ELGLGGAQAPRPVK	0.9715	-0.061059	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	778.66	669.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QZS4	A0A9L0QZS4_HORSE	Interleukin 22 receptor subunit alpha 1	IL22RA1	Equus caballus (Horse)		membrane [GO:0016020]		EPPGAPR	0.96717	-0.039273	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2816.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3058	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QZT0	A0A9L0QZT0_HORSE	Zinc finger protein 133		Equus caballus (Horse)			metal ion binding [GO:0046872]	EGSSESWFGR	0.98505	-1.1612	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1110.4	1302.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0QZV7	A0A9L0QZV7_HORSE	ISG15 ubiquitin like modifier	ISG15	Equus caballus (Horse)				LTQTVAELK	0.96683	-0.096349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	538.54	0	0	0	0	0	0	0
A0A9L0QZY2	A0A9L0QZY2_HORSE	Uncharacterized protein		Equus caballus (Horse)				VDHYLAPYTK	0.91645	0.30819	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	381.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R0B4	A0A9L0R0B4_HORSE	Guanine nucleotide-binding protein subunit alpha-11	GNA11 GNA15	Equus caballus (Horse)	signal transduction [GO:0007165]		GTP binding [GO:0005525]	HGEHPLRLR	0.98681	-1.8405	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	321.23	0	0	0	0	0	0	0
A0A9L0R0B5	A0A9L0R0B5_HORSE	Family with sequence similarity 135 member A	FAM135A	Equus caballus (Horse)				LTELCEEVKVR	0.98557	-1.3289	0	0	0	0	0	0	0	617.37	0	0	0	0	0	0	0	0	0	882.08	0	0	0	0	0	0	0	0	0	0	0	0	0	1410.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1952.7	0	0	0	0	0	0	0	0	0	0	0	420.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R0D2	A0A9L0R0D2_HORSE	Zinc finger protein 286A	ZNF286A	Equus caballus (Horse)				DFKLVFQL	0.991	-1.2199	0	0	0	0	0	0	0	0	0	0	834.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	651.22	0	0	905.74	0	0	1564.8	1233.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R0H4	A0A9L0R0H4_HORSE	Zinc finger protein 510	ZNF510	Equus caballus (Horse)			metal ion binding [GO:0046872]	LDSWRKFHK	0.95907	-0.012353	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1638.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R0P8	A0A9L0R0P8_HORSE	WD repeat-containing protein 76	WDR76	Equus caballus (Horse)				LSASVSFPASR	0.88957	0.36122	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1076.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R0R1	A0A9L0R0R1_HORSE	Myosin IC	MYO1C	Equus caballus (Horse)		myosin complex [GO:0016459]	actin binding [GO:0003779]; ATP binding [GO:0005524]; cytoskeletal motor activity [GO:0003774]	AVASEIFK	0.98316	-0.70131	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	580.04	0	0	0	0	0	0	0	0	0	0	1335.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	493.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R0W3	A0A9L0R0W3_HORSE	Spermatosis associated 6 like	SPATA6L	Equus caballus (Horse)				ISRQSKPPFVVR	0.92327	0.29132	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	902.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	609.73	581.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R112	A0A9L0R112_HORSE	[histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B (EC 2.1.1.361) (EC 2.1.1.362) ([histone H4]-lysine20 N-methyltransferase KMT5B)	KMT5C	Equus caballus (Horse)		nucleus [GO:0005634]	histone H4K20 methyltransferase activity [GO:0042799]	GEGAFRLRPR	0.9853	-2.3361	516.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2061.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	933.8	0	2038.6	0	0	0	0	0	0	0	2241.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R119	A0A9L0R119_HORSE	SUN domain containing ossification factor	SUCO	Equus caballus (Horse)				LNEVMDNIVK	0	2.2504	626.37	0	0	650.13	767.17	671.88	1379	1890.4	1862.4	503.69	2810.2	2792.3	0	3755.3	4097.7	6818.1	5002.8	5247.9	0	2457	2622.2	0	590.86	0	0	0	0	8840.7	8754.6	7507	28130	26122	25018	5273.6	5191.7	3627.3	1289.6	5768.4	5544.7	8071.9	7204.3	6352.6	3906.4	3881.1	3565.6	1112.8	5777.1	6539.4	5052.1	5339.9	5500.9	873.69	4893.3	4067.4	870.51	901.23	926.99	1110.3	0	3480.9	560.13	2790.7	3134.4	1018.2	1641.6	957.07	2541.5	3747.7	2517.3	3696	10424	9848.6	2240.8	2074.8	2076.4
A0A9L0R132	A0A9L0R132_HORSE	Uncharacterized protein		Equus caballus (Horse)				ELAAAAK	0.98832	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1247.3	1285.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R153	A0A9L0R153_HORSE	"2-oxoglutarate dehydrogenase complex component E1 (EC 1.2.4.2) (2-oxoglutarate dehydrogenase, mitochondrial) (Alpha-ketoglutarate dehydrogenase) (Thiamine diphosphate (ThDP)-dependent 2-oxoglutarate dehydrogenase)"	OGDH	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	GRLNVLANVIR	0.90966	0.31191	0	0	0	0	0	0	0	716.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R196	A0A9L0R196_HORSE	Adhesion G protein-coupled receptor D1	ADGRD1	Equus caballus (Horse)		membrane [GO:0016020]		ICSSGGK	0.98844	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	670.48	624.56	644.42	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R1C2	A0A9L0R1C2_HORSE	Mitochondrial import inner membrane translocase subunit TIM23	TIMM23	Equus caballus (Horse)	protein transport [GO:0015031]	mitochondrial inner membrane [GO:0005743]		QPPERPR	0.97285	0.032902	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1040.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R1E3	A0A9L0R1E3_HORSE	C-X9-C motif containing 1	CMC1	Equus caballus (Horse)				DVLIPKIMR	0.98067	-0.25877	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2048.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	540.55	0	0
A0A9L0R1Q6	A0A9L0R1Q6_HORSE	Zinc finger protein 527	ZNF527	Equus caballus (Horse)				KLRQTDTQTER	0.9669	-0.17468	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1106.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R1U7	A0A9L0R1U7_HORSE	Sterol regulatory element binding transcription factor 1	SREBF1	Equus caballus (Horse)				AALHSVK	0.95327	0.23188	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	859.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R1U9	A0A9L0R1U9_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				NIEVLQVEEER	0.2093	1.0142	0	458.89	0	0	0	0	0	0	0	0	1143.5	1330.4	1386.1	1422	1467.3	2071.8	0	1783.1	0	1040.9	0	485.24	0	0	0	0	400.16	0	2328.7	2330.8	3235.2	2954.6	2843.9	1281.4	1164.9	0	1433.2	0	2668.7	2107.8	1687.8	1690.9	1813.6	1555.7	1394.6	0	3005.8	2865.1	1949.2	0	0	774.15	0	1939.8	1239.3	1073.5	1047.4	0	1495.7	0	581.78	1290.1	1309.8	1658.3	1541.8	1479.6	2262.6	2278	2238.9	1333.5	2263.4	2041.3	1689	1568.6	1700.2
A0A9L0R1V3	A0A9L0R1V3_HORSE	Tolloid like 1	TLL1	Equus caballus (Horse)				IRRIGSGISMFK	0.88356	0.4256	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1533.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R1X7	A0A9L0R1X7_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				EKGAESLFKEIMAENFPNR	0.78013	0.50712	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	987.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	904.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R256	A0A9L0R256_HORSE	FAT atypical cadherin 1	FAT1	Equus caballus (Horse)		membrane [GO:0016020]	calcium ion binding [GO:0005509]	FYKIRLPER	0.93109	0.27073	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	644.17	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R2F8	A0A9L0R2F8_HORSE	KIAA1549 like	KIAA1549L	Equus caballus (Horse)		membrane [GO:0016020]		AAGPAAR	0.98474	-0.97089	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1036.6	0	0	0	0	0	0	0	0	0	0	0	844.44	0	0	0	0	0	0	0	595.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	980.84	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R2I1	A0A9L0R2I1_HORSE	Signal peptide peptidase like 2A	SPPL2A	Equus caballus (Horse)		endosome membrane [GO:0010008]; lysosomal membrane [GO:0005765]		ATETAPR	0.90388	0.32102	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	266.86	0	0	0	0	381.66	0	0	0	0	0	0	760.64	541.13	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R2L2	A0A9L0R2L2_HORSE	Histone H2B	H3C5	Equus caballus (Horse)		membrane [GO:0016020]; nucleosome [GO:0000786]; nucleus [GO:0005634]	DNA binding [GO:0003677]	GSKKAVIK	0.085366	1.4917	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	667.24	0	0	0	0	1020.2	0	922.04	0	2213.4	1832.1	1375.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R2P4	A0A9L0R2P4_HORSE	Junctophilin 4	JPH4	Equus caballus (Horse)		endoplasmic reticulum membrane [GO:0005789]		NRLVHGGRVR	0.97291	-0.20784	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1446.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R2P5	A0A9L0R2P5_HORSE	PHD and ring finger domains 1	PHRF1	Equus caballus (Horse)			metal ion binding [GO:0046872]	LAIKPFYQK	0.98252	-0.94004	0	0	0	0	0	0	0	0	0	0	0	459.33	0	0	297.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	714.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	447.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R2T1	A0A9L0R2T1_HORSE	TRAF3 interacting protein 1	TRAF3IP1	Equus caballus (Horse)				LTDGSFK	0.98437	-1.3054	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1631.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1899.2	0	0	0	0	0	0	2409.5	2158.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R2T4	A0A9L0R2T4_HORSE	ABC1 atypical kinase-like domain-containing protein		Equus caballus (Horse)				VPAVIKK	0.55435	0.64803	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13980	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15156	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R2Y4	A0A9L0R2Y4_HORSE	Reverse transcriptase domain-containing protein		Equus caballus (Horse)				NGEMLKPFYLK	0.36486	0.72699	0	0	0	0	0	0	0	0	0	0	0	0	0	6663.6	0	10134	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5290.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2826.4	0	0	0	0	0	0	0	0	7041.1	0	0	0	0
A0A9L0R2Y7	A0A9L0R2Y7_HORSE	Malic enzyme	ME3	Equus caballus (Horse)			"malic enzyme activity [GO:0004470]; metal ion binding [GO:0046872]; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]"	VLDFAYK	0.9677	-0.057095	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1256.2	0	0	0	1073.3	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R312	A0A9L0R312_HORSE	NudE neurodevelopment protein 1	NDE1	Equus caballus (Horse)	cell differentiation [GO:0030154]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; kinetochore [GO:0000776]; spindle [GO:0005819]		EYEAELETQLQQIETRNR	0.98048	-0.59785	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	720.47	0	0	0	0	0	0	0	0	0	0	0	524.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R326	A0A9L0R326_HORSE	Histone-lysine N-methyltransferase (EC 2.1.1.364)	KMT2A	Equus caballus (Horse)	methylation [GO:0032259]	nucleus [GO:0005634]	DNA binding [GO:0003677]; histone H3K4 methyltransferase activity [GO:0042800]; metal ion binding [GO:0046872]	APEELSK	0.98497	-2.1057	0	0	0	0	0	0	0	0	0	1332.9	0	1765.4	0	0	0	0	0	0	0	1071	0	0	0	0	0	0	0	0	0	0	0	0	442.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R3G9	A0A9L0R3G9_HORSE	"Keratin, type I cytoskeletal 10 (Cytokeratin-10) (Keratin-10)"	KRT10A	Equus caballus (Horse)		intermediate filament [GO:0005882]		ALEESNYELEGK	0	251.42	5030.1	4253.2	3188	4338.4	3780.1	3026	6272.1	6150.6	6846.3	4719.7	12375	12035	20835	20212	18921	41439	35277	42729	802.29	11406	8927.2	2226.1	3656.3	2055.4	3217.9	2803.7	2583.2	43185	44802	43438	139600	142080	129690	34927	36196	26234	21446	52085	45515	43363	35497	35329	14892	12623	12894	41218	40164	40941	21029	21945	21029	3613.7	19218	17894	11880	10194	9431.9	31932	28950	30667	1957.1	11903	10336	13159	13140	12329	17506	17042	18207	16055	34155	29711	14664	12524	14316
A0A9L0R3L1	A0A9L0R3L1_HORSE	Cyclin dependent kinase 13	CDK13	Equus caballus (Horse)			ATP binding [GO:0005524]	TKPLTPSIGAKEK	0.9208	0.3065	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	623.99	0	640.56	700.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	660.3	567.91	745.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R417	A0A9L0R417_HORSE	UTP20 small subunit processome component	UTP20	Equus caballus (Horse)				TLEEQMRK	0.98771	-1.0796	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	472.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R454	A0A9L0R454_HORSE	"NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial"	NDUFS1	Equus caballus (Horse)		mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]	"4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]"	CINMLRIPVRR	0.98525	-2.476	0	0	0	14859	0	0	0	0	0	0	0	1219.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35183	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35025	0	0	0	0	0	30045	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R4F1	A0A9L0R4F1_HORSE	HAUS augmin like complex subunit 1	HAUS1	Equus caballus (Horse)	cell cycle [GO:0007049]; cell division [GO:0051301]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; spindle [GO:0005819]		LEKNLTATLVLEK	0.88413	0.37345	0	0	0	0	0	0	894.47	0	0	2387.3	2742.5	0	0	0	0	2338.7	2769.2	2865.4	0	1206.4	0	1820.5	0	0	0	0	0	0	587.92	0	0	1998.6	0	0	0	0	0	0	0	0	0	977.79	0	0	891.44	1637.5	0	0	0	0	0	0	0	1110.2	0	0	0	0	0	0	1564.8	0	1932.6	0	0	0	0	0	1016.3	813.27	802.53	0	0	1633.6	0
A0A9L0R4G4	A0A9L0R4G4_HORSE	glutamine--tRNA ligase (EC 6.1.1.18) (Glutaminyl-tRNA synthetase)	QARS1	Equus caballus (Horse)	translation [GO:0006412]	aminoacyl-tRNA synthetase multienzyme complex [GO:0017101]	aminoacyl-tRNA ligase activity [GO:0004812]; ATP binding [GO:0005524]	VGVTVAQTTMEPHLLEACVR	0.87952	0.39476	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39675	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R4N0	A0A9L0R4N0_HORSE	Calcineurin-like phosphoesterase domain-containing protein	LOC111772263	Equus caballus (Horse)				AVNRLNPKPK	0.98621	-1.2782	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	396.38	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R4P3	A0A9L0R4P3_HORSE	Apolipoprotein A-II (Apolipoprotein A2)	APOA2	Equus caballus (Horse)		extracellular region [GO:0005576]		APELQAQAK	0	4.8654	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	652.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R4S1	A0A9L0R4S1_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	OBSCN	Equus caballus (Horse)	phosphorylation [GO:0016310]	cytoplasm [GO:0005737]; organelle [GO:0043226]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	APEARPSATK	0.98282	-0.75696	0	0	8662.2	0	0	10078	0	0	50163	0	1460	0	0	0	1176.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	77633	0	0	0	0	0	0	0	0	28623	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10181	0	0	0	0	1682.8	0	0	1503.4	795.48	0	938.11	0	0	0
A0A9L0R4T6	A0A9L0R4T6_HORSE	CACN subunit beta associated regulatory protein	CBARP	Equus caballus (Horse)		membrane [GO:0016020]		HDPHFDDAPPPPR	0.73421	0.56769	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	692.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R4U3	A0A9L0R4U3_HORSE	Syntaxin 17	STX17	Equus caballus (Horse)				GVPRDAGR	0.98882	-1.6929	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1247.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R4Y9	A0A9L0R4Y9_HORSE	Myosin IIIA	MYO3A	Equus caballus (Horse)				KNGQKAAVK	0.97404	-0.18688	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3003.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R500	A0A9L0R500_HORSE	Biphenyl hydrolase like	BPHL	Equus caballus (Horse)				APGSAAR	0.96058	0.21952	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	657.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	774.31	0	0
A0A9L0R508	A0A9L0R508_HORSE	Endonuclease/exonuclease/phosphatase domain-containing protein		Equus caballus (Horse)				LQPQNSNNR	0.96684	-0.09653	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	608.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R519	A0A9L0R519_HORSE	SKI family transcriptional corepressor 1	SKOR1	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		KARYAIQQK	0.96371	-0.12747	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	688.61	0	1135.1	1163.3	1127	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	659.81	685.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R561	A0A9L0R561_HORSE	Nuclear receptor binding SET domain protein 2	NSD2	Equus caballus (Horse)	methylation [GO:0032259]	nucleus [GO:0005634]	DNA binding [GO:0003677]; histone H3 methyltransferase activity [GO:0140938]; metal ion binding [GO:0046872]; protein-lysine N-methyltransferase activity [GO:0016279]	GVGSPSGR	0.98064	-0.58614	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	416.86	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R5A3	A0A9L0R5A3_HORSE	Origin recognition complex subunit 1	ORC1	Equus caballus (Horse)	DNA replication [GO:0006260]	nucleus [GO:0005634]	ATP binding [GO:0005524]; DNA binding [GO:0003677]	LAYYSTRMKSR	0.9727	-0.1926	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1129.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R5A8	A0A9L0R5A8_HORSE	Uncharacterized protein		Equus caballus (Horse)				VTFQSPLR	0.96804	0.023206	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	800.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R5G9	A0A9L0R5G9_HORSE	Doublecortin domain containing 1	DCDC1	Equus caballus (Horse)			carbohydrate binding [GO:0030246]	ILADLDTMKHK	0.98383	-0.78936	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1508.8	1503.1	0	0	0	0	0	0	0	0	0	0	0	0	801.22	817.59	720.55	495.02	457.52	0	1147.5	1159.1	1267.1	479.55	300.23	0	0	0	0	701.62	804.69	0	522.08	434.79	409.32	409.23	636.82	551.81	562.72	471.82	463.24	807.25	701.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R5H1	A0A9L0R5H1_HORSE	Cilia and flagella associated protein 44	CFAP44	Equus caballus (Horse)				KELSNAK	0.98445	-0.69529	0	681.89	0	0	0	0	0	0	0	0	0	783.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R5M6	A0A9L0R5M6_HORSE	"Myosin light chain 3 (Myosin light chain 1, slow-twitch muscle B/ventricular isoform)"	MYL3	Equus caballus (Horse)				NKDTGTYEDFVEGLRVFDK	0.94341	0.25201	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1523.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R600	A0A9L0R600_HORSE	Coiled-coil domain containing 169		Equus caballus (Horse)				RNPANQK	0.9839	-0.69926	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1066.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R607	A0A9L0R607_HORSE	Myosin motor domain-containing protein		Equus caballus (Horse)		myosin complex [GO:0016459]	actin binding [GO:0003779]; ATP binding [GO:0005524]; cytoskeletal motor activity [GO:0003774]	KEAELASPERETPDISTSQPNSK	0.97073	0.20386	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1145.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R678	A0A9L0R678_HORSE	Voltage-dependent T-type calcium channel subunit alpha	CACNA1H	Equus caballus (Horse)		monoatomic ion channel complex [GO:0034702]	calcium channel activity [GO:0005262]	QAAPGEQGGLGR	0.97343	0.12566	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1172.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R6D1	A0A9L0R6D1_HORSE	SPOUT domain containing methyltransferase 1	SPOUT1	Equus caballus (Horse)				QLPESKTYR	0.98773	-1.7783	0	0	0	0	0	0	0	0	0	0	0	805.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R6R1	A0A9L0R6R1_HORSE	MICOS complex subunit		Equus caballus (Horse)		MICOS complex [GO:0061617]		GVYDFVK	0.97185	0.032335	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2273.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R6R7	A0A9L0R6R7_HORSE	Collagen type IV alpha 6 chain	COL4A6	Equus caballus (Horse)		basement membrane [GO:0005604]; collagen trimer [GO:0005581]; membrane [GO:0016020]		GIPGLPGPR	0.867	0.45728	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1218.5	0	0	0	1061.6	1110.5	0	0	0	0	0	911.89	0	0	0	0	0	0	0	0	0	0	0	924.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R6S1	A0A9L0R6S1_HORSE	"6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 (EC 2.7.1.105) (EC 3.1.3.46) (6PF-2-K/Fru-2,6-P2ase heart-type isozyme)"	PFKFB2	Equus caballus (Horse)	phosphorylation [GO:0016310]		ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; kinase activity [GO:0016301]	QFAQALR	0.96846	-0.037184	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1328.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R6T7	A0A9L0R6T7_HORSE	PDGFA associated protein 1	PDAP1	Equus caballus (Horse)				QREEAARK	0.88454	0.35482	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	974.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R6W8	A0A9L0R6W8_HORSE	IQ motif and Sec7 domain ArfGEF 3	IQSEC3	Equus caballus (Horse)				ELKSNEDHVTYVTK	0.89583	0.3282	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	836.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R783	A0A9L0R783_HORSE	protein kinase C (EC 2.7.11.13)	PKN2	Equus caballus (Horse)		cleavage furrow [GO:0032154]; midbody [GO:0030496]	ATP binding [GO:0005524]	GLPFSENVSAVQK	0.93079	0.26135	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	705.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R7E1	A0A9L0R7E1_HORSE	FAM111 trypsin like peptidase A	FAM111A	Equus caballus (Horse)				IPFDKKSNMK	0.98686	-1.4359	0	0	0	0	0	0	0	0	0	518.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R7F5	A0A9L0R7F5_HORSE	protein disulfide-isomerase (EC 5.3.4.1)	P4HB	Equus caballus (Horse)		endoplasmic reticulum lumen [GO:0005788]	isomerase activity [GO:0016853]	AEGSEIR	0.96901	-0.036094	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1425.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R7G5	A0A9L0R7G5_HORSE	Uncharacterized protein		Equus caballus (Horse)				TVWTFLK	0.98804	-1.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	448.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R7L0	A0A9L0R7L0_HORSE	Autophagy related 2A	ATG2A	Equus caballus (Horse)				DPWAGRAVR	0.98499	-0.98965	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34426	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R7N0	A0A9L0R7N0_HORSE	TBC1 domain family member 9	TBC1D9	Equus caballus (Horse)				EFLKEQAWKIHFAEYGQGICMYR	0.96774	-0.055359	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3018.3	1642.1	423.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R7N2	A0A9L0R7N2_HORSE	Armadillo repeat containing X-linked 5	ARMCX5	Equus caballus (Horse)				LSKNQANTR	0.97226	-0.1822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	873.48	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R7P9	A0A9L0R7P9_HORSE	FIG4 phosphoinositide 5-phosphatase	FIG4	Equus caballus (Horse)		membrane [GO:0016020]		GSSGLFR	0.96782	-0.046309	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2893.4	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R7R5	A0A9L0R7R5_HORSE	"Serine/threonine-protein phosphatase PGAM5, mitochondrial (EC 3.1.3.16) (Phosphoglycerate mutase family member 5) (Serine/threonine-protein phosphatase Pgam5, mitochondrial)"	PGAM5	Equus caballus (Horse)				RPGDPDSPRAARRPEGNMSLAAR	0.97282	-0.20263	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	951.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3869.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R7U7	A0A9L0R7U7_HORSE	FAD-binding PCMH-type domain-containing protein	LOC100146423	Equus caballus (Horse)			"2 iron, 2 sulfur cluster binding [GO:0051537]; metal ion binding [GO:0046872]"	TQTYRALLKHLK	0.91213	0.29671	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	902.32	0	891.44	0	0	0	0	0	0	941.9	1072.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R7X8	A0A9L0R7X8_HORSE	rRNA adenine N(6)-methyltransferase (EC 2.1.1.-)	TFB2M	Equus caballus (Horse)			"RNA binding [GO:0003723]; rRNA (adenine-N6,N6-)-dimethyltransferase activity [GO:0000179]"	LEVVHLKPPIMVSK	0.88937	0.43119	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	687.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R7Y7	A0A9L0R7Y7_HORSE	Homer scaffold protein 2	HOMER2	Equus caballus (Horse)		cytoplasm [GO:0005737]; postsynaptic density [GO:0014069]		EKAEIEDIR	0.98602	-2.9551	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1934.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R853	A0A9L0R853_HORSE	ATP-dependent RNA helicase (EC 3.6.4.13)	DDX46	Equus caballus (Horse)			ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]; RNA binding [GO:0003723]	GGGGNEK	0.98695	-1.0582	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3492.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	527.11	0	0	0	0	881.83	0	0	0	381.78	0	0	0	0	0	0	0	0	0	0	0	0	0	329.19	0	0	0	0	0
A0A9L0R857	A0A9L0R857_HORSE	Uncharacterized protein		Equus caballus (Horse)				LLGRMFR	0.9881	-1.1844	0	0	0	0	0	0	0	0	0	0	804.81	0	1382.2	0	1414	1788.2	1807.8	0	0	0	1330.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	376.23	0	0	0	0	0	0	1248.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	352.95	0	0	0	0	350.21	0	0	0	0	0
A0A9L0R893	A0A9L0R893_HORSE	Phospholipid-transporting ATPase (EC 7.6.2.1)	ATP11C	Equus caballus (Horse)		membrane [GO:0016020]	ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]	GRPGGVA	0.96243	0.2173	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20215	0	0	0	0	0	0	0	0	0	0	0	0	0	35666	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R8E2	A0A9L0R8E2_HORSE	Calpain 2	CAPN2	Equus caballus (Horse)	proteolysis [GO:0006508]		cysteine-type peptidase activity [GO:0008234]; metal ion binding [GO:0046872]	EVLNRFK	0.99043	-1.6556	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1899.2	0	0	0	0	0	0	0	0	2463.3	0	0	0	0	0	2246.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R8E4	A0A9L0R8E4_HORSE	Cytochrome c oxidase assembly factor 1	COA1	Equus caballus (Horse)		membrane [GO:0016020]		ISFSKTAK	0.98831	-1.7172	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	923.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R8I8	A0A9L0R8I8_HORSE	Phosphoinositide phospholipase C (EC 3.1.4.11)	PLCD3	Equus caballus (Horse)	lipid catabolic process [GO:0016042]; signal transduction [GO:0007165]		hydrolase activity [GO:0016787]	FGGAFAPAR	0.98633	-1.3589	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	990.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R8K9	A0A9L0R8K9_HORSE	Conserved oligomeric Golgi complex subunit 6 (COG complex subunit 6) (Component of oligomeric Golgi complex 6)	COG6	Equus caballus (Horse)	intra-Golgi vesicle-mediated transport [GO:0006891]; protein transport [GO:0015031]	Golgi membrane [GO:0000139]; Golgi transport complex [GO:0017119]		EQTQDLIVK	0.96858	-0.034517	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	766.2	0	0	0	0	0	0	0	0	0	0	0	0	0	624.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R8Q0	A0A9L0R8Q0_HORSE	Acyl-CoA 6-desaturase (EC 1.14.19.3) (Fatty acid desaturase 2)	FADS2	Equus caballus (Horse)	fatty acid biosynthetic process [GO:0006633]	endoplasmic reticulum membrane [GO:0005789]	"oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	WLVIDRKVYNITK	0.91908	0.29326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2057.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R8W1	A0A9L0R8W1_HORSE	Transforming growth factor beta-3 proprotein	TGFB3	Equus caballus (Horse)	positive regulation of cell division [GO:0051781]	extracellular region [GO:0005576]	growth factor activity [GO:0008083]	GITSKVFR	0.9879	-1.7191	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1330	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1087.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R8Z4	A0A9L0R8Z4_HORSE	Vacuolar protein sorting-associated protein 53 homolog	VPS53	Equus caballus (Horse)		endosome membrane [GO:0010008]; Golgi apparatus [GO:0005794]		ILDMKGLK	0.98329	-0.67872	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	620.03	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R920	A0A9L0R920_HORSE	DIX domain containing 1	DIXDC1	Equus caballus (Horse)	Wnt signaling pathway [GO:0016055]			LLQQHQAK	0.96254	-0.0089121	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	569.48	0	0	0	0	0	0	0	0	1036.4	0	0	0	0
A0A9L0R925	A0A9L0R925_HORSE	Rho family GTPase 2	RND2	Equus caballus (Horse)			GTP binding [GO:0005525]	GSARGSESPLR	0.97409	0.076402	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2151.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R926	A0A9L0R926_HORSE	CDKN1A interacting zinc finger protein 1	CIZ1	Equus caballus (Horse)			metal ion binding [GO:0046872]	GAVGWGRSSWK	0.98585	-2.048	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	623.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1110.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R972	A0A9L0R972_HORSE	SLIT-ROBO Rho GTPase activating protein 1	SRGAP1	Equus caballus (Horse)				ELDGPVYEK	0.98627	-1.421	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	613.12	0	0	0	0	0	0	0	0	0	0	0	3114.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R9B5	A0A9L0R9B5_HORSE	Multiple C2 and transmembrane domain containing 1	MCTP1	Equus caballus (Horse)		membrane [GO:0016020]		ASLRTLIPKEQK	0.91231	0.30893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	621.01	0	0	0	0	0	0	0	0	0	0	0	0	492.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R9G5	A0A9L0R9G5_HORSE	GRIP and coiled-coil domain containing 2	GCC2	Equus caballus (Horse)				DALLETVNR	0.88166	0.38576	0	0	0	0	0	0	0	0	0	0	0	0	0	627.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R9J0	A0A9L0R9J0_HORSE	Multiple C2 and transmembrane domain containing 2	MCTP2	Equus caballus (Horse)		membrane [GO:0016020]		RHSSLIRNLR	0.97509	-0.20537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	478.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R9J2	A0A9L0R9J2_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				EWNDIFKILK	0.98549	-2.4635	0	0	0	0	0	0	0	0	0	0	0	643.63	0	498.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1039.2	0	0	0	0	0	0	0	0	0	0	0	0	0	597.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	734.24	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R9M1	A0A9L0R9M1_HORSE	Zinc finger protein 831	ZNF831	Equus caballus (Horse)				ALEPGRRR	0.98609	-2.0172	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	711.26	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0R9Q2	A0A9L0R9Q2_HORSE	Myosin heavy chain 9	MYH9	Equus caballus (Horse)		myosin complex [GO:0016459]	actin binding [GO:0003779]; ATP binding [GO:0005524]; cytoskeletal motor activity [GO:0003774]	GESGAGK	0.98785	-1.5449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	447.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	341.96	0	0	0	0	0	0	0	0	0	0	0	0	392.2	0	0	0	0	0	0	0
A0A9L0R9V2	A0A9L0R9V2_HORSE	Calcyphosine 2	CAPS2	Equus caballus (Horse)			metal ion binding [GO:0046872]	ILTGLGKYLQQLDKEGNGLLDK	0.70588	0.6232	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	799.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RA55	A0A9L0RA55_HORSE	Bromodomain containing 4	BRD4	Equus caballus (Horse)	chromatin organization [GO:0006325]			LAELQEQLK	0.97569	0.079954	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	624.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RA70	A0A9L0RA70_HORSE	Uncharacterized protein		Equus caballus (Horse)				VGGLMTR	0.95573	0.23005	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	728.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RA80	A0A9L0RA80_HORSE	LHFPL tetraspan subfamily member 3	LHFPL3	Equus caballus (Horse)		membrane [GO:0016020]		ILLPLGK	0.96468	0.21339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	102680	0	0	0	0	0	812.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RAD2	A0A9L0RAD2_HORSE	Phosphatidate cytidylyltransferase (EC 2.7.7.41)	CDS2	Equus caballus (Horse)	CDP-diacylglycerol biosynthetic process [GO:0016024]	membrane [GO:0016020]	phosphatidate cytidylyltransferase activity [GO:0004605]	MTVGFVIK	0.99024	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	554.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RAJ9	A0A9L0RAJ9_HORSE	Centrosomal protein 104	CEP104	Equus caballus (Horse)				LKEINFR	0.98917	-1.7566	0	0	0	0	0	0	0	0	0	0	2374	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	730.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RAK3	A0A9L0RAK3_HORSE	PR/SET domain 11	PRDM11	Equus caballus (Horse)				KCLQLYKLR	0.98497	-1.3127	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	577.56	0	0	0	0	0	0	0	0	0	0
A0A9L0RAL1	A0A9L0RAL1_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	NUAK1	Equus caballus (Horse)				QSATMPK	0.98804	-1.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	501.68	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	479.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RAM5	A0A9L0RAM5_HORSE	MIS18 binding protein 1	MIS18BP1	Equus caballus (Horse)				LEATGMSINRLSSNK	0.98751	-1.8481	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	646.64	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RAP3	A0A9L0RAP3_HORSE	Deoxycytidine kinase	DCK	Equus caballus (Horse)	carbohydrate derivative metabolic process [GO:1901135]		deoxynucleoside kinase activity [GO:0019136]	IKKVSIEGNIAAGK	0.91125	0.31848	0	0	0	0	0	0	0	0	0	0	2105.7	2526.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2299.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RAU9	A0A9L0RAU9_HORSE	"Mucin 5AC, oligomeric mucus/gel-forming"	MUC5AC	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		LSPEFKGR	0.98959	-1.6271	0	0	0	0	0	0	0	0	0	0	0	0	0	611.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RAW6	A0A9L0RAW6_HORSE	Cyclin dependent kinase 16	CDK16	Equus caballus (Horse)			ATP binding [GO:0005524]	YRAEALLSHAPR	0.9859	-1.9302	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1150.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RB67	A0A9L0RB67_HORSE	Solute carrier family 26 member 4	SLC26A4	Equus caballus (Horse)		membrane [GO:0016020]		LLEPLQKSVLAAVVIANLKGMFMQVCDVPR	0.91179	0.3141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	589.16	0	671.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RB98	A0A9L0RB98_HORSE	Non-homologous end joining factor 1	NHEJ1	Equus caballus (Horse)	double-strand break repair via nonhomologous end joining [GO:0006303]	nucleus [GO:0005634]		DTAGPGK	0.97413	0.13337	0	0	0	532.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	74038	2122.2	0	0	372.38	0	0	18147	0	0	1129.7	0	0
A0A9L0RBF4	A0A9L0RBF4_HORSE	Tetratricopeptide repeat domain 23	TTC23	Equus caballus (Horse)				GLHRPKNPLPH	0.98649	-2.6784	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	586.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RBI3	A0A9L0RBI3_HORSE	Large ribosomal subunit protein eL38 (60S ribosomal protein L38)	RPL38	Equus caballus (Horse)		ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840]		INVFFKRATR	0.97401	-0.19537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2646.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RBJ0	A0A9L0RBJ0_HORSE	"RB binding protein 6, ubiquitin ligase"	RBBP6	Equus caballus (Horse)			metal ion binding [GO:0046872]	GAGDSKK	0.90582	0.32096	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1030.2	1052.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RBJ6	A0A9L0RBJ6_HORSE	Mannosidase alpha class 2C member 1	MAN2C1	Equus caballus (Horse)				VPAADRPGAR	0.96311	-0.14044	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	485.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RBP4	A0A9L0RBP4_HORSE	"Spliceosome associated factor 3, U4/U6 recycling protein"	SART3	Equus caballus (Horse)			RNA binding [GO:0003723]	ELWDSIMTKGNAK	0.26174	0.90571	0	1330.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1228.6	2476.1	0	0	0	0	0	0	0	0	0	468.88	0	644.73	0	0	0	0	0	695.18	0	0	0	513.54	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RC34	A0A9L0RC34_HORSE	Uncharacterized protein		Equus caballus (Horse)				GSLMYCR	0.94509	0.24295	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	354.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RCB7	A0A9L0RCB7_HORSE	Rho GTPase activating protein 18	ARHGAP18	Equus caballus (Horse)				MSKHLLEMARER	0.96404	-0.13945	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	501.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RCC9	A0A9L0RCC9_HORSE	Decapping mRNA 2	DCP2	Equus caballus (Horse)			metal ion binding [GO:0046872]	AQVFEETGFDIK	0.92625	0.28308	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	697.09	705.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	757.32	0	0	0	0	460.43	0	0	705.87	0	0	0	0	0	0	0	0
A0A9L0RCD3	A0A9L0RCD3_HORSE	Transcription factor AP-4	TFAP4	Equus caballus (Horse)				LSKELSGSSPK	0.98988	-1.2605	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	631.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	987.92	0	0	0	0	0	0	0	0	0	0	632.42	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RCE2	A0A9L0RCE2_HORSE	Zinc finger protein 709-like	LOC100630362	Equus caballus (Horse)			metal ion binding [GO:0046872]	CSKAFTSSRYLR	0.87721	0.40637	0	0	0	0	0	0	0	0	0	0	683.44	675.83	0	0	0	1140.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RCG0	A0A9L0RCG0_HORSE	Mirror-image polydactyly 1	MIPOL1	Equus caballus (Horse)				LTKEDKEQR	0.974	0.10547	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	895.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	614.29	0	0	0	0	0	0	0	0	0	0	332.75	0
A0A9L0RCN9	A0A9L0RCN9_HORSE	Collagen type VI alpha 6 chain	COL6A6	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		LSKHLVNVAER	0.98646	-1.4443	0	0	0	0	0	0	0	0	0	0	0	623.93	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RCY4	A0A9L0RCY4_HORSE	Ras-related protein Rab-21	RAB21	Equus caballus (Horse)	protein transport [GO:0015031]	cleavage furrow [GO:0032154]; early endosome membrane [GO:0031901]; endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]	GTP binding [GO:0005525]	AGRRACPR	0.98596	-1.4048	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	819.42	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RD12	A0A9L0RD12_HORSE	BMP/retinoic acid inducible neural specific 3	BRINP3	Equus caballus (Horse)	negative regulation of cell cycle [GO:0045786]			QPLISLPRQR	0.98637	-2.4276	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1476.4	0	0	0	0	0	0	0	1118.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RD60	A0A9L0RD60_HORSE	SHC binding and spindle associated 1	SHCBP1	Equus caballus (Horse)		cytoplasm [GO:0005737]; spindle [GO:0005819]		AGGELADGWLR	0.9097	0.29921	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1289.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RDA8	A0A9L0RDA8_HORSE	Period circadian regulator 3	PER3	Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]		YLKSYNIPALK	0.98463	-1.2854	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	578.52	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RDC4	A0A9L0RDC4_HORSE	Heteroous nuclear ribonucleoprotein M	HNRNPM	Equus caballus (Horse)			RNA binding [GO:0003723]	GEGERPTQNEK	0.95206	0.23713	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	536.45	0	549.61	0	0	0	595.53	0	0	348.75	0	0	0	338.87	346.98	0	311.2	404.75	0	417.58	0	0	776.54	540.57	553.31	0	0	0	0	0	0	397.07	434.52	501.61	546.43	672.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	473.83	348.59	0	0	0
A0A9L0RDK9	A0A9L0RDK9_HORSE	Smoothelin	SMTN	Equus caballus (Horse)				AGSVRDRVR	0.98659	-3.1836	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1093	0	0	0	0	0	0
A0A9L0RDM2	A0A9L0RDM2_HORSE	"Membrane bound transcription factor peptidase, site 1"	MBTPS1	Equus caballus (Horse)	proteolysis [GO:0006508]	membrane [GO:0016020]	serine-type peptidase activity [GO:0008236]	VKFYDENTR	0.98565	-1.9426	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2285.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RDM5	A0A9L0RDM5_HORSE	Nudix hydrolase 4	NUDT4	Equus caballus (Horse)			hydrolase activity [GO:0016787]	AAPLLPSR	0.94944	0.23782	0	0	0	6013.9	6340.9	0	0	0	32857	5782.1	19924	0	31812	697.71	31912	0	0	0	0	0	24188	5118.2	5034.5	0	4707	0	4970.2	44714	0	0	0	0	0	46349	47559	33582	2088.5	35023	0	43965	42236	0	0	0	0	29321	0	0	0	0	0	4577.3	0	0	0	0	0	36607	40606	0	0	23492	24876	0	0	8228.1	0	0	0	0	28069	0	0	8653.1	0
A0A9L0RDM7	A0A9L0RDM7_HORSE	Transient receptor potential cation channel subfamily A member 1	TRPA1	Equus caballus (Horse)		membrane [GO:0016020]		AVKAKTHPS	0.98812	-1.0364	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1449.7	0	0	503.61	0	0	0	0	0	0	1130.7	0	0	0	0	0	0	0	975	0	0	0	0	0	0	692.97	715.08	604.79	0	0	0	953.81	0	0	0	623.12	630.24	0	0	0	0	0	1295.3	0	524.14	506.34	0	0	0	621.23	0	662.09	0	0	0	0	0	0
A0A9L0RDX7	A0A9L0RDX7_HORSE	Glutamate receptor interacting protein 2	GRIP2	Equus caballus (Horse)				LLAIDNIR	0.93521	0.27822	0	0	0	0	0	0	0	0	572.65	0	0	0	0	0	0	0	2028.7	0	0	0	0	0	0	0	0	0	0	0	0	0	1364.4	1368.8	0	2493.7	2776	0	0	0	0	0	0	1973.8	0	0	0	0	2083.3	0	0	0	0	0	0	0	0	0	0	1703.8	1855.5	0	0	0	0	0	0	0	0	0	0	0	0	814.53	0	0	0
A0A9L0RE30	A0A9L0RE30_HORSE	ELAV like RNA binding protein 1	ELAVL1	Equus caballus (Horse)			RNA binding [GO:0003723]	GFWSLVRRHR	0.97993	-0.31213	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	473.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RE61	A0A9L0RE61_HORSE	Proteasome inhibitor PI31 subunit	PSMF1	Equus caballus (Horse)	regulation of metabolic process [GO:0019222]	proteasome complex [GO:0000502]		QPPWHVDTGIVRGSAWQSTINK	0.98629	-1.9242	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3750.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RE70	A0A9L0RE70_HORSE	Sideroflexin 2	SFXN2	Equus caballus (Horse)	amino acid transport [GO:0006865]	membrane [GO:0016020]; mitochondrion [GO:0005739]		LLLASCRVR	0.98986	-1.6206	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	370.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RE86	A0A9L0RE86_HORSE	Protein inhibitor of activated STAT 1	PIAS1	Equus caballus (Horse)		nucleus [GO:0005634]	metal ion binding [GO:0046872]; transferase activity [GO:0016740]	KHELLTK	0.98585	-1.5001	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1129.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	866.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RE93	A0A9L0RE93_HORSE	SKI family transcriptional corepressor 2	SKOR2	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		DDAESLAK	0.87849	0.39003	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	448.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RED3	A0A9L0RED3_HORSE	ADAM metallopeptidase with thrombospondin type 1 motif 16	ADAMTS16	Equus caballus (Horse)	proteolysis [GO:0006508]	extracellular region [GO:0005576]	metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237]	ALAPLGVDSLHLR	0.90948	0.3001	0	0	0	554.53	0	734.47	0	737.97	0	1514.2	2053	2042.1	0	0	0	2390.5	2350.1	2697.3	0	0	0	0	1374.1	0	0	0	0	0	0	0	1005.8	1048.7	0	2584.5	2815	2686.5	0	0	0	838.22	0	0	729.68	709.11	0	1484.9	1613.6	1727.2	0	0	0	0	669.02	0	0	1161.2	1141.8	0	0	0	0	0	0	0	0	0	0	0	0	0	633.28	0	0	1156.3	0
A0A9L0RED6	A0A9L0RED6_HORSE	Small RNA binding exonuclease protection factor La	SSB	Equus caballus (Horse)		ribonucleoprotein complex [GO:1990904]	RNA binding [GO:0003723]	GAKEGIILFK	0.98565	-3.0248	0	0	0	0	0	0	0	0	0	0	0	2868.8	366.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	286.12	0	0	0	753.05	0	0	0	294.23	0	0	0	0	0	0	0	0	0	0	0	359.57	0	0	0	0	0	0	0	0	0	0
A0A9L0REE6	A0A9L0REE6_HORSE	C-type lectin domain-containing protein	LOC102149924	Equus caballus (Horse)				LGFALCASVPDLL	0.96003	-0.011857	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2048.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0REH6	A0A9L0REH6_HORSE	Uncharacterized protein		Equus caballus (Horse)				AAMAEPK	0.96701	-0.026653	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1933.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0REH8	A0A9L0REH8_HORSE	Zinc finger protein 252	ZNF252	Equus caballus (Horse)			metal ion binding [GO:0046872]	LSLIQHK	0.99064	-1.259	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	525.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	861.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0REK4	A0A9L0REK4_HORSE	Septin	SEPTIN11	Equus caballus (Horse)		cytoskeleton [GO:0005856]	GTP binding [GO:0005525]	NELHKFK	0.98464	-1.1738	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2331.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RER0	A0A9L0RER0_HORSE	RNA helicase (EC 3.6.4.13)	DDX23	Equus caballus (Horse)			ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]	DWRIFREDYSITTK	0.66436	0.64124	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	541.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RER2	A0A9L0RER2_HORSE	Hexosyltransferase (EC 2.4.1.-)	CHPF2	Equus caballus (Horse)		Golgi cisterna membrane [GO:0032580]	hexosyltransferase activity [GO:0016758]	LMDVVSKK	0.98788	-1.0796	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1906.2	0	635.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RER9	A0A9L0RER9_HORSE	Pleckstrin homology domain interacting protein	PHIP	Equus caballus (Horse)				VPAATHER	0.9344	0.24858	0	0	0	0	0	0	0	0	0	0	0	0	883.69	0	0	0	0	0	0	0	643.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	709.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	732.86	0	0	0
A0A9L0RET0	A0A9L0RET0_HORSE	Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.4.19.12) (Deubiquitinating enzyme 47) (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47)	USP47	Equus caballus (Horse)				FDFDYTTMHRIK	0.97839	0.06164	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13168	0	0	0	0	0	0	0	0	0	1604.3	439.93	0	0	0	0	0	0	0	0	0	0	0	0	1684.2	0	0	0	4852.3	7010.1	7057.8	0	0	0	0	0	0	0	0	0	4082.4	0	0	0	0	0	0	0	0	0	0	0	0	0	631.31	0	0	0
A0A9L0REU2	A0A9L0REU2_HORSE	furin (EC 3.4.21.75) (Dibasic-processing enzyme) (Paired basic amino acid residue-cleaving enzyme)	FURIN	Equus caballus (Horse)	proteolysis [GO:0006508]	membrane [GO:0016020]	serine-type endopeptidase activity [GO:0004252]	LTLSYNR	0.97504	0.086191	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	718.8	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RF13	A0A9L0RF13_HORSE	VAC14 component of PIKFYVE complex	VAC14	Equus caballus (Horse)		intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]		ILEVTEQNK	0.97009	0.16716	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	722.12	0	0	0	0	0	0	0	788.03	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	573.85	643.98	0	0	0	0	0	0	0
A0A9L0RF23	A0A9L0RF23_HORSE	PIH1 domain-containing protein 1	PIH1D1	Equus caballus (Horse)				TNSSEGK	0.95579	0.22844	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	572.4	349.84	0	0	429.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RF48	A0A9L0RF48_HORSE	Fas binding factor 1	FBF1	Equus caballus (Horse)				ASILEMRK	0.98625	-2.4356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	411.26	0	0	0	0	0	507.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RFA5	A0A9L0RFA5_HORSE	HEAT repeat-containing protein 1	HEATR1	Equus caballus (Horse)	rRNA processing [GO:0006364]	nucleolus [GO:0005730]; ribonucleoprotein complex [GO:1990904]		AVEEQAINR	0.98037	-0.52852	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	687.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	697.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	895.89	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RFF0	A0A9L0RFF0_HORSE	Phosphodiesterase (EC 3.1.4.-)	PDE9A	Equus caballus (Horse)			hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	ATAQIGFIR	0.98604	-1.3525	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1247.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RFH3	A0A9L0RFH3_HORSE	Myocardin related transcription factor B	MRTFB	Equus caballus (Horse)	positive regulation of transcription by RNA polymerase II [GO:0045944]			APAPAAPQPFIK	0.98282	-0.75165	0	611.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2849.3	2493.5	0	0	0	0	0	0	0	0	0	0	0	0	2012.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1298.1	1327.3	1297.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RFL6	A0A9L0RFL6_HORSE	Golgi membrane protein 1	GOLM1	Equus caballus (Horse)		membrane [GO:0016020]		GVGEVGR	0.9315	0.25645	0	0	0	0	0	0	0	0	0	0	0	0	0	0	707.32	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	579.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RFS0	A0A9L0RFS0_HORSE	Chitinase domain-containing protein 1	CHID1	Equus caballus (Horse)				SGPAGLR	0.98925	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26279	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RFT0	A0A9L0RFT0_HORSE	Synaptotagmin binding cytoplasmic RNA interacting protein	SYNCRIP	Equus caballus (Horse)		cytoplasm [GO:0005737]	RNA binding [GO:0003723]	KLKDYAFIHFDER	0.98157	-0.66133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	547.72	505.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RFT2	A0A9L0RFT2_HORSE	RNA-binding protein PNO1 (RNA-binding protein pno1)	PNO1	Equus caballus (Horse)				DVSALTK	0.98535	-2.1031	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	253.69	488.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RFW1	A0A9L0RFW1_HORSE	RED-like N-terminal domain-containing protein	LOC111767784	Equus caballus (Horse)		nucleus [GO:0005634]		LTQILSYLRQGTRNK	0.885	0.35387	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	881.44	889.22	0	0	728.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RFW7	A0A9L0RFW7_HORSE	Bardet-Biedl syndrome 1	BBS1	Equus caballus (Horse)				TALRPQHQETR	0.92026	0.29087	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	597.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RFX6	A0A9L0RFX6_HORSE	Solute carrier family 26 member 11	SLC26A11	Equus caballus (Horse)		membrane [GO:0016020]		GTAVTLSPALPLR	0.96917	-0.15973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	781.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	609.42	0	0	0	0	0
A0A9L0RFY1	A0A9L0RFY1_HORSE	Neurofilament medium polypeptide (160 kDa neurofilament protein) (Neurofilament 3) (Neurofilament triplet M protein)	NEFM	Equus caballus (Horse)		axon [GO:0030424]; intermediate filament [GO:0005882]		EYQDLLNVK	0.98793	-1.0303	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	753.08	0	602.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RG85	A0A9L0RG85_HORSE	Conserved oligomeric Golgi complex subunit 2 (Component of oligomeric Golgi complex 2)	COG2	Equus caballus (Horse)	protein transport [GO:0015031]	Golgi apparatus [GO:0005794]; membrane [GO:0016020]		TYATIDK	0.96038	-0.019391	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2076	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RG99	A0A9L0RG99_HORSE	Angiopoietin-1	ANGPT1	Equus caballus (Horse)				LNGIKWHYFK	0.9882	-1.7984	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	668.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	734.24	518.23	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RGD5	A0A9L0RGD5_HORSE	"SET domain containing 1A, histone lysine methyltransferase"	SETD1A	Equus caballus (Horse)	methylation [GO:0032259]		methyltransferase activity [GO:0008168]; RNA binding [GO:0003723]	DEAELVEGK	0.96828	-0.034517	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	563.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RGE9	A0A9L0RGE9_HORSE	Lymphocyte antigen 86	LY86	Equus caballus (Horse)				RAPLLQMVSLQK	0.74938	0.54943	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	854.16	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RGH5	A0A9L0RGH5_HORSE	Bromodomain containing 3	BRD3	Equus caballus (Horse)	chromatin organization [GO:0006325]			HPMDLSTVKKK	0.015385	2.1349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1832.5	1284.6	1839.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RGH8	A0A9L0RGH8_HORSE	POU class 2 homeobox associating factor 3	POU2AF3	Equus caballus (Horse)				GAPGSLR	0.98851	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28536	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RGR5	A0A9L0RGR5_HORSE	Casein kinase 1 gamma 3	CSNK1G3	Equus caballus (Horse)				LDAPRRR	0.96724	0.013358	0	0	0	0	0	1391.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	635.68	0	618.37	0	0	0	0	0	0	0	0	0	0	0	1444.2	0	0	0	0	0	0	0	1348.5	0	0	0	0	1371.5	0	0	0	0	0
A0A9L0RGR7	A0A9L0RGR7_HORSE	PKHD1 like 1	PKHD1L1	Equus caballus (Horse)		membrane [GO:0016020]		IKEGGLFRR	0.91275	0.30171	0	0	0	0	1512.9	0	0	0	0	0	0	2868.8	0	1271.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1136.2	0	1550.8	0	0	0	0	0	0	0	0	0	1273.3	0	0	0	0	0	1371.5	0	0	0	0	0	1294.2	0	0	0	0	0	0	0
A0A9L0RH12	A0A9L0RH12_HORSE	Ras and Rab interactor 3	RIN3	Equus caballus (Horse)				MVTGSSLNNNSRCQLK	0.98741	-1.8626	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3368.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RH43	A0A9L0RH43_HORSE	Cytoglobin	CYGB	Equus caballus (Horse)			metal ion binding [GO:0046872]; oxygen carrier activity [GO:0005344]	TLGAAPR	0.98894	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3906.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RH63	A0A9L0RH63_HORSE	DENN domain containing 2B	DENND2B	Equus caballus (Horse)				GLPQLPSSCYSVDRGR	0.9913	-1.2351	0	0	2014.2	1765.7	0	0	0	1921.7	2137.4	2483.7	0	0	0	0	0	0	0	0	0	1804	1696.5	0	1478.8	1538.6	0	0	0	0	0	0	3096.3	0	0	0	4922.8	0	0	0	0	0	0	0	0	1411.5	0	0	0	0	2607.8	2482.6	0	0	0	0	885.47	0	0	0	869.6	0	0	0	0	0	0	0	1202.8	0	0	0	0	0	0	2158.1	0
A0A9L0RH66	A0A9L0RH66_HORSE	Prostaglandin E receptor 4	PTGER4	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	MHRQFMR	0.98832	-1.7932	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1421.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RH79	A0A9L0RH79_HORSE	tRNA 4-demethylwyosine synthase (AdoMet-dependent) (EC 4.1.3.44)	LOC100062082	Equus caballus (Horse)		membrane [GO:0016020]	"4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]"	AWKTKFISR	0.9885	-1.1478	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	718.32	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RHC6	A0A9L0RHC6_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				APNKINPKRPTPR	0.88445	0.37618	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	458.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RHC8	A0A9L0RHC8_HORSE	AFG3 like matrix AAA peptidase subunit 2	AFG3L2	Equus caballus (Horse)	proteolysis [GO:0006508]	membrane [GO:0016020]	peptidase activity [GO:0008233]	TQVLQPEEKK	0.88817	0.41812	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	420.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RHI9	A0A9L0RHI9_HORSE	"WD repeat containing, antisense to TP73"	WRAP73	Equus caballus (Horse)				SFQWDPQQPRLAICTGGSK	0.94799	0.23727	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	530.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RHN6	A0A9L0RHN6_HORSE	"Methyltransferase 5, N6-adenosine"	METTL5	Equus caballus (Horse)				LRSGTSGPGR	0.9865	-1.9074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	634.07	0	974.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RHQ8	A0A9L0RHQ8_HORSE	"H1.2 linker histone, cluster member"	H1-2	Equus caballus (Horse)		chromosome [GO:0005694]; nucleus [GO:0005634]	DNA binding [GO:0003677]	TGAAKPK	0.98969	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	54856	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RHS6	A0A9L0RHS6_HORSE	Developmentally regulated GTP binding protein 2	DRG2	Equus caballus (Horse)			nucleotide binding [GO:0000166]	GEVQRSLLEK	0.9793	-0.37238	0	0	0	0	0	0	0	0	0	0	0	3458.8	0	1610.6	0	0	0	0	0	0	0	0	0	0	1238.8	0	0	0	0	0	0	0	0	0	0	0	0	500.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1115.4	0	0	0	0	0	0	0
A0A9L0RHZ2	A0A9L0RHZ2_HORSE	Olfactory receptor	OR6C324	Equus caballus (Horse)	sensory perception of smell [GO:0007608]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	RVASISKNQR	0.97397	-0.19761	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	463.95
A0A9L0RI05	A0A9L0RI05_HORSE	Tubulin epsilon and delta complex 1	TEDC1	Equus caballus (Horse)				LEAALEWRR	0.97413	-0.20904	0	0	0	0	0	0	0	0	0	0	799.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RI21	A0A9L0RI21_HORSE	Suppressor of cytokine signaling 5	SOCS5	Equus caballus (Horse)	negative regulation of signal transduction [GO:0009968]			HAPWGGK	0.98954	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	508.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RI24	A0A9L0RI24_HORSE	Kinesin-like protein	KIF3C	Equus caballus (Horse)		microtubule [GO:0005874]	ATP binding [GO:0005524]; cytoskeletal motor activity [GO:0003774]	MLEDLRREQQATELLAAK	0.98413	-0.70624	0	0	0	0	0	0	0	0	0	1153.9	0	0	0	0	0	0	0	0	0	0	0	0	7927	0	0	0	0	0	0	0	0	0	0	0	0	0	2216.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RI48	A0A9L0RI48_HORSE	TSPY like 2	TSPYL2	Equus caballus (Horse)				ISILINQR	0.041667	1.6797	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	675.57	0	0	0	0	0	0	0	0	0	0	0	0	0	385.96	296.24
A0A9L0RIA2	A0A9L0RIA2_HORSE	Deoxyribonuclease	DNASE1L3	Equus caballus (Horse)	apoptotic process [GO:0006915]	nuclear envelope [GO:0005635]; zymogen granule [GO:0042588]	endonuclease activity [GO:0004519]	AENFIFMGDFNAGCSYVPK	0.87786	0.39424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	685.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RIC4	A0A9L0RIC4_HORSE	Serine/threonine-protein kinase SBK1 (EC 2.7.11.1) (SH3 domain-binding kinase 1)	SBK1	Equus caballus (Horse)		cytoplasm [GO:0005737]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	LEAPAPLK	0.96963	0.16711	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1513.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	694.44	1699.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RIP5	A0A9L0RIP5_HORSE	Chromosome 7 C11orf42 homolog	C7H11orf42	Equus caballus (Horse)				QSRPAHSR	0.9901	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	368.82	0	0	489.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RIS3	A0A9L0RIS3_HORSE	Transmembrane protein 132C	TMEM132C	Equus caballus (Horse)		membrane [GO:0016020]		VDLTIAEACQK	0.76303	0.53445	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	436.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RIT1	A0A9L0RIT1_HORSE	Cytochrome P450 family 2 subfamily C member 23	CYP2C23	Equus caballus (Horse)		membrane [GO:0016020]	metal ion binding [GO:0046872]; monooxygenase activity [GO:0004497]	TEYFVPFSLGK	0.96327	-0.13897	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	521.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RIV4	A0A9L0RIV4_HORSE	GRAM domain containing 1C	GRAMD1C	Equus caballus (Horse)		membrane [GO:0016020]		SIFLWTK	0.96122	-0.013801	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	800.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	581.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RJH3	A0A9L0RJH3_HORSE	Mitochondrial ribosomal protein S28	MRPS28	Equus caballus (Horse)				VWSGQPGCLWVRLLATWNR	0.96852	0.028454	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1235.6	0	0	0	0	0	0
A0A9L0RJJ3	A0A9L0RJJ3_HORSE	Zinc finger protein 875	ZNF875	Equus caballus (Horse)			metal ion binding [GO:0046872]	IHSGEKPYTCRK	0.67073	0.61019	0	0	0	0	0	0	0	0	0	0	0	0	405.43	463.7	500.07	0	0	0	0	901.6	0	0	0	0	0	0	0	0	0	0	0	1516.2	0	0	0	0	0	0	0	0	2252.3	0	0	0	0	0	0	0	0	0	1253.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	685.92	678.68	0	0	0
A0A9L0RJL6	A0A9L0RJL6_HORSE	glycine dehydrogenase (aminomethyl-transferring) (EC 1.4.4.2)	GLDC	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	LGCGVAGGR	0.98775	-1.0279	0	0	0	0	0	0	0	0	0	0	0	16339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	778.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RJM1	A0A9L0RJM1_HORSE	Rho guanine nucleotide exchange factor 33	ARHGEF33	Equus caballus (Horse)				YTQRKDHVK	0.97326	0.10394	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	616.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RJM9	A0A9L0RJM9_HORSE	RAB11 family interacting protein 2	RAB11FIP2	Equus caballus (Horse)				MMLSEQAQK	0.97745	0.065167	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1244.8	0	0	0	0	0	0	0	0	0	0	718.02	0	0	0	0
A0A9L0RJP7	A0A9L0RJP7_HORSE	Argininosuccinate lyase	ASL	Equus caballus (Horse)	urea cycle [GO:0000050]			AGVGGRRQRPPR	0.97378	-0.19066	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1107	1358.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	336	0	0	0	0	0	0	0	624.05	0	0	0	0	863.05	0	0	0	0	0
A0A9L0RJQ6	A0A9L0RJQ6_HORSE	Solute carrier family 2 member 11	SLC2A11	Equus caballus (Horse)		membrane [GO:0016020]		GGPGGGR	0.98984	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	413.2	0	0	0	299.96	0	0	0	0	0	0	0	320.52	0	0	0	0
A0A9L0RJR1	A0A9L0RJR1_HORSE	REST corepressor 1	RCOR1	Equus caballus (Horse)		nucleus [GO:0005634]		MPAMVEK	0.86855	0.45933	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	577.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RJS7	A0A9L0RJS7_HORSE	"Nuclear protein, coactivator of histone transcription"	NPAT	Equus caballus (Horse)				DNTQQFRASSR	0.97984	-0.35654	0	0	0	0	0	0	0	0	0	2745.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RK26	A0A9L0RK26_HORSE	BTB domain and CNC homolog 2	BACH2	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	NDLVVSLPEEVK	0.97826	0.066972	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	954.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RK32	A0A9L0RK32_HORSE	Sodium/hydrogen exchanger	SLC9A6	Equus caballus (Horse)	regulation of intracellular pH [GO:0051453]; sodium ion transport [GO:0006814]	plasma membrane [GO:0005886]; recycling endosome membrane [GO:0055038]	antiporter activity [GO:0015297]	IGSNFQHMMMFAGLR	0.97258	-0.20237	0	0	0	0	0	0	0	0	0	0	659.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RK39	A0A9L0RK39_HORSE	Uncharacterized protein		Equus caballus (Horse)				GRSTEKASPK	0.96787	-0.16432	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6464	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RK45	A0A9L0RK45_HORSE	Phosphodiesterase 4D interacting protein	PDE4DIP	Equus caballus (Horse)		cytoplasm [GO:0005737]		AALPSSR	0.96828	-0.041882	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	502.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RK47	A0A9L0RK47_HORSE	Uncharacterized protein		Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	EFILGRNR	0.98571	-2.0323	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	512
A0A9L0RKA7	A0A9L0RKA7_HORSE	Protein phosphatase 1 regulatory subunit 18	PPP1R18	Equus caballus (Horse)				VREWTPR	0.98788	-1.7847	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1393.2	0	0	0	0	0	0	0	0	0	0	0	0	0	1250.8	0	0	0	0	0	0	0
A0A9L0RKE0	A0A9L0RKE0_HORSE	acid phosphatase (EC 3.1.3.2)	ACP6	Equus caballus (Horse)				MITGVFSVR	0.88854	0.44691	1102	0	0	921.85	0	963.9	0	0	0	0	0	1866.1	0	0	3122.4	0	0	12418	0	0	1941.6	637.1	542.45	1053	0	440.81	434.52	0	0	2371.2	0	0	0	0	0	1770.6	0	0	0	0	0	0	545.35	0	533.58	2888.7	0	0	0	2512.1	0	702.95	0	0	0	580.48	0	0	0	0	0	0	0	1126.3	1094.9	0	0	0	1310.2	0	1745.8	0	1002.9	803.06	869.38
A0A9L0RKH0	A0A9L0RKH0_HORSE	Janus kinase and microtubule interacting protein 3	JAKMIP3	Equus caballus (Horse)				QVREHEQHK	0.98807	-1.0828	0	0	0	0	0	0	0	0	0	0	915.47	0	0	0	0	0	0	1711.8	0	0	623.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1807.4	0	1223.8	0	0	0	1112.8	0	0	0	1759.6	0	0	0	1499.1	0	0	0	1110.3	0	0	0	841.15	942.29	0	0	0	0	0	0	0	0	0	734.06	727.31	735.68
A0A9L0RKQ0	A0A9L0RKQ0_HORSE	Carbonic anhydrase 12	CA12	Equus caballus (Horse)				GEPAAQRSK	0.98973	-1.6435	828.77	0	0	0	0	879.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RKZ8	A0A9L0RKZ8_HORSE	Bis(5'-adenosyl)-triphosphatase (EC 3.6.1.29)	FHIT	Equus caballus (Horse)			bis(5'-adenosyl)-triphosphatase activity [GO:0047710]; nucleotide binding [GO:0000166]	AGDFHRNDSIYEENK	0.98764	-1.8478	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1131.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RL09	A0A9L0RL09_HORSE	ERCC excision repair 6 like 2	ERCC6L2	Equus caballus (Horse)		nucleus [GO:0005634]	ATP binding [GO:0005524]; hydrolase activity [GO:0016787]	VLSGPMEKAK	0.98828	-1.0961	0	0	0	0	0	0	0	0	0	0	0	0	1348.3	1297.6	0	0	0	0	0	0	860.18	0	0	0	0	0	0	0	1338.9	0	0	1078.5	1108.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	923.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1068.2	0	0	0
A0A9L0RL33	A0A9L0RL33_HORSE	Elongin-A	ELOA	Equus caballus (Horse)	transcription by RNA polymerase II [GO:0006366]	nucleus [GO:0005634]		EKVSNNLK	0.9884	-1.0751	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	477.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RL54	A0A9L0RL54_HORSE	Mercaptopyruvate sulfurtransferase	MPST	Equus caballus (Horse)				ATGRFRGTEPEPR	0.9184	0.30647	585.41	679.35	0	0	0	0	0	0	0	0	0	0	1353.2	0	0	3298.7	0	0	0	0	0	512.21	638.62	0	0	0	0	0	0	0	1903.6	1747.8	0	0	0	0	0	0	0	2647.4	0	0	1104.6	1137.6	1164.4	0	2305.1	0	2894.3	3373.5	3263.8	0	0	0	712.64	871.85	0	0	0	0	813.88	2236.8	0	818.78	0	0	3356.4	3069.1	3234.2	0	1164.7	890.26	598.66	0	700.88
A0A9L0RL77	A0A9L0RL77_HORSE	StAR related lipid transfer domain containing 8	STARD8	Equus caballus (Horse)				QAEPEGSPATPKK	0.98335	-0.70131	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	764.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RLC7	A0A9L0RLC7_HORSE	Tau tubulin kinase 2	TTBK2	Equus caballus (Horse)				LGPWAENNHLK	0.96475	-0.12116	0	0	0	0	0	0	0	0	0	0	0	0	399.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RLF7	A0A9L0RLF7_HORSE	Zinc finger protein 689	ZNF689	Equus caballus (Horse)				GVTGQRK	0.5203	0.64803	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	894.93	828.6	703.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RLG5	A0A9L0RLG5_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				LEEITQAEEIK	0.36111	0.73921	0	0	0	0	0	0	0	0	0	0	0	0	0	0	712.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	512.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RLH0	A0A9L0RLH0_HORSE	Formin homology 2 domain containing 1	FHOD1	Equus caballus (Horse)				APEPGPR	0.96912	-0.033251	1647.8	0	0	2389.1	0	2080	0	0	0	0	5640.6	0	0	0	0	0	0	0	2053	0	0	0	0	2237	0	0	0	2595.8	2832.1	2782.5	0	0	0	0	0	0	0	0	0	0	0	0	0	1589.4	0	1790.6	0	0	0	2792.2	0	0	0	0	0	0	2191.3	0	0	2651.8	0	0	0	0	0	0	0	0	0	4401.8	0	0	0	3483.5	0
A0A9L0RLS8	A0A9L0RLS8_HORSE	Zinc finger protein 770	ZNF770	Equus caballus (Horse)				HQLTHNLPFK	0.91623	0.30819	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1226.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RLU1	A0A9L0RLU1_HORSE	Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase)	GALNT16	Equus caballus (Horse)		Golgi membrane [GO:0000139]	carbohydrate binding [GO:0030246]; glycosyltransferase activity [GO:0016757]	VKCLRNDR	0.87609	0.3931	0	0	0	0	0	0	0	0	3574.9	0	0	0	0	6663.6	0	0	0	0	0	2796.8	2633	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10204	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4628.4	0	0	0	5855.8	0	0	0
A0A9L0RLW6	A0A9L0RLW6_HORSE	G protein-coupled receptor class C group 5 member A	GPRC5A	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	SEAQPSGGGLSSR	0.40343	0.69818	498.87	0	0	0	0	0	0	0	0	0	0	0	579.64	0	0	3877.8	0	0	0	0	0	0	0	422.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	803.4	2546.7	0	2698	0	545.95	0	0	0	0	521.68	0	0	0	0	0	0	359.38	0	0	0	2135.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RLX7	A0A9L0RLX7_HORSE	Bromodomain and PHD finger containing 1	BRPF1	Equus caballus (Horse)			metal ion binding [GO:0046872]	GVGHSSK	0.98803	-1.2702	435.04	0	0	0	0	0	0	0	0	334.68	0	557.13	0	474.11	0	0	0	0	362.78	0	0	420.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	479.48	0	0	629.92	0	0	0	0	0	0	0	0	457.14	0	0	0	477.87	500.39	489.8	451.61	0	0	0	0	565.21
A0A9L0RM97	A0A9L0RM97_HORSE	Leiomodin 1	LMOD1	Equus caballus (Horse)		cytoskeleton [GO:0005856]; sarcomere [GO:0030017]		EEDEKAK	0.66667	0.63294	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	448.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RMC0	A0A9L0RMC0_HORSE	Sodium/potassium-transporting ATPase subunit alpha	ATP12A	Equus caballus (Horse)	potassium ion transport [GO:0006813]	plasma membrane [GO:0005886]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]	GKTGVKK	0.1383	1.2438	0	0	0	0	0	537.13	485.29	546.72	0	0	797.48	782.63	1359.8	1431.5	1452.6	2978.3	2960.6	2767.3	0	546.5	660.55	0	266.31	0	0	0	0	880.51	1184.3	1472.6	920.64	1152.9	897.76	802.35	727.83	0	519.8	1732.8	1764.6	1524.6	1270.4	1090.8	834.25	1003.6	849.52	602.53	1485.3	1264.7	1467.6	1388.8	1092.2	0	1200.1	1168.6	0	0	0	1234.4	1128.9	1961.2	0	0	783.12	476.39	556.39	451.01	1437.3	1401.7	1242.2	622.16	2426.4	1901.8	443.17	510.47	441.57
A0A9L0RMF7	A0A9L0RMF7_HORSE	Eukaryotic translation initiation factor 4 gamma 1	EIF4G1	Equus caballus (Horse)			translation initiation factor activity [GO:0003743]	LFSSEELSR	0.96722	0.024308	0	0	0	0	0	0	0	585.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1552.9	0	0	0	0	0	0	0	0	0	0	2470.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RMR4	A0A9L0RMR4_HORSE	von Willebrand factor A domain containing 3B	VWA3B	Equus caballus (Horse)				KHPKPKVGGG	0.97076	-0.18083	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	408.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RMS8	A0A9L0RMS8_HORSE	F-box protein 31	FBXO31	Equus caballus (Horse)				EFTAGRRQAGSAPPGR	0.69524	0.61634	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	572.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RMW0	A0A9L0RMW0_HORSE	Protein GOLM2 (Golgi membrane protein 2)	GOLM2	Equus caballus (Horse)		membrane [GO:0016020]		EADYGRLSSK	0.98506	-2.3774	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	328.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RMY4	A0A9L0RMY4_HORSE	Collagen beta(1-O)galactosyltransferase 2	COLGALT2	Equus caballus (Horse)				RFSLIEK	0.98085	-0.59081	550.63	0	0	0	0	339.9	0	0	0	0	0	0	0	0	0	0	0	1627.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2314.3	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RMZ7	A0A9L0RMZ7_HORSE	Iroquois homeobox 5	IRX5	Equus caballus (Horse)				CPPARPRR	0.98674	-2.6421	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3225.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	339.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RNA2	A0A9L0RNA2_HORSE	Nocturnin	NOCT	Equus caballus (Horse)				DAPRLRR	0.99201	-1.2253	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1702.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RNA5	A0A9L0RNA5_HORSE	Uncharacterized protein		Equus caballus (Horse)				SLSHLFLR	0.87844	0.38234	2227.7	1381.9	1294.8	1222.4	1365.2	1254.1	437.66	0	0	398.01	0	0	0	0	0	2699.1	2661.1	2410.3	0	0	0	1303.9	1536.8	0	1026.2	899.17	849.98	677.57	1330.6	1231.9	917.32	732.6	992.06	1814.1	1952.4	1459.6	0	0	0	1837.2	1651.5	0	0	0	0	550.41	1834.5	1728.8	0	0	0	2261.6	673.32	975.42	1999.4	0	0	2137.1	2465.8	2615.2	0	638.29	762.47	1961.4	0	2001.5	0	0	0	0	0	0	0	0	0
A0A9L0RNE8	A0A9L0RNE8_HORSE	3-oxoacid CoA-transferase 2	OXCT2	Equus caballus (Horse)		extracellular region [GO:0005576]	growth factor activity [GO:0008083]	LGPRERR	0.9662	0.18305	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26127	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	618.37	0	0	0	0	0	0	0	0	0	0	0	0	1954.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RNF7	A0A9L0RNF7_HORSE	RNA polymerase III subunit E	POLR3E	Equus caballus (Horse)				LEKVYNLVK	0.9869	-1.3678	0	0	0	0	0	507.97	571.33	712.86	0	0	0	0	631.39	444.34	0	0	0	0	0	631.53	0	0	653.9	511.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2802.2	0	0	0	0	0	0	660.26	637.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RNK7	A0A9L0RNK7_HORSE	Transcription factor AP-4	TFAP4	Equus caballus (Horse)				LKVIAQQEQVRLLHQEK	0.96663	-0.075496	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	700.11	579.17	563.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	716.4	549.78	0	0	0	0	0	0	0	0	0	0	0	506.03	519.35	0	0	0	0	0	0	0	408.27	404.95	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RNW1	A0A9L0RNW1_HORSE	MAP7 domain containing 1	MAP7D1	Equus caballus (Horse)				EEAERQR	0.96443	-0.13761	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35181	40256	0	0	0	34106	0	0	0	0	0	0	0	16133	0	0	0	0	0	0	24483	0	0	0	0	0	0	0	25605	30218	0	0	19214	0	0	0	0	0	0	0	8733.8	0	0	0	0	0
A0A9L0RNY1	A0A9L0RNY1_HORSE	TNF receptor-associated factor (EC 2.3.2.27)	TRAF2 C8G	Equus caballus (Horse)	apoptotic process [GO:0006915]	cytoplasm [GO:0005737]	tumor necrosis factor receptor binding [GO:0005164]; zinc ion binding [GO:0008270]	GRAVPISR	0.9873	-1.0562	0	0	0	346.99	0	1901.7	0	4143.7	0	0	4053.9	0	0	0	0	0	0	4943.3	0	0	2876.6	733.76	0	0	1238.8	0	0	2365.2	1235.8	2579.1	3096.3	3173.9	0	5061.7	4655.9	0	600.92	0	0	3069.1	4689.7	0	0	0	0	0	0	0	0	0	0	0	0	2836.8	0	0	0	0	0	0	507.52	2765.5	3082.6	0	0	0	0	2375.2	0	0	2895.9	1066.2	0	0	0
A0A9L0RNZ3	A0A9L0RNZ3_HORSE	Prostate tumor-overexpressed gene 1 protein	PTOV1	Equus caballus (Horse)		nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]		GVLTPRTR	0.98557	-1.1642	0	0	0	0	0	0	2027.4	2156.8	0	2544.1	0	0	0	0	0	0	0	0	1692.7	0	1695.2	1673.3	1560	0	1249.2	0	0	2226.4	0	0	3691.7	3423.4	0	0	5257.3	0	0	0	2441.9	0	0	1806.8	0	0	0	0	0	0	2606	0	0	0	1629.8	1825.8	0	1009	1183.7	0	0	0	0	0	0	0	0	0	1502.5	0	0	0	0	3226	0	0	0
A0A9L0RP06	A0A9L0RP06_HORSE	Sodium channel epithelial 1 subunit delta	SCNN1D	Equus caballus (Horse)	response to stimulus [GO:0050896]; sensory perception of taste [GO:0050909]	membrane [GO:0016020]	sodium channel activity [GO:0005272]	VGACALASSSAGRGPR	0.98731	-1.8224	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	438.81	0	0	0	0
A0A9L0RP81	A0A9L0RP81_HORSE	RB transcriptional corepressor like 2	RBL2	Equus caballus (Horse)	cell cycle [GO:0007049]; chromatin organization [GO:0006325]	nucleus [GO:0005634]		NILQQHFDK	0.96357	-0.024494	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1047.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RPC5	A0A9L0RPC5_HORSE	Neurobeachin like 1	NBEAL1	Equus caballus (Horse)				LVPNYNFK	0.98491	-0.83939	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8676.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RPM9	A0A9L0RPM9_HORSE	Transketolase (EC 2.2.1.1)	TKT	Equus caballus (Horse)			metal ion binding [GO:0046872]; transferase activity [GO:0016740]	RAWGEPRR	0.96806	-0.045705	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	529.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RPN3	A0A9L0RPN3_HORSE	Lethal(3)malignant brain tumor-like protein 2	L3MBTL2	Equus caballus (Horse)	chromatin organization [GO:0006325]	nucleus [GO:0005634]	metal ion binding [GO:0046872]	LVGSRTLPVDFHIK	0.98607	-0.99724	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1502.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	612.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RPS1	A0A9L0RPS1_HORSE	"SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 1"	SMARCC1	Equus caballus (Horse)		chromosome [GO:0005694]		DGGPASK	0.98556	-1.4975	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	869.43	0	0	0	910.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2473.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RPW1	A0A9L0RPW1_HORSE	Uncharacterized protein		Equus caballus (Horse)				ELTQLQKVK	0.98813	-1.5383	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	499.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RQ36	A0A9L0RQ36_HORSE	Transmembrane protein 260	TMEM260	Equus caballus (Horse)		membrane [GO:0016020]		NDPQLAAILVALKHLR	0.96144	-0.00066385	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	680.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RQ62	A0A9L0RQ62_HORSE	Platelet-derived growth factor receptor beta (PDGF-R-beta) (PDGFR-beta) (EC 2.7.10.1) (Beta platelet-derived growth factor receptor) (Beta-type platelet-derived growth factor receptor)	PDGFRB	Equus caballus (Horse)	cellular response to growth factor stimulus [GO:0071363]; chemotaxis [GO:0006935]; phosphorylation [GO:0016310]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	cytoplasmic vesicle [GO:0031410]; lysosomal lumen [GO:0043202]; plasma membrane [GO:0005886]	ATP binding [GO:0005524]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	GGPIYIITEYCR	0.97029	-0.03287	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	893.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RQ79	A0A9L0RQ79_HORSE	ATP synthase F1 subunit epsilon	ATP5F1E	Equus caballus (Horse)	proton transmembrane transport [GO:1902600]	"proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]"		SPIGCRR	0.98084	-0.58935	516.33	0	0	0	0	0	0	536.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2776	0	0	933.8	738.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RQA4	A0A9L0RQA4_HORSE	GATA zinc finger domain containing 2A	GATAD2A	Equus caballus (Horse)		nucleus [GO:0005634]		ALKVEHTSRLK	0.97358	-0.20315	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	839.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RQD7	A0A9L0RQD7_HORSE	Protein farnesyltransferase subunit beta (FTase-beta) (EC 2.5.1.58)	FNTB	Equus caballus (Horse)		protein farnesyltransferase complex [GO:0005965]	protein farnesyltransferase activity [GO:0004660]; zinc ion binding [GO:0008270]	EKLLEYLYSLK	0.98693	-1.9158	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1493.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RQH0	A0A9L0RQH0_HORSE	Ubiquitin specific peptidase 54	USP54	Equus caballus (Horse)				IRKWMYFDDAHVK	0.98881	-1.1907	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	727.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RQP0	A0A9L0RQP0_HORSE	Solute carrier family 2 member 11	SLC2A11	Equus caballus (Horse)		membrane [GO:0016020]		GWAGVCC	0.96729	-0.047494	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1299.2	0	0	0	0	0	0	0	2000.8	0	0	0	0	0
A0A9L0RQP6	A0A9L0RQP6_HORSE	Heparan sulfate proteoglycan 2	HSPG2	Equus caballus (Horse)	cell differentiation [GO:0030154]; circulatory system development [GO:0072359]	basement membrane [GO:0005604]; extracellular region [GO:0005576]		VAAYGGK	0.94859	0.23855	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	186.24	276.33	0	0	0	0	0	0	0
A0A9L0RQR9	A0A9L0RQR9_HORSE	RNA-directed DNA polymerase (EC 2.7.7.49)		Equus caballus (Horse)				IKYLGIDLSK	0.98637	-1.9074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	601.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RQV7	A0A9L0RQV7_HORSE	Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase)	GALNT3	Equus caballus (Horse)		Golgi membrane [GO:0000139]	carbohydrate binding [GO:0030246]; glycosyltransferase activity [GO:0016757]	HYHKKFWK	0.96087	-0.0022997	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	468.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RQW0	A0A9L0RQW0_HORSE	DNA-directed RNA polymerase subunit beta (EC 2.7.7.6)	POLR3B	Equus caballus (Horse)		DNA-directed RNA polymerase complex [GO:0000428]	metal ion binding [GO:0046872]; nucleotidyltransferase activity [GO:0016779]	IADQVIPK	0.98334	-0.9059	0	1367.8	1190.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1105.3	0	0	0	1092.9	0	0	0	0	0	0	0	626.03	0	0	0	0	0	0	0	0	1390	0	0	635.68	0	0	718.09	0	0	0	0	0	1558.6	0	0	0	1479.6	0	0	0	2061.8	0	0	1186.2	0	1348.5	0	0	0	1483.6	0	0	0	628.27	0	0
A0A9L0RQW2	A0A9L0RQW2_HORSE	TLC domain containing 3B	TLCD3B	Equus caballus (Horse)		membrane [GO:0016020]		GACRLFRPR	0.9877	-1.8168	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	987.92	0	0	0	0	0	0	0	0	0	573.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RQZ9	A0A9L0RQZ9_HORSE	Phospholipid-transporting ATPase (EC 7.6.2.1)	ATP8B2	Equus caballus (Horse)		membrane [GO:0016020]	ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]	LDKFSGTLYWK	0.9094	0.30012	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1829.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	547.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RR25	A0A9L0RR25_HORSE	Arsenite-resistance protein 2	SRRT	Equus caballus (Horse)	regulatory ncRNA-mediated gene silencing [GO:0031047]	nucleus [GO:0005634]		SVNIKEICWNLQNIR	0.95352	0.23662	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1517.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RR40	A0A9L0RR40_HORSE	Dynein axonemal heavy chain 6	DNAH6	Equus caballus (Horse)		axoneme [GO:0005930]; dynein complex [GO:0030286]; microtubule [GO:0005874]	ATP binding [GO:0005524]	ELTKIPIFSLFRK	0.98535	-2.0887	982.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	594.1	0	0	0	0	0	0	0	0	0	0	3693.2	0	0	0	0	0	0	0	0	0	0	0	0	4245.1	0	0	0	0	0	0	0	0	0	677.43	0	0	0	0	0	0	0	0	2674.1	0	0	1130.2	1478.2	1566
A0A9L0RR48	A0A9L0RR48_HORSE	Ubiquitin-like domain-containing CTD phosphatase 1 (EC 3.1.3.16) (Nuclear proteasome inhibitor UBLCP1)	UBLCP1	Equus caballus (Horse)		nucleus [GO:0005634]	metal ion binding [GO:0046872]; phosphoprotein phosphatase activity [GO:0004721]	ALPIIVK	0.94276	0.25197	0	0	0	0	78730	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	86162	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RR65	A0A9L0RR65_HORSE	G protein-coupled receptor kinase (EC 2.7.11.-)	GRK6	Equus caballus (Horse)	phosphorylation [GO:0016310]		ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	DPAERLGCR	0.98811	-1.7737	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	780.23	790.26	0	0	0	0	0	0	0	0	0	562.66	535.77	0	429.35	0	0	0	0	0	0	0	0	665.67	0	0	0	0	0	525.57	635.16	862.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RR80	A0A9L0RR80_HORSE	Complement C3		Equus caballus (Horse)		extracellular region [GO:0005576]		DAGLDMK	0.98491	-0.96846	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	390.51	0	422.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	345.69	0	299.34	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	343.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RR93	A0A9L0RR93_HORSE	Myosin heavy chain 10	MYH10	Equus caballus (Horse)		myosin complex [GO:0016459]	actin binding [GO:0003779]; ATP binding [GO:0005524]; cytoskeletal motor activity [GO:0003774]	AKLQELEGAVK	0.98752	-3.6222	0	0	0	0	0	0	0	0	546.47	0	0	0	0	0	0	0	0	3706.1	0	0	0	591.19	0	676.86	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RRA8	A0A9L0RRA8_HORSE	Ubiquitin-related modifier 1	URM1	Equus caballus (Horse)	tRNA processing [GO:0008033]	cytoplasm [GO:0005737]		REVSRGWR	0.97798	0.061394	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	109120	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	143020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RRC0	A0A9L0RRC0_HORSE	Collagen type XXVIII alpha 1 chain	COL28A1	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		GAQGPRGPVGAPGPK	0.98733	-1.0702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	390.02	0	0	0
A0A9L0RRG4	A0A9L0RRG4_HORSE	Paired related homeobox 1	PRRX1	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	LDSPGNLDTLQAK	0.76484	0.51437	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	821.14	0	0	2563.2	2013.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	832.07	522.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	685.63	0	0	0	0	0	543.33	0
A0A9L0RRH1	A0A9L0RRH1_HORSE	HEAT repeat containing 5A	HEATR5A	Equus caballus (Horse)				AQIAAAK	0.98369	-0.8076	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57906	5082.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	646.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RRJ1	A0A9L0RRJ1_HORSE	Nicotinamide nucleotide adenylyltransferase 3	NMNAT3	Equus caballus (Horse)				VLRHHHR	0.9885	-1.1474	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	236.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RRQ5	A0A9L0RRQ5_HORSE	G-protein coupled receptors family 1 profile domain-containing protein	LOC100071946	Equus caballus (Horse)		membrane [GO:0016020]	G protein-coupled receptor activity [GO:0004930]	IFCSSRR	0.98268	-0.71964	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	612.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RRV8	A0A9L0RRV8_HORSE	Cerebellar deration related protein 2	CDR2	Equus caballus (Horse)				ARALELEAEVAEMR	0.98724	-1.8485	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1421.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RS35	A0A9L0RS35_HORSE	Male-enhanced antigen 1	MEA1	Equus caballus (Horse)				SLPGPVVR	0.97036	0.20177	0	6136.6	0	0	0	0	0	0	0	0	0	801.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RS60	A0A9L0RS60_HORSE	Rho family GTPase 2	RND2	Equus caballus (Horse)			GTP binding [GO:0005525]	VNPGLPK	0.99014	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	695.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RSI0	A0A9L0RSI0_HORSE	Potassium channel tetramerization domain containing 10	KCTD10	Equus caballus (Horse)				RGRSGIPR	0.97804	0.060261	0	0	0	0	0	0	0	0	1111.4	0	0	0	0	0	1090.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	780.87	0	913.71	0	0	0	0	0	0	0	0	519.71	0	0	0	0	0	0
A0A9L0RSY8	A0A9L0RSY8_HORSE	Golgin A1	GOLGA1	Equus caballus (Horse)				LSDYAEQVR	0.96132	-0.0098985	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	546.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RT06	A0A9L0RT06_HORSE	Serine/threonine-protein kinase PRP4 homolog (EC 2.7.11.1) (PRP4 pre-mRNA-processing factor 4 homolog)	PRPF4B	Equus caballus (Horse)	phosphorylation [GO:0016310]		ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	SKVKEDK	0.96555	-0.085534	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1066.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RT10	A0A9L0RT10_HORSE	CD101 molecule	CD101	Equus caballus (Horse)		membrane [GO:0016020]		DLSWTQK	0.98564	-1.9328	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	614.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RT20	A0A9L0RT20_HORSE	Zinc finger protein 219	ZNF219	Equus caballus (Horse)				RFRFNSILALHLR	0.97221	-0.20071	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	428.31	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RT22	A0A9L0RT22_HORSE	Zinc finger protein 316	ZNF316	Equus caballus (Horse)			metal ion binding [GO:0046872]	AGQAPALPR	0.97962	-0.27246	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	364.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RT35	A0A9L0RT35_HORSE	Nucleolin	NCL	Equus caballus (Horse)		nucleolus [GO:0005730]	DNA binding [GO:0003677]; RNA binding [GO:0003723]	AAAPPAK	0.98816	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	451.56	485.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	489.76	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RTJ5	A0A9L0RTJ5_HORSE	Calcium-transporting ATPase (EC 7.2.2.10)	ATP2B1	Equus caballus (Horse)	calcium ion transport [GO:0006816]	membrane [GO:0016020]	ATP binding [GO:0005524]	VFRPRDRDDIVK	0.91776	0.29293	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	417.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RTJ6	A0A9L0RTJ6_HORSE	mitogen-activated protein kinase kinase kinase (EC 2.7.11.25)	MAP3K2	Equus caballus (Horse)				LNLKHLLVPESK	0.96453	-0.12917	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8687.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8088.1	0	8203.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RTP5	A0A9L0RTP5_HORSE	Cysteine rich secretory protein LCCL domain containing 1	CRISPLD1	Equus caballus (Horse)				VTTVLFMAR	0.10345	1.3683	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	553.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RTU7	A0A9L0RTU7_HORSE	"SET domain containing 1B, histone lysine methyltransferase"	SETD1B	Equus caballus (Horse)	chromatin organization [GO:0006325]; methylation [GO:0032259]	chromosome [GO:0005694]; nuclear speck [GO:0016607]	methyltransferase activity [GO:0008168]; RNA binding [GO:0003723]	IEMLLKEQR	0.98513	-2.2364	0	0	0	0	0	0	0	0	0	0	0	0	1625.7	0	1437.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3226.6	0	0	0	2418.1	0	0	0	0	0	0	0	0	1845	1950.5	2002.2	0	0	0	0	2260.2	0	0	0	0	995.92	1163.2	0	0	0	0	0	0	0	0	1670.7	0	1784.6	0	0	579.42	0	0
A0A9L0RTZ0	A0A9L0RTZ0_HORSE	Dedicator of cytokinesis 6	DOCK6	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]	SPFGNQENVR	0.98742	-1.5244	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	591.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RUA3	A0A9L0RUA3_HORSE	Coiled-coil domain containing 157	CCDC157	Equus caballus (Horse)				GAEGQPGR	0.98588	-0.84969	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1061.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RUD0	A0A9L0RUD0_HORSE	"SPG7 matrix AAA peptidase subunit, paraplegin"	SPG7	Equus caballus (Horse)	proteolysis [GO:0006508]	membrane [GO:0016020]	metallopeptidase activity [GO:0008237]	VRSLFKEAR	0.98192	-0.65161	0	0	0	480.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	568.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RUF0	A0A9L0RUF0_HORSE	DnaJ heat shock protein family (Hsp40) member C21	DNAJC21	Equus caballus (Horse)			metal ion binding [GO:0046872]	AEEMRRQQK	0.88497	0.44604	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	334.1	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RUL6	A0A9L0RUL6_HORSE	Coiled-coil domain-containing protein 102A	CCDC102A	Equus caballus (Horse)				GTGGSEP	0.98881	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	412.2	401.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	300.86	0	0	0	0	0	0	0	0	0	0	0	359.78	0	0	0	0	0
A0A9L0RUN4	A0A9L0RUN4_HORSE	SPRY domain containing 7	SPRYD7	Equus caballus (Horse)				AASVFCCLR	0.96561	-0.077057	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1660.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1107.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RUS5	A0A9L0RUS5_HORSE	Haptoglobin	LOC100067869	Equus caballus (Horse)	acute-phase response [GO:0006953]; defense response to bacterium [GO:0042742]		antioxidant activity [GO:0016209]; hemoglobin binding [GO:0030492]	DIAPTLK	0	106.52	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	878.01	0	0	0	410.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1443.1	1449.6	1248	0	0	0	0	0	0	7292.5	8623.7	9723.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RUV5	A0A9L0RUV5_HORSE	Potassium voltage-gated channel subfamily A member 4 (Voltage-gated potassium channel subunit Kv1.4)	KCNA4	Equus caballus (Horse)		axon [GO:0030424]; monoatomic ion channel complex [GO:0034702]; plasma membrane [GO:0005886]	potassium channel activity [GO:0005267]	RRPRPERR	0.96485	-0.093211	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	396.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RUV9	A0A9L0RUV9_HORSE	VPS9 domain containing 1	VPS9D1	Equus caballus (Horse)				LALGGHKEVTDR	0.98829	-1.8957	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	645.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RUW4	A0A9L0RUW4_HORSE	Sushi repeat-containing protein SRPX2	SRPX2	Equus caballus (Horse)				LLIVSAPDPSNR	0.9648	-0.12926	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	420.55	0	0	0	0	0	0	0	0	0	0	0	0	356.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RV37	A0A9L0RV37_HORSE	Perilipin	PLIN3	Equus caballus (Horse)				VTSLAGLPR	0.91129	0.312	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2108.9	2166.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RV48	A0A9L0RV48_HORSE	Sorbin and SH3 domain containing 3	SORBS3	Equus caballus (Horse)				AIETRQPSPKPGLR	0.97101	-0.064283	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	667.93	563.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	436.85
A0A9L0RV82	A0A9L0RV82_HORSE	Potassium channel tetramerization domain containing 19	KCTD19	Equus caballus (Horse)				GLTSGAMSAPRIR	0.88229	0.35654	0	0	0	0	358.77	349.39	0	0	0	306.79	0	0	0	0	0	0	0	0	0	0	1180.1	0	0	0	0	0	0	0	1235.8	0	1034.5	0	0	0	0	2332.9	600.92	2522.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1101.7	0	0	379.9	0	0	0	0	0	0	0	0	636.45	0	0	0	395.53	0	0	427.65	0	0
A0A9L0RV83	A0A9L0RV83_HORSE	NACHT domain-containing protein	LOC100054965	Equus caballus (Horse)				LTIECNNAR	0.79477	0.49733	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1113.1	0	1171.2	0	0	0	0	0	664.24	0	0	0	1898.8	1761.9	0	0	0	0	1423.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	327.44	0	298.55	0	0	0	0	0	0	0	0	0
A0A9L0RVI0	A0A9L0RVI0_HORSE	Phosphofurin acidic cluster sorting protein 2	PACS2	Equus caballus (Horse)				TLQVHLLAPPTVGR	0.89505	0.43917	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	603.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RVJ1	A0A9L0RVJ1_HORSE	Purinergic receptor P2X 7	P2RX7	Equus caballus (Horse)		membrane [GO:0016020]		VKKSQGPR	0.8858	0.35154	0	0	0	0	0	0	2027.4	0	2348.1	0	0	0	0	0	0	3294.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2441.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1499	974.64	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RVJ2	A0A9L0RVJ2_HORSE	RBBP8 N-terminal like	RBBP8NL	Equus caballus (Horse)				ARGRVGGAR	0.9677	-0.15866	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2343.4
A0A9L0RVJ4	A0A9L0RVJ4_HORSE	BTB domain containing 7	BTBD7	Equus caballus (Horse)				TLRTPTR	0.98674	-1.4442	0	0	0	0	0	0	0	0	0	0	0	0	398.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RVK6	A0A9L0RVK6_HORSE	"Ribosomal RNA processing 9, U3 small nucleolar RNA binding protein"	RRP9	Equus caballus (Horse)			RNA binding [GO:0003723]	TNQIRGRPR	0.99178	-1.2489	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	683.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RW22	A0A9L0RW22_HORSE	Glycoprotein hormone subunit alpha 2	GPHA2	Equus caballus (Horse)				LGKLFFK	0.9879	-1.7903	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	351.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RW24	A0A9L0RW24_HORSE	Semaphorin 3F	SEMA3F	Equus caballus (Horse)	signal transduction [GO:0007165]; system development [GO:0048731]		signaling receptor binding [GO:0005102]	ATDGTFRPTPTAPR	0.97052	0.03938	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	485.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	513.01	452.61	471.3	0	0	0	0	0	0
A0A9L0RW52	A0A9L0RW52_HORSE	Neuroligin 1	NLGN1	Equus caballus (Horse)	cell adhesion [GO:0007155]	plasma membrane [GO:0005886]; synapse [GO:0045202]		VTAQFCTPINK	0.96222	-0.1334	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1514.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RW60	A0A9L0RW60_HORSE	Teneurin transmembrane protein 4	TENM4	Equus caballus (Horse)		cell projection [GO:0042995]; plasma membrane [GO:0005886]		TLFVDVEER	0.96879	-0.097568	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	942.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RW81	A0A9L0RW81_HORSE	Uncharacterized protein		Equus caballus (Horse)				LTKIKNDR	0.96661	-0.10056	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2674.1	0	0	0	0	0
A0A9L0RWB4	A0A9L0RWB4_HORSE	Dihydroxyacetone phosphate acyltransferase (DAP-AT) (DHAP-AT) (EC 2.3.1.42)	GNPAT	Equus caballus (Horse)	glycerophospholipid metabolic process [GO:0006650]	peroxisomal membrane [GO:0005778]	glycerone-phosphate O-acyltransferase activity [GO:0016287]	VNNDYIFNVNEPATAK	0.96555	-0.10674	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	561.13	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RWB7	A0A9L0RWB7_HORSE	Vomeronasal type-1 receptor		Equus caballus (Horse)	response to pheromone [GO:0019236]; sensory perception of chemical stimulus [GO:0007606]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	TQIIRLTYR	0.98714	-1.9042	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2877.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RWC6	A0A9L0RWC6_HORSE	Ig-like domain-containing protein		Equus caballus (Horse)		membrane [GO:0016020]		TAVCGDGK	0.98496	-0.84969	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	444.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RWC7	A0A9L0RWC7_HORSE	DNA topoisomerase 2 (EC 5.6.2.2)	TOP2B	Equus caballus (Horse)	DNA topological change [GO:0006265]	nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	"ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity [GO:0003918]; metal ion binding [GO:0046872]"	FILEKIQGK	0.99043	-1.2519	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1899.6	0	0	0	1273.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RWH9	A0A9L0RWH9_HORSE	"RAB17, member RAS onco family"	RAB17	Equus caballus (Horse)				GLQRSRPRAAAER	0.7234	0.57185	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1281.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RWK1	A0A9L0RWK1_HORSE	DNA damage inducible 1 homolog 1	DDI1	Equus caballus (Horse)			hydrolase activity [GO:0016787]	LVTVYCVR	0.96044	-0.010583	0	0	0	0	0	0	0	528.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RWN5	A0A9L0RWN5_HORSE	THAP domain containing 4	THAP4	Equus caballus (Horse)			DNA binding [GO:0003677]	GAGGHGR	0.98875	-1.7521	0	0	2111.7	0	0	2033.5	0	0	0	0	0	3600.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2938.9	0	0	0	0	0	324.88	0	0	0	0	0	1582.7	0	0	0	0	0	0	0	2266	0	0	0	0	0	0	0	457.4	0	0	0	0	0	0	0	0	0	2039.7	2138.8	0	0	0	0	0	0
A0A9L0RWP4	A0A9L0RWP4_HORSE	"Large ribosomal subunit protein uL14m (39S ribosomal protein L14, mitochondrial)"	MRPL14	Equus caballus (Horse)		ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840]		TPIPTSLR	0.98573	-0.85552	0	253.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1357.2	0	0	322.22	0	0	0	0	0	0	0	0	0	0	0	0	495.91	537.65	0	0	0	398.87	384.65	446.23	0	446.95	468.27	0	314.71	0	383.4	399.68	410.2	0	0	0	0	0	0
A0A9L0RWP6	A0A9L0RWP6_HORSE	"Tsukushi, small leucine rich proteoglycan"	TSKU	Equus caballus (Horse)				GIQGKHPR	0.98299	-0.90875	550.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1669.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	460.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	466.63	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RWR7	A0A9L0RWR7_HORSE	GATA zinc finger domain containing 2B	GATAD2B	Equus caballus (Horse)		nucleus [GO:0005634]		QDGSGVK	0.93481	0.24907	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	341.22	0	0	0	0	0	0	0	0	0	0
A0A9L0RWS4	A0A9L0RWS4_HORSE	CD99 antigen-like protein 2	CD99L2	Equus caballus (Horse)		membrane [GO:0016020]		SVFRMSSGRV	0.9725	-0.196	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	697.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RWT6	A0A9L0RWT6_HORSE	Translocase of inner mitochondrial membrane 44	TIMM44	Equus caballus (Horse)	intracellular protein transport [GO:0006886]	mitochondrial inner membrane [GO:0005743]		AGLSASR	0.98941	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1459.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RWV3	A0A9L0RWV3_HORSE	Histone H2A	MACROH2A2	Equus caballus (Horse)		nucleosome [GO:0000786]; nucleus [GO:0005634]	DNA binding [GO:0003677]	AGGKEFLETVK	0.98863	-1.8725	0	0	0	0	0	0	0	0	0	0	383.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	625.65	0	0	0	0	0	304.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RWV8	A0A9L0RWV8_HORSE	Kelch domain containing 7A	KLHDC7A	Equus caballus (Horse)				AGPTAGSK	0.9431	0.24461	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	473.83	0	0	0	0	0	0	0	0	0	0	0	0	833.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1023	476.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RX69	A0A9L0RX69_HORSE	Coatomer subunit beta'	COPB2	Equus caballus (Horse)	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]	COPI-coated vesicle membrane [GO:0030663]; Golgi membrane [GO:0000139]	structural molecule activity [GO:0005198]	IFKNFKEK	0.9855	-1.4552	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	985.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1276.4	0	0	0
A0A9L0RXC4	A0A9L0RXC4_HORSE	NHL repeat containing 3	NHLRC3	Equus caballus (Horse)				LRQTRGSR	0.97646	0.057414	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1307.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RXG0	A0A9L0RXG0_HORSE	"SET domain containing 2, histone lysine methyltransferase"	SETD2	Equus caballus (Horse)		nucleus [GO:0005634]	histone H3 methyltransferase activity [GO:0140938]; protein-lysine N-methyltransferase activity [GO:0016279]	DPDKQTQNK	0.98306	-0.94184	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	724.64	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RXL8	A0A9L0RXL8_HORSE	Stabilizer of axonemal microtubules 2	SAXO2	Equus caballus (Horse)				EGGANGK	0.98956	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	536.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RXT0	A0A9L0RXT0_HORSE	Tyrosine kinase non receptor 1	TNK1	Equus caballus (Horse)			ATP binding [GO:0005524]; protein tyrosine kinase activity [GO:0004713]	DPPPARGQRR	0.97283	-0.20013	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9567.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RXW9	A0A9L0RXW9_HORSE	Translation machinery associated 16 homolog	TMA16	Equus caballus (Horse)				KDACELIER	0.99031	-1.6714	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3206.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RXZ4	A0A9L0RXZ4_HORSE	dual-specificity kinase (EC 2.7.12.1)	DYRK1B	Equus caballus (Horse)			ATP binding [GO:0005524]	GGGGAPR	0.95959	0.21903	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	538.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RY06	A0A9L0RY06_HORSE	Zinc finger and SCAN domain containing 26	ZSCAN26	Equus caballus (Horse)		nucleus [GO:0005634]		GEETRMENGK	0.97969	-0.46554	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	576.98	671.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RY11	A0A9L0RY11_HORSE	"Creatine kinase S-type, mitochondrial (EC 2.7.3.2) (Sarcomeric mitochondrial creatine kinase)"	CKMT2	Equus caballus (Horse)	phosphorylation [GO:0016310]		ATP binding [GO:0005524]; kinase activity [GO:0016301]	VPPPLPQFSKK	0.98459	-0.84893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	586.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	625.74	0
A0A9L0RY16	A0A9L0RY16_HORSE	ATP binding cassette subfamily A member 2	ABCA2	Equus caballus (Horse)		membrane [GO:0016020]	ATP binding [GO:0005524]	EEVAHDK	0.96828	0.17779	0	0	0	0	0	0	0	0	0	0	0	0	0	471.46	425.91	0	0	0	0	391.16	0	0	0	0	0	0	0	767.05	0	0	739.01	0	633.87	0	0	0	0	498.06	537.21	0	0	0	0	0	0	594.38	0	625.13	513.62	0	443.25	0	0	0	0	0	0	627.28	0	626.38	0	0	354.32	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RY27	A0A9L0RY27_HORSE	"AlkB homolog 1, histone H2A dioxygenase"	ALKBH1	Equus caballus (Horse)	DNA repair [GO:0006281]		dioxygenase activity [GO:0051213]	EIKKSNIR	0.92101	0.29097	0	0	0	0	0	0	0	0	0	0	3424.8	0	0	0	0	0	0	0	0	0	2065.4	0	0	0	0	0	1414.2	0	0	0	3593.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	762.85	0	0	0	0	0	0	0	0	0	0	1951.6	0	0	0	0	0	0	0	0
A0A9L0RY51	A0A9L0RY51_HORSE	Abl interactor 2	ABI2	Equus caballus (Horse)				VVAIYDYTK	0.9646	0.0026017	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2932.6	2618.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RYB1	A0A9L0RYB1_HORSE	Uncharacterized protein		Equus caballus (Horse)				AVALSER	0.96695	-0.039919	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1213.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RYG5	A0A9L0RYG5_HORSE	Fibronectin type III and SPRY domain containing 2	FSD2	Equus caballus (Horse)				HTFVSSRHK	0.98867	-1.887	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	594.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RYK9	A0A9L0RYK9_HORSE	Period circadian protein homolog 2 (Circadian clock protein PERIOD 2)	PER2	Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]		ELKVHLPADR	0.98691	-1.9116	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	506.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RYP0	A0A9L0RYP0_HORSE	Nucleolar complex protein 2 homolog	NOC2L	Equus caballus (Horse)		nucleus [GO:0005634]		LVPTARFYPLR	0.98701	-1.1514	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	521.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RYQ8	A0A9L0RYQ8_HORSE	C2 calcium dependent domain containing 6	C2CD6	Equus caballus (Horse)				NLQDLSDKLFSK	0.98904	-1.7611	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7709.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RYU1	A0A9L0RYU1_HORSE	BicC family RNA binding protein 1	BICC1	Equus caballus (Horse)			RNA binding [GO:0003723]	KPVVTEVR	0.96389	-0.022254	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4960.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RYU6	A0A9L0RYU6_HORSE	dTMP kinase (EC 2.7.4.9)	DTYMK	Equus caballus (Horse)				ADFSLDWCK	0.98798	-1.8775	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2310	2674.7	2600.6	0	0	0	0	0	0	0	0	0	1024.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RZ31	A0A9L0RZ31_HORSE	Tetratricopeptide repeat and ankyrin repeat containing 1	TRANK1	Equus caballus (Horse)			helicase activity [GO:0004386]; hydrolase activity [GO:0016787]	LSSKVMSK	0.97929	-0.36738	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1378.1	0	0	0	0	415.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RZ95	A0A9L0RZ95_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				FIQSERQKEK	0.76615	0.51767	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	726.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RZB8	A0A9L0RZB8_HORSE	Coiled-coil domain containing 77	CCDC77	Equus caballus (Horse)				GVSGGFSGSPRWR	0.99204	-1.2443	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	931.05	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RZD3	A0A9L0RZD3_HORSE	2-phosphoxylose phosphatase 1 (Acid phosphatase-like protein 2)	PXYLP1	Equus caballus (Horse)				APGSPLPWR	0.98756	-1.8124	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	396.87	0	0	641.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0RZI8	A0A9L0RZI8_HORSE	SET binding factor 1	SBF1	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]	AVLLRSGGLHSK	0.98854	-1.8882	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	453.95
A0A9L0RZJ3	A0A9L0RZJ3_HORSE	N-acylglucosamine 2-epimerase (EC 5.1.3.8) (GlcNAc 2-epimerase) (N-acetyl-D-glucosamine 2-epimerase) (Renin-binding protein)	RENBP	Equus caballus (Horse)			isomerase activity [GO:0016853]	VAPPGKK	0.58865	0.64803	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3870.4	0	0	0	0	0	0
A0A9L0RZQ2	A0A9L0RZQ2_HORSE	Citron rho-interacting serine/threonine kinase	CIT	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]	metal ion binding [GO:0046872]	DEIQRKFDALR	0.96794	-0.04122	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6898.7	0	0	0	0	0	441.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S013	A0A9L0S013_HORSE	RNA polymerase II-associated factor 1 homolog	PAF1	Equus caballus (Horse)		nucleus [GO:0005634]		DRSKGHR	0.96814	-0.17165	0	0	0	0	0	0	1405.9	0	0	0	0	0	0	0	0	0	0	2285.3	0	0	1276.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	692.41	0	0	0	0	0	1139	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1027.3	0	0	0	0	0	0	0
A0A9L0S022	A0A9L0S022_HORSE	TATA box-binding protein-like 1 (TATA box-binding protein-related factor 2) (TBP-like factor) (TBP-related protein)	TBPL1	Equus caballus (Horse)			DNA binding [GO:0003677]	APAVQTRER	0.98315	-0.90206	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	526.51	0	0	0	0	3479.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	680.8	0	0	0	0	0	0	0	873.76	0	0	0	0
A0A9L0S058	A0A9L0S058_HORSE	Forkhead box R1	FOXR1	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	LEVPEPSK	0.87162	0.40185	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3369.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S073	A0A9L0S073_HORSE	Glutamate rich 5	ERICH5	Equus caballus (Horse)				EPQPQEAKGK	0.95716	0.22356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	978.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S079	A0A9L0S079_HORSE	Kelch like family member 23	KLHL23	Equus caballus (Horse)				EIAPMMERR	0.98055	-0.52014	0	0	0	0	0	0	384.97	0	0	0	0	0	603.88	0	0	0	0	0	0	0	0	659.45	0	0	0	0	0	0	1232.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S081	A0A9L0S081_HORSE	Family with sequence similarity 98 member B	FAM98B	Equus caballus (Horse)				GGGGGGR	0.98868	-1.0492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	842.34	756.19	1169.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	595.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	450.62	0	0	0	0	0	0
A0A9L0S096	A0A9L0S096_HORSE	Protein kibra	WWC1	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		EMRFISPRK	0.99167	-1.2386	0	431.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1105.7	0	0	0	0	0	0	735.81	0	0	0	0	0	0	0	0	0	460.06	0	0	0	0	0	0	0	0	0	291.06	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S0B7	A0A9L0S0B7_HORSE	"1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma (EC 3.1.4.11)"	PLCG2	Equus caballus (Horse)	phospholipid catabolic process [GO:0009395]; signal transduction [GO:0007165]		phosphatidylinositol phospholipase C activity [GO:0004435]	VSSAKFLKDK	0.77399	0.5097	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	327.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S0B8	A0A9L0S0B8_HORSE	C2H2-type domain-containing protein		Equus caballus (Horse)				LGLSFHSHLAELR	0.98621	-1.3788	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1313.2	0	0	0	963.4	0	0	0	0	0	0	0	0	0	0	0	4785.2	0	2017.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S0C7	A0A9L0S0C7_HORSE	UDP-glucose glycoprotein glucosyltransferase 2	UGGT2	Equus caballus (Horse)	organic substance metabolic process [GO:0071704]	endoplasmic reticulum lumen [GO:0005788]	transferase activity [GO:0016740]	ESHSIIK	0.98608	-2.0001	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	328.74	0	0	0	0	0	0	0	0	0	0
A0A9L0S0I9	A0A9L0S0I9_HORSE	Cytoplasmic tRNA 2-thiolation protein 1 (EC 2.7.7.-) (ATP-binding domain-containing protein 3) (Cytoplasmic tRNA adenylyltransferase 1)	LOC111775260 ATPBD3 CTU1 NCS6	Equus caballus (Horse)	protein urmylation [GO:0032447]; tRNA thio-modification [GO:0034227]; tRNA wobble uridine modification [GO:0002098]	cytoplasm [GO:0005737]	nucleotidyltransferase activity [GO:0016779]; tRNA binding [GO:0000049]	VSIFLSHAFRR	0.98438	-0.78817	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	462.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	331.73	0	344.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S0J4	A0A9L0S0J4_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	MAST3	Equus caballus (Horse)	phosphorylation [GO:0016310]	cytoplasm [GO:0005737]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	AGPSGGR	0.99058	-1.6615	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3204.3	0	0	0	0	0	0	0	0	437.02	0	0	0	0	0	0	0	0	0	851.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S0L2	A0A9L0S0L2_HORSE	Kinesin-like protein	KIF5B	Equus caballus (Horse)		microtubule [GO:0005874]	ATP binding [GO:0005524]; cytoskeletal motor activity [GO:0003774]	EMTNHQKK	0.98957	-1.125	0	0	0	0	0	0	0	0	0	0	0	1519.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	858.27	0	0	1714.6	0	0	0
A0A9L0S0N4	A0A9L0S0N4_HORSE	Dynein axonemal assembly factor 9	DNAAF9	Equus caballus (Horse)				SPGGPGR	0.98818	-1.2702	0	0	0	0	0	0	0	0	0	0	945.03	856.5	0	642.7	608.23	0	0	0	0	0	694.69	597.2	0	604.97	420.78	461.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	465.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	576.98	0	0	480.46	0	499.98	0	722.09	0	0	1031.4	0	742.67	691.77	618.87
A0A9L0S0P3	A0A9L0S0P3_HORSE	Sphingosine kinase 1	SPHK1	Equus caballus (Horse)				AASAPTR	0.98425	-0.98696	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1236.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S0R9	A0A9L0S0R9_HORSE	"2-oxoadipate dehydrogenase complex component E1 (2-oxoadipate dehydrogenase, mitochondrial) (Alpha-ketoadipate dehydrogenase) (Dehydrogenase E1 and transketolase domain-containing protein 1) (Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial)"	DHTKD1	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	LMLESQEFDHFLATK	0.68665	0.58543	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	527.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S0U7	A0A9L0S0U7_HORSE	Eyes shut homolog	EYS	Equus caballus (Horse)				IDCKIQLPK	0.98682	-1.8435	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	347.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S0W9	A0A9L0S0W9_HORSE	tRNA N(3)-methylcytidine methyltransferase (EC 2.1.1.-)	METTL8	Equus caballus (Horse)	RNA methylation [GO:0001510]; tRNA processing [GO:0008033]		RNA methyltransferase activity [GO:0008173]	IHKNKFFK	0.96638	-0.10056	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1208.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S0Y1	A0A9L0S0Y1_HORSE	NEDD8 ultimate buster 1 ubiquitin-like domain-containing protein		Equus caballus (Horse)				KNFLKTQLYIPGR	0.88318	0.35682	0	0	556.68	0	0	0	0	0	0	0	0	0	0	393.89	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1256.4	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S0Y4	A0A9L0S0Y4_HORSE	RELT like 2	RELL2	Equus caballus (Horse)		membrane [GO:0016020]		RYGLHEHR	0.98858	-1.713	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1032.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	601.14	0	0	0	0	0	0	0	0	0	0	0	508.19	0	0	0	0	0	0	0	0	602.03	0	0	0	0
A0A9L0S185	A0A9L0S185_HORSE	Family with sequence similarity 171 member A1	FAM171A1	Equus caballus (Horse)		membrane [GO:0016020]		EELLSHK	0.9677	-0.02931	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1292.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S1B7	A0A9L0S1B7_HORSE	Fraser extracellular matrix complex subunit 1	FRAS1	Equus caballus (Horse)				GLVLDENSVK	0.40574	0.68447	0	0	0	0	0	0	0	0	0	0	0	0	0	0	396.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1171.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	460.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S1H4	A0A9L0S1H4_HORSE	"Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (EC 3.1.7.2) (Metazoan SpoT homolog 1) (Penta-phosphate guanosine-3'-pyrophosphohydrolase)"	HDDC3	Equus caballus (Horse)			metal ion binding [GO:0046872]	MGSEAAR	0.98802	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	332.6	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S1T6	A0A9L0S1T6_HORSE	DUF1725 domain-containing protein		Equus caballus (Horse)				IWYIYTMEYYSAMKKDK	0.87389	0.39818	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	861.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S1W7	A0A9L0S1W7_HORSE	RNA helicase (EC 3.6.4.13)	DDX47	Equus caballus (Horse)			ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]	AASEEHDSPTEVPQPAVEEEETK	0.89543	0.43496	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1096.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S1W9	A0A9L0S1W9_HORSE	ubiquitinyl hydrolase 1 (EC 3.4.19.12)	OTUD4	Equus caballus (Horse)				GDPEERKDK	0.96463	-0.094113	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	573.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S1Z3	A0A9L0S1Z3_HORSE	Uncharacterized protein		Equus caballus (Horse)				IFLNTLSSKRR	0.97177	-0.20086	0	0	0	0	0	0	0	0	0	0	0	452.72	0	0	0	445.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S214	A0A9L0S214_HORSE	Thimet oligopeptidase (EC 3.4.24.15)	THOP1	Equus caballus (Horse)	proteolysis [GO:0006508]		metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237]	AGVTELR	0.98749	-1.202	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	672.76	4045.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S238	A0A9L0S238_HORSE	"Ciliary rootlet coiled-coil, rootletin family member 2"	CROCC2	Equus caballus (Horse)				KERTISSLK	0.97312	-0.19165	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1071.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S298	A0A9L0S298_HORSE	Leucine rich repeat and sterile alpha motif containing 1	LRSAM1	Equus caballus (Horse)			metal ion binding [GO:0046872]	YLDAERQR	0.98852	-1.0501	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	343.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S2C3	A0A9L0S2C3_HORSE	MAP kinase-interacting serine/threonine-protein kinase 2 (EC 2.7.11.1) (MAP kinase signal-integrating kinase 2)	MKNK2	Equus caballus (Horse)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	LAQRRQR	0.9913	-1.235	0	0	0	0	0	0	0	0	1523.2	0	959.41	0	1682.7	1531.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1883.3	0	0	0	0	0	2847.2	2533	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S2E2	A0A9L0S2E2_HORSE	ETS transcription factor ERG	ERG	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	AAQPSPSTVPK	0.91708	0.29276	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	277.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S2M8	A0A9L0S2M8_HORSE	P2X purinoceptor	P2RX7	Equus caballus (Horse)	monoatomic ion transmembrane transport [GO:0034220]; signal transduction [GO:0007165]	membrane [GO:0016020]	channel activity [GO:0015267]	IRREFPR	0.96071	-0.015636	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	791.48	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S2Q8	A0A9L0S2Q8_HORSE	Cell division control protein	CDC6	Equus caballus (Horse)	cell division [GO:0051301]; DNA replication initiation [GO:0006270]	nucleus [GO:0005634]		ALAGGGK	0.98998	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	481.32	0	0	0	0
A0A9L0S2S4	A0A9L0S2S4_HORSE	SHC adaptor protein 4	SHC4	Equus caballus (Horse)				NEDCYHGKLSRK	0.96513	-0.11029	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	749.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S2Z7	A0A9L0S2Z7_HORSE	RBR-type E3 ubiquitin transferase (EC 2.3.2.31)	RNF19A	Equus caballus (Horse)		membrane [GO:0016020]	metal ion binding [GO:0046872]; transferase activity [GO:0016740]	ISIGSLFR	0.97238	0.13182	0	0	0	0	0	0	1269.9	0	0	0	0	0	0	0	0	0	0	2401.1	0	0	1330.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1963.5	0	0	0	0	0	0	0	0	0	0	1876.2	1704.3	1561.7	0	0	0	0	0	0	0	1386.3	0	0	0	0	0	0	0	742.09	0	0	350.21	0	1041.6	0	0	0
A0A9L0S331	A0A9L0S331_HORSE	Kinase (EC 2.7.-.-)	IP6K2	Equus caballus (Horse)	phosphorylation [GO:0016310]		kinase activity [GO:0016301]	AGGQQGLSK	0.97183	-0.064164	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2038.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S356	A0A9L0S356_HORSE	Cerebral endothelial cell adhesion molecule	CERCAM	Equus caballus (Horse)				APNPGDLK	0.96838	-0.035901	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1407.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S3H6	A0A9L0S3H6_HORSE	Potassium voltage-gated channel subfamily H member 8	KCNH8	Equus caballus (Horse)		monoatomic ion channel complex [GO:0034702]	potassium channel activity [GO:0005267]	MLIPQSADSNFILANAQVAK	0.88462	0.35831	0	0	0	0	13992	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15461	0	0	0	0	0	0	0	0	0	0	33239	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S3N4	A0A9L0S3N4_HORSE	Reticulon 4 receptor like 1	RTN4RL1	Equus caballus (Horse)				WLPGPAGRR	0.98349	-0.80574	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	686.18	889.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S446	A0A9L0S446_HORSE	Exportin-2 (Chromosome segregation 1-like protein) (Importin-alpha re-exporter)	CSE1L	Equus caballus (Horse)		cytoplasm [GO:0005737]		IIIPEIQK	0.88577	0.35454	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1035.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S4C3	A0A9L0S4C3_HORSE	Anosmin 1	ANOS1	Equus caballus (Horse)				VSACGPSR	0.97543	0.11873	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	573.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S4K2	A0A9L0S4K2_HORSE	Testis specific 10	TSGA10	Equus caballus (Horse)				SEIELLRSQMTNER	0.96852	0.010894	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	815.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1417.7	0	0	0	0	0	0
A0A9L0S4T5	A0A9L0S4T5_HORSE	Gremlin	GREM1	Equus caballus (Horse)		extracellular space [GO:0005615]	cytokine activity [GO:0005125]	VTRVKQCR	0.97492	0.077549	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2958.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S4U1	A0A9L0S4U1_HORSE	Major facilitator superfamily domain containing 2B	MFSD2B	Equus caballus (Horse)		membrane [GO:0016020]		PRGWVLHQQK	0.98856	-1.8966	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	331.66	0	0	0	0	0	0
A0A9L0S4U5	A0A9L0S4U5_HORSE	Zinc finger protein 608	ZNF608	Equus caballus (Horse)				KNELPLKELGK	0.97422	-0.19776	0	0	0	0	0	0	0	0	0	0	585.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S4X3	A0A9L0S4X3_HORSE	NLR family pyrin domain containing 4	NLRP4	Equus caballus (Horse)				GIQGIGK	0.98287	-0.93587	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38576	1056.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S4Z6	A0A9L0S4Z6_HORSE	Uncharacterized protein		Equus caballus (Horse)				ELKVGSQR	0.98883	-1.1461	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3746	0	0	0	0	0	0	1009.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S4Z7	A0A9L0S4Z7_HORSE	Uncharacterized protein		Equus caballus (Horse)		membrane [GO:0016020]		STASFTPGAQQDR	0.77826	0.51049	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1114.7	1087	1067.9	0	0	0	0	581.12	0	0	0	977.01	0	0	0	0	1170.8	0	0	0	0	0	0	0	0	0	0	0	528.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S4Z9	A0A9L0S4Z9_HORSE	Aldo-keto reductase family 1 member B1 (EC 1.1.1.21) (EC 1.1.1.300) (Aldehyde reductase) (Aldose reductase)	AKR1B1	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	PALSWGRTAYLK	0.92862	0.26334	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	426.28	726.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S547	A0A9L0S547_HORSE	IQ motif containing B1	IQCB1	Equus caballus (Horse)				GFQTRKR	0.96626	-0.089442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1054.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S5C8	A0A9L0S5C8_HORSE	NF-kappa-B inhibitor-like protein 1 (Inhibitor of kappa B-like protein) (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 1)	NFKBIL1	Equus caballus (Horse)				YLRVQQIR	0.98796	-1.8057	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1561.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S5C9	A0A9L0S5C9_HORSE	Complement C1q B chain	C1QB	Equus caballus (Horse)		extracellular region [GO:0005576]		VGPKGPAGPK	0.98709	-1.844	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	735.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S5H4	A0A9L0S5H4_HORSE	Zinc finger and SCAN domain containing 23	ZSCAN23	Equus caballus (Horse)		nucleus [GO:0005634]		NFIYHCNLIQHR	0.9339	0.25601	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	361.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S5P0	A0A9L0S5P0_HORSE	"RAB6B, member RAS oncogene family"	RAB6B	Equus caballus (Horse)				SWGVRDAR	0.9875	-1.064	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	965.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1184.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S5Q1	A0A9L0S5Q1_HORSE	Striatin 4	STRN4	Equus caballus (Horse)		membrane [GO:0016020]; protein-containing complex [GO:0032991]	calmodulin binding [GO:0005516]; protein-containing complex binding [GO:0044877]	GVPSLPR	0.89652	0.33513	0	0	0	0	0	0	0	685.03	773.16	0	0	0	0	586.4	0	0	0	0	0	578.34	485.62	0	0	0	0	0	0	946.46	1383.9	937.21	1490.6	1020.8	997.51	0	0	0	0	714.81	0	837.92	0	879.82	0	0	0	0	0	587.62	0	687.06	580.21	0	0	0	0	0	0	0	0	0	0	562.88	542.95	0	0	0	0	0	0	0	568.78	0	0	0	0
A0A9L0S5S2	A0A9L0S5S2_HORSE	Protein canopy homolog 3	CNPY3	Equus caballus (Horse)				ASGSGSK	0.96995	0.20049	0	0	0	0	0	0	302.36	0	297.12	0	0	0	0	336.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	411.62	0	0	0	470.72	0	0	0	0	0	0	0	420.3	0	0	0	0	444.28	0	391.2	0	286.01	0	0	0	275.67	0	0	0	0	0	0	0	0	399.78	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S5S7	A0A9L0S5S7_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				APVQKENNK	0.98175	-0.66078	0	0	0	0	0	0	0	0	0	0	0	0	0	0	897.24	0	0	0	0	0	0	0	0	1242.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1459.8	0	0	0	0	735.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	529.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S5T5	A0A9L0S5T5_HORSE	Mitofusin 2	MFN2	Equus caballus (Horse)	mitochondrion organization [GO:0007005]	mitochondrial outer membrane [GO:0005741]	GTP binding [GO:0005525]; hydrolase activity [GO:0016787]	FEECISQSAVKTK	0.98741	-1.5192	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	464.64	0	1279.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S5Z9	A0A9L0S5Z9_HORSE	Lys-63-specific deubiquitinase (EC 3.4.19.-)	BRCC3	Equus caballus (Horse)	cell division [GO:0051301]; double-strand break repair [GO:0006302]; mitotic G2 DNA damage checkpoint signaling [GO:0007095]; positive regulation of DNA repair [GO:0045739]; proteolysis [GO:0006508]; response to ionizing radiation [GO:0010212]	BRCA1-A complex [GO:0070531]; BRISC complex [GO:0070552]; cytoplasm [GO:0005737]; spindle pole [GO:0000922]	cysteine-type deubiquitinase activity [GO:0004843]; metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237]; polyubiquitin modification-dependent protein binding [GO:0031593]	LAELTGRPMR	0.084337	1.4903	0	0	0	0	0	0	0	0	468.68	0	525.25	0	877.58	935.06	725.26	0	0	0	0	616.13	0	0	0	0	0	0	0	1471.9	0	1298.1	1896.5	1848.5	1892.4	706.83	885.5	681.68	547	1314.4	1492.4	1131.8	866.94	763.08	0	0	506.2	1182.2	1134.5	1171.8	1063.6	0	1319.5	0	0	771.11	0	0	0	1586.8	1607.9	2044.8	0	603.96	621.07	0	0	0	889.67	769.98	901.9	538.17	1084	1009.5	0	0	0
A0A9L0S618	A0A9L0S618_HORSE	Dorsal root ganglia homeobox	DRGX	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	EALEAQQSLGR	0.96695	-0.082108	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2516.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S647	A0A9L0S647_HORSE	Histone deacetylase 3 (HD3) (EC 3.5.1.98)	HDAC3	Equus caballus (Horse)	chromatin organization [GO:0006325]	nucleus [GO:0005634]	hydrolase activity [GO:0016787]	AGGSGLK	0.95633	0.22429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	555.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S661	A0A9L0S661_HORSE	Ig-like domain-containing protein		Equus caballus (Horse)				TTGQAVTLRCSTVSK	0.94883	0.23726	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	595.89	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S676	A0A9L0S676_HORSE	Zinc finger protein 358	ZNF358	Equus caballus (Horse)				MERDTEIR	0.9889	-1.7601	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	838.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S683	A0A9L0S683_HORSE	FACT complex subunit SSRP1	SSRP1	Equus caballus (Horse)	DNA repair [GO:0006281]; DNA replication [GO:0006260]	chromosome [GO:0005694]; nucleus [GO:0005634]	DNA binding [GO:0003677]	GAAHAGK	0.97325	0.13255	0	0	0	0	0	0	0	424.38	429.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2840.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S6B6	A0A9L0S6B6_HORSE	Family with sequence similarity 186 member B	FAM186B	Equus caballus (Horse)				LGQPGKEHR	0.98599	-2.4396	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	657.38	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	646.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S6F9	A0A9L0S6F9_HORSE	Serine/threonine kinase 38	STK38	Equus caballus (Horse)				TGSSSITRTSALR	0.93069	0.2615	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1122.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S6J7	A0A9L0S6J7_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				ILYPEKISFK	0.98667	-1.9167	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1409.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S6L8	A0A9L0S6L8_HORSE	6-phosphofructokinase (EC 2.7.1.11) (Phosphohexokinase)	PFKP	Equus caballus (Horse)	glycolytic process [GO:0006096]; phosphorylation [GO:0016310]	cytoplasm [GO:0005737]	ATP binding [GO:0005524]; kinase activity [GO:0016301]; metal ion binding [GO:0046872]	EYYSAIKK	0.98816	-1.7894	0	0	0	0	0	0	0	670.47	0	0	0	0	593.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	536.74	0	0	0	0	0	803.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S6N9	A0A9L0S6N9_HORSE	VPS16 core subunit of CORVET and HOPS complexes	VPS16	Equus caballus (Horse)		early endosome [GO:0005769]; protein-containing complex [GO:0032991]		VGPEQKVK	0.99036	-1.1885	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	383.4	0	0	0	0	0	0	0	0
A0A9L0S6Q3	A0A9L0S6Q3_HORSE	"Leucine, glutamate and lysine rich 1"	LEKR1	Equus caballus (Horse)				LAAVLQRRLNQQ	0.96616	-0.15645	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1250.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S6U5	A0A9L0S6U5_HORSE	MSL complex subunit 2	MSL2	Equus caballus (Horse)			metal ion binding [GO:0046872]	GQRTNVSPQPTRLR	0.96675	-0.082994	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	598.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S6X7	A0A9L0S6X7_HORSE	Complement C7	C7	Equus caballus (Horse)	"complement activation, classical pathway [GO:0006958]; innate immune response [GO:0045087]; killing of cells of another organism [GO:0031640]"	extracellular region [GO:0005576]; membrane attack complex [GO:0005579]		ILPLTVCK	0.9697	-0.17903	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2198	0	0	0	0	0	0	0	0	0	0	0	6881.5	0	0	0	0	0	0	0	0	0	0	1746.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S757	A0A9L0S757_HORSE	Lipocalin 2	LCN2	Equus caballus (Horse)		extracellular region [GO:0005576]		ELTPELREK	0.9859	-1.9268	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	503.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S796	A0A9L0S796_HORSE	Pyrroline-5-carboxylate reductase 3 (EC 1.5.1.2) (Pyrroline-5-carboxylate reductase-like protein)	PYCR3	Equus caballus (Horse)	proline biosynthetic process [GO:0006561]			SAQGTAK	0.95673	0.23517	0	0	0	0	0	0	0	0	0	0	0	0	0	574.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	636.1	0	0	0	0	0	0	0	0	0	807.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S797	A0A9L0S797_HORSE	Parkin coregulated like	PACRGL	Equus caballus (Horse)				LEQHGGSVSR	0.96303	-0.13902	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	916.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S7F7	A0A9L0S7F7_HORSE	Sterile alpha motif domain containing 12	SAMD12	Equus caballus (Horse)				ELHFPGR	0.9675	-0.039279	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	574.68	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S7F8	A0A9L0S7F8_HORSE	Lactamase beta like 1	LACTBL1	Equus caballus (Horse)				LLRPDAAK	0.97358	0.1052	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1510.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S7F9	A0A9L0S7F9_HORSE	Hook microtubule tethering protein 1	HOOK1	Equus caballus (Horse)		cytoplasm [GO:0005737]; microtubule [GO:0005874]		VPAATAD	0.95446	0.23592	0	0	0	0	0	0	0	286.06	0	0	0	0	0	0	0	0	0	0	0	456.18	0	0	0	0	0	0	0	0	0	369.06	0	0	531.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S7K0	A0A9L0S7K0_HORSE	Solute carrier family 6 member 1	SLC6A1	Equus caballus (Horse)		membrane [GO:0016020]		GVGWTGK	0.93202	0.27267	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	767.89	0	0	768.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S7L2	A0A9L0S7L2_HORSE	Reverse transcriptase zinc-binding domain-containing protein		Equus caballus (Horse)				KNLKSAIPK	0.97202	0.046528	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	324.13	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S7P5	A0A9L0S7P5_HORSE	RALBP1 associated Eps domain containing 2	REPS2	Equus caballus (Horse)			metal ion binding [GO:0046872]	VPLSHGYSK	0.96458	-0.11659	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	690.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S7R1	A0A9L0S7R1_HORSE	Ankyrin repeat domain containing 11	ANKRD11	Equus caballus (Horse)				DSSQCEK	0.98618	-1.4445	0	890.11	0	0	0	1007.2	0	0	0	0	2495.2	1622.9	0	0	0	0	0	0	0	1271.1	1292.3	1102	0	0	831.32	1046.5	1000.8	0	0	0	1970.7	1978.9	2082.8	0	0	0	0	0	1039	0	0	0	0	0	0	0	0	0	1090.3	0	0	0	1199.3	0	0	0	994.95	0	0	0	882.16	1076.7	0	0	0	0	0	0	1042	0	0	1568.6	0	1506.2	1615.1
A0A9L0S7W9	A0A9L0S7W9_HORSE	EF-hand calcium binding domain 6	EFCAB6	Equus caballus (Horse)			metal ion binding [GO:0046872]	ELQQSTEKAVPAR	0.98547	-1.2835	0	0	0	0	0	0	0	0	514.88	0	0	0	0	0	0	0	2504.7	2232.8	0	0	0	0	0	0	0	0	0	2047	0	2423.5	0	1479.6	0	0	2468.9	0	0	0	0	0	0	0	0	0	0	0	2333.3	0	0	0	0	0	1332.7	0	0	0	0	0	0	0	0	0	0	0	0	0	436.55	0	0	0	0	0	0	0	0
A0A9L0S7Z4	A0A9L0S7Z4_HORSE	Serpin family B member 13	SERPINB13	Equus caballus (Horse)				AKQMSTSK	0.98307	-0.94521	0	0	0	0	0	0	0	0	0	0	0	927.83	0	0	0	0	0	585.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1141.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S818	A0A9L0S818_HORSE	Podocan	PODN	Equus caballus (Horse)				LAVGSVVESAFR	0.91123	0.31505	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2005.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S853	A0A9L0S853_HORSE	RING-type E3 ubiquitin transferase (EC 2.3.2.27)	TRIM9	Equus caballus (Horse)		cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	metal ion binding [GO:0046872]; transferase activity [GO:0016740]	DVMLGKDDK	0.98844	-1.7131	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	459.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S864	A0A9L0S864_HORSE	Kinesin-like protein	KIF12	Equus caballus (Horse)		microtubule [GO:0005874]	ATP binding [GO:0005524]	DPKSMSSLGVGK	0.98686	-2.6158	0	0	0	0	0	0	0	543.03	567.69	0	0	0	477.26	495.27	502.21	2433.2	2385.7	2335.9	0	579.92	0	0	0	0	0	0	0	1901.7	0	2458.5	1469.1	1482.7	1411	0	2967.7	2496.4	0	995.12	712.77	0	0	2274.7	0	0	0	0	0	0	492.14	0	506.01	0	0	0	0	0	0	1730.1	1972.1	1900.7	0	428.21	0	0	0	0	0	0	0	0	581.69	0	0	0	0
A0A9L0S885	A0A9L0S885_HORSE	Centrin 1	CETN1	Equus caballus (Horse)		microtubule organizing center [GO:0005815]	metal ion binding [GO:0046872]	EEILKAFR	0.98401	-1.2934	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1421.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S8D5	A0A9L0S8D5_HORSE	Mitochondrial transcription termination factor 4	MTERF4	Equus caballus (Horse)				KLTTASSR	0.98137	-0.65828	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2567.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S8D6	A0A9L0S8D6_HORSE	M-phase phosphoprotein 8	MPHOSPH8	Equus caballus (Horse)				EDSKENRK	0.9848	-0.98803	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1272.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S8F9	A0A9L0S8F9_HORSE	Family with sequence similarity 149 member B1	FAM149B1	Equus caballus (Horse)				RRNPPPR	0.97546	0.086872	550.63	0	0	0	236.01	339.9	1269.9	1330.2	1521.9	0	804.81	1079.8	1382.2	1515.2	1414	1788.2	1807.8	0	0	1669.6	1330.5	0	0	0	0	0	0	0	0	0	1378.1	0	1694.8	0	0	0	376.23	0	1640.8	0	0	0	1322.8	1248.1	1054.2	0	0	1893	1876.2	1704.3	1561.7	0	0	968.6	0	262.12	0	1998.4	1386.3	2032.7	0	1068.4	0	0	352.95	490.99	742.09	835.41	0	350.21	1146.9	1041.6	0	0	0
A0A9L0S8H8	A0A9L0S8H8_HORSE	Uncharacterized protein		Equus caballus (Horse)				EDIWLADR	0.99057	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	951.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1229.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S8N0	A0A9L0S8N0_HORSE	UDP-glucuronosyltransferase (EC 2.4.1.17)	LOC100065342	Equus caballus (Horse)		membrane [GO:0016020]	glycosyltransferase activity [GO:0016757]	RDVHLPALYQK	0.98421	-1.2868	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1465.8	0	0	0	0	0	0	0	885.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S8S2	A0A9L0S8S2_HORSE	Transmembrane 131 like	TMEM131L	Equus caballus (Horse)		membrane [GO:0016020]		KNNGNNQQVPVK	0.98521	-2.0863	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	648.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S940	A0A9L0S940_HORSE	Calpain 5	CAPN5	Equus caballus (Horse)	proteolysis [GO:0006508]		cysteine-type peptidase activity [GO:0008234]	LRNPWGER	0.98831	-1.6047	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	481.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1158.4	0	0	0	0	0	0	0	0	0	3028.8	0	529.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S954	A0A9L0S954_HORSE	Adenosine 3'-phospho 5'-phosphosulfate transporter 1	SLC35B2	Equus caballus (Horse)		membrane [GO:0016020]		CGRAAAR	0.98883	-1.6947	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1264.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S967	A0A9L0S967_HORSE	Calcium-transporting ATPase (EC 7.2.2.10)	ATP2C1	Equus caballus (Horse)	calcium ion transport [GO:0006816]	membrane [GO:0016020]	ATP binding [GO:0005524]	EQTLTLTQQQRDLYQQEKAR	0.98366	-0.24692	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3869.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S9G3	A0A9L0S9G3_HORSE	Histone H2A		Equus caballus (Horse)		nucleosome [GO:0000786]; nucleus [GO:0005634]	DNA binding [GO:0003677]	GATGGTR	0.98997	-1.2702	663.15	821.3	780.2	880.45	875.41	968.5	778.78	989.99	945.28	569.28	926.78	671.85	870.72	888.1	0	0	535.5	0	632.2	0	590.61	659.01	664.23	776.07	805.47	655.51	745.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	933.11	0	660.49	0	0	0	974.46	1004.9	0	901.97	892.68	798.52	728.22	891.92	704.34	0	0	0	982.98	0	794.36	0	662.15	0	822.41	0	822.26	968.79	747.97	1030.5	683.06	670.42	827.61
A0A9L0S9M7	A0A9L0S9M7_HORSE	EF-hand calcium binding domain 3	EFCAB3	Equus caballus (Horse)			metal ion binding [GO:0046872]	LLKSIKSLK	0.98209	-0.26084	0	0	0	0	0	0	0	0	572.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S9P9	A0A9L0S9P9_HORSE	Glycoprotein Ib platelet subunit alpha	GP1BA	Equus caballus (Horse)		membrane [GO:0016020]		WERVEPK	0.98973	-1.6296	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1291.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1158.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S9S9	A0A9L0S9S9_HORSE	Centrosomal protein of 162 kDa	CEP162	Equus caballus (Horse)	cell projection organization [GO:0030030]	centriole [GO:0005814]; cytoplasm [GO:0005737]; microtubule [GO:0005874]		GAQALIEQIK	0.041096	1.6632	0	0	350.14	0	0	0	331.36	0	339.8	0	367.03	891.59	654.84	839.24	884.64	390.35	0	511.62	0	810.53	301.88	0	0	0	0	0	0	430.39	398.91	1068.5	1539.9	0	1592.6	1191.1	1400.6	728.18	811.36	927.56	603.21	760.84	888.67	0	530.24	585.95	572.49	0	758.68	1265.9	391.33	686.88	339.92	0	526.61	0	389.11	0	0	0	885.95	1085.2	306.64	595.78	0	881.91	577.56	342.41	575.66	514.22	324.26	360.29	917.44	311.75	501.43	512.42	504.96
A0A9L0S9T3	A0A9L0S9T3_HORSE	Zinc finger protein 582	ZNF582	Equus caballus (Horse)				TAPFYISTK	0.96961	0.14858	0	431.79	873.35	0	0	476.24	854.41	972.58	0	0	511.78	0	879.95	0	897.24	0	3717.2	0	759.52	982.84	0	1651.6	1287.7	554.62	0	971.07	939.14	3035.8	0	0	0	0	0	0	0	0	1105.7	1518	1459.8	0	0	0	743.61	735.81	717.09	2323.9	0	3147.9	1158.4	1035	935.8	602.34	684.92	700.58	766.61	0	751.71	2923.7	0	2998.3	529.85	0	680.8	0	0	518.21	679.27	0	0	0	0	855.58	0	0	637.61
A0A9L0S9T4	A0A9L0S9T4_HORSE	LIM domain kinase 2	LIMK2	Equus caballus (Horse)			ATP binding [GO:0005524]	ELIRCDEETQK	0.98768	-1.8641	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	604.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S9U0	A0A9L0S9U0_HORSE	Collagen alpha-1(I) chain	LOC100067285	Equus caballus (Horse)				DAPKNGK	0.9865	-0.86442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	231.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S9U1	A0A9L0S9U1_HORSE	Actin-related protein 2/3 complex subunit 3	ARPC3	Equus caballus (Horse)	Arp2/3 complex-mediated actin nucleation [GO:0034314]	Arp2/3 protein complex [GO:0005885]; cytoplasm [GO:0005737]	actin binding [GO:0003779]	SLSGPGQ	0.96076	0.21824	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	351.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S9U5	A0A9L0S9U5_HORSE	Syntaxin 16	STX16	Equus caballus (Horse)		membrane [GO:0016020]		LTDAFLLLR	0.96401	-0.025619	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	489.13	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S9U9	A0A9L0S9U9_HORSE	Mixed lineage kinase domain like pseudokinase	MLKL	Equus caballus (Horse)				RIVRQYLQKPMK	0.88285	0.38452	0	0	0	0	0	0	0	866.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1579.2	0	0	0	0	0	0	0	0	0	0	826.44	0	0	0	0	0	0	0	0	805.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S9V8	A0A9L0S9V8_HORSE	Collagen type VII alpha 1 chain		Equus caballus (Horse)	cell adhesion [GO:0007155]	cellular anatomical entity [GO:0110165]; collagen trimer [GO:0005581]		DGAPGVRGDK	0.98673	-2.6298	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	830.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S9V9	A0A9L0S9V9_HORSE	ubiquitinyl hydrolase 1 (EC 3.4.19.12)	USP49	Equus caballus (Horse)			hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	SSRGQAK	0.68195	0.59666	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	777.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S9X4	A0A9L0S9X4_HORSE	Methyltransferase like 17	METTL17	Equus caballus (Horse)				AVHLEKK	0.98063	-0.58221	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4153.8	0	0	0	0	0	0	0	0	0	0	0	0	0	47099	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31670	0	0	0	0	0	0	0	0	36607	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0S9Y4	A0A9L0S9Y4_HORSE	Protein-L-isoaspartate O-methyltransferase domain-containing protein 1	PCMTD1	Equus caballus (Horse)				GIPQRAPPKR	0.98485	-0.22528	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3057.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SA10	A0A9L0SA10_HORSE	CD163 molecule like 1	CD163L1	Equus caballus (Horse)				LVDGGGR	0.86254	0.46607	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1236.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	830.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SA11	A0A9L0SA11_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	LRRK2	Equus caballus (Horse)	cell differentiation [GO:0030154]; phosphorylation [GO:0016310]; regulation of signal transduction [GO:0009966]	cytosol [GO:0005829]; intracellular organelle [GO:0043229]; membrane [GO:0016020]	ATP binding [GO:0005524]; GTP binding [GO:0005525]; protein serine/threonine kinase activity [GO:0004674]	VPTVHNSKK	0.98332	-0.80777	0	0	0	0	0	0	0	0	0	0	0	912.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	889.19	0	1107.3	1250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	505.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	543.69	0	0
A0A9L0SA49	A0A9L0SA49_HORSE	RNA-directed DNA polymerase (EC 2.7.7.49)		Equus caballus (Horse)				EIKGTQIGK	0.98904	-1.2146	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	878.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SA72	A0A9L0SA72_HORSE	Zinc finger protein 335	ZNF335	Equus caballus (Horse)				ICAEAFPGRAEMESHKR	0.96935	0.038723	0	0	0	0	0	0	0	0	0	0	0	0	0	339.89	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SAC5	A0A9L0SAC5_HORSE	Uncharacterized protein		Equus caballus (Horse)		membrane [GO:0016020]		AGSYGNSMFKFLR	0.28161	0.83641	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1586.8	0	0	0	0	0	0	0	0	0	0	0	0	0	876.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	828.72	2924.2	0	0	0
A0A9L0SAC6	A0A9L0SAC6_HORSE	RCC1 and BTB domain containing protein 1	RCBTB1	Equus caballus (Horse)				YIHVHKAVLK	0.98678	-1.9117	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2848.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SAF0	A0A9L0SAF0_HORSE	Tubulin-specific chaperone D	TBCD	Equus caballus (Horse)				FLQRPCPWCP	0.74334	0.54297	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	760.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SAI1	A0A9L0SAI1_HORSE	ATP binding cassette subfamily A member 13	ABCA13	Equus caballus (Horse)		membrane [GO:0016020]	ATP binding [GO:0005524]	ILYTPNTPEINQVIQK	0.95711	0.23264	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	315.92	0	0	0	0	0	0	0	0	0	514.33	0	0	0	0	0	1231.4	0	1157	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SAK0	A0A9L0SAK0_HORSE	SR-related CTD associated factor 4	SCAF4	Equus caballus (Horse)			RNA binding [GO:0003723]	HVVQIVEKFIK	0.98353	-1.2896	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2086.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SAN4	A0A9L0SAN4_HORSE	Ribonuclease P/MRP subunit p25 like	RPP25L	Equus caballus (Horse)				GPAASAR	0.95463	0.23672	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	605.96	0
A0A9L0SAQ9	A0A9L0SAQ9_HORSE	Transglutaminase 5	TGM5	Equus caballus (Horse)				AIFSLASR	0.977	0.10886	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	688.56	0	0	0	0	1830.7	0	0	0	0
A0A9L0SAS4	A0A9L0SAS4_HORSE	Collagen type XV alpha 1 chain	COL15A1	Equus caballus (Horse)				AAGLLSTYR	0.96418	-0.11293	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	801.01	0	0	0	0	0	0
A0A9L0SAV2	A0A9L0SAV2_HORSE	Gse1 coiled-coil protein	GSE1	Equus caballus (Horse)				LDTSSEK	0.9781	0.072023	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	765.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	328.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SAX8	A0A9L0SAX8_HORSE	C2H2-type domain-containing protein	LOC106782082	Equus caballus (Horse)				CGACGRNFR	0.9889	-1.7585	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	601.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SB06	A0A9L0SB06_HORSE	RAN binding protein 17	RANBP17	Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]		MLIGLARDLR	0.98381	-0.95193	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	388.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SBC3	A0A9L0SBC3_HORSE	Regulator of chromosome condensation 2	RCC2	Equus caballus (Horse)				GGPAGRK	0.55474	0.64803	0	0	0	0	0	0	0	0	0	0	0	0	0	359.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	316.37	0	882.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SBE0	A0A9L0SBE0_HORSE	Solute carrier family 66 member 3		Equus caballus (Horse)		membrane [GO:0016020]		RSSPRSATAR	0.96451	-0.12146	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	537.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SBJ6	A0A9L0SBJ6_HORSE	Phosphotriesterase-related protein (Parathion hydrolase-related protein)	PTER	Equus caballus (Horse)				ILMAHDIHTK	0.9647	-0.084274	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	451.76	0	0	0	0	0	0	0	0
A0A9L0SBW0	A0A9L0SBW0_HORSE	Talin 1	TLN1	Equus caballus (Horse)		cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]		AAARDGK	0.98624	-2.6899	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	763.46	0	265.42	0	0	0	0	0	0	0	0	0	0	521.28	0	0	509.19	463.07	0	0	0	0	0	0	507.65	0	0	0	0	667.67	669.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SC02	A0A9L0SC02_HORSE	Hypoxia inducible factor 1 subunit alpha inhibitor	HIF1AN	Equus caballus (Horse)				ELLLSWR	0.92989	0.2766	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1009.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	591.85	0	0	0	0	0	0	0
A0A9L0SC67	A0A9L0SC67_HORSE	Zinc finger homeobox 3	ZFHX3	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	VIKHWFR	0.98588	-2.9035	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2996.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	911.05	0	0	0	0	0	0	0
A0A9L0SC78	A0A9L0SC78_HORSE	Solute carrier family 16 member 5	SLC16A5	Equus caballus (Horse)		membrane [GO:0016020]		VSPLLPRAAGR	0.98527	-1.2806	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	396.38	0	0	0	358.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SCC9	A0A9L0SCC9_HORSE	WD repeat-containing protein 48 (USP1-associated factor 1)	WDR48	Equus caballus (Horse)		late endosome [GO:0005770]		ELVASAGLDR	0.87836	0.3908	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	806.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SCJ5	A0A9L0SCJ5_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				SPEQKEK	0.98792	-1.092	516.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2061.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2241.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SCL8	A0A9L0SCL8_HORSE	Protein phosphatase 1 regulatory subunit 14	PPP1R14C	Equus caballus (Horse)	regulation of phosphorylation [GO:0042325]	membrane [GO:0016020]	protein phosphatase inhibitor activity [GO:0004864]	KLNPPQK	0.98148	-0.6252	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24188	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SCU8	A0A9L0SCU8_HORSE	Uncharacterized protein		Equus caballus (Horse)				VTSVGEVVEK	0.90547	0.3219	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	522.75	0	0	0
A0A9L0SCY9	A0A9L0SCY9_HORSE	DNA (cytosine-5)-methyltransferase (EC 2.1.1.37)	DNMT1	Equus caballus (Horse)		nucleus [GO:0005634]	chromatin binding [GO:0003682]; DNA (cytosine-5-)-methyltransferase activity [GO:0003886]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]	QCVSPSQGSEPANHQK	0.96689	-0.081559	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	730.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SD17	A0A9L0SD17_HORSE	PCNA-associated factor (PCNA-associated factor of 15 kDa) (PCNA-clamp-associated factor)	PCLAF	Equus caballus (Horse)		nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]		VVASRAPR	0.98642	-1.9211	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2122.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SD25	A0A9L0SD25_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				GQKYLTYR	0.98782	-1.2742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	401.05	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SD58	A0A9L0SD58_HORSE	Chromobox 4	CBX4	Equus caballus (Horse)				AAGAEEK	0.9584	0.22021	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1218.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SDB4	A0A9L0SDB4_HORSE	peptidylprolyl isomerase (EC 5.2.1.8)	FKBP14	Equus caballus (Horse)			peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	GNNSTLLS	0.9676	-0.050287	0	0	0	0	0	0	0	0	0	1093.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SDD0	A0A9L0SDD0_HORSE	Replication protein A4	RPA4	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	LIRECPR	0.98786	-1.7801	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	967.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SDE1	A0A9L0SDE1_HORSE	Kinesin-like protein	KIF17	Equus caballus (Horse)		microtubule [GO:0005874]	ATP binding [GO:0005524]	NIKNKPR	0.96753	-0.098206	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	687.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SDE4	A0A9L0SDE4_HORSE	Sorting nexin 7	SNX7	Equus caballus (Horse)	protein transport [GO:0015031]			FIVKGMVERFNDDFIETR	0.98209	-0.6388	0	0	0	0	0	0	0	0	0	0	439.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	709.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SDJ6	A0A9L0SDJ6_HORSE	Methionine synthase (EC 2.1.1.13) (5-methyltetrahydrofolate--homocysteine methyltransferase)	MTR	Equus caballus (Horse)	methylation [GO:0032259]	cytoplasm [GO:0005737]	cobalamin binding [GO:0031419]; methionine synthase activity [GO:0008705]; zinc ion binding [GO:0008270]	QDHYESLKER	0.98867	-1.8867	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2165.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SDR3	A0A9L0SDR3_HORSE	Catenin beta like 1	CTNNBL1	Equus caballus (Horse)		nucleus [GO:0005634]		RKLLFQWK	0.96637	-0.10056	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	254.96	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SDY2	A0A9L0SDY2_HORSE	Selenoprotein P	SELENOP	Equus caballus (Horse)		membrane [GO:0016020]		KTSVKLYLWLLWK	0.91763	0.29326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	526.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SDZ1	A0A9L0SDZ1_HORSE	Pituitary adenylate cyclase-activating polypeptide	ADCYAP1	Equus caballus (Horse)	regulation of protein localization [GO:0032880]	extracellular region [GO:0005576]	hormone activity [GO:0005179]	KYLAAVLGKSPSLEK	0.90955	0.30005	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1484.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SE33	A0A9L0SE33_HORSE	Myomesin 1	MYOM1	Equus caballus (Horse)				KDAGIYEVILK	0.98066	-0.58938	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	468.22	0	0	0	0	0	0	0	0	0	0	0	0	349.56	0	0	0	0	0	0	0	0	0	0	0	0	591.12	0	0	0	0	0	0	0	0	0
A0A9L0SE36	A0A9L0SE36_HORSE	ubiquitinyl hydrolase 1 (EC 3.4.19.12)	USP32	Equus caballus (Horse)			metal ion binding [GO:0046872]	LSSSKENLDASK	0.98853	-1.8837	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	883.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SE44	A0A9L0SE44_HORSE	Long-chain-fatty-acid--CoA ligase ACSBG1 (EC 6.2.1.3) (Acyl-CoA synthetase bubblegum family member 1)	ACSBG1	Equus caballus (Horse)	lipid metabolic process [GO:0006629]			LDADGFLYITGR	0.78333	0.50331	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1884.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SE79	A0A9L0SE79_HORSE	C2H2-type domain-containing protein	ZSCAN5B	Equus caballus (Horse)				GNLNVHRR	0.98297	-0.73694	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	606.13	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SEA1	A0A9L0SEA1_HORSE	CutA divalent cation tolerance homolog	CUTA	Equus caballus (Horse)				LHAAGAGFR	0.9665	-0.10439	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	599.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SEA2	A0A9L0SEA2_HORSE	Centrosomal protein 295	CEP295	Equus caballus (Horse)		centrosome [GO:0005813]; cytoplasm [GO:0005737]		KAEMRHK	0.97945	-0.27707	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	983.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SEE9	A0A9L0SEE9_HORSE	Lysosomal protein transmembrane 5	LAPTM5	Equus caballus (Horse)		membrane [GO:0016020]		LSFCLREMDRIAATR	0.89184	0.35983	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1196.1	0	967.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SEG5	A0A9L0SEG5_HORSE	Uncharacterized protein		Equus caballus (Horse)				FPTFTALNR	0.97617	0.079084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2108.6	0	1536	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SEH1	A0A9L0SEH1_HORSE	Ephrin B2	EFNB2	Equus caballus (Horse)	cell differentiation [GO:0030154]; nervous system development [GO:0007399]	membrane [GO:0016020]		GVSQSLQRK	0.98427	-0.92071	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1151.9	1126.5	0	0	0	0	0	0	0	0	392.83	0	0	0	0	0	0
A0A9L0SEP4	A0A9L0SEP4_HORSE	DNA damage-binding protein 1 (Damage-specific DNA-binding protein 1)	DDB1 CYB561A3	Equus caballus (Horse)	DNA repair [GO:0006281]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein ubiquitination [GO:0016567]	nucleus [GO:0005634]		ISHLASRR	0.98063	-0.57575	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	558.42	543	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SEQ9	A0A9L0SEQ9_HORSE	E3 ubiquitin-protein ligase UHRF (EC 2.3.2.27) (RING-type E3 ubiquitin transferase UHRF) (Ubiquitin-like PHD and RING finger domain-containing protein) (Ubiquitin-like-containing PHD and RING finger domains protein)	UHRF2	Equus caballus (Horse)	cell cycle [GO:0007049]; protein ubiquitination [GO:0016567]	nucleus [GO:0005634]	DNA binding [GO:0003677]; histone binding [GO:0042393]; metal ion binding [GO:0046872]; ubiquitin protein ligase activity [GO:0061630]	DLRPRAR	0.98812	-1.7763	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1630.6	0	0	0	0	0	0	0	0
A0A9L0SER0	A0A9L0SER0_HORSE	Thioredoxin domain containing 2	TXNDC2	Equus caballus (Horse)				QGNIPNSPAK	0.9856	-1.3459	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2813.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	370.26
A0A9L0SEU0	A0A9L0SEU0_HORSE	ORC ubiquitin ligase 1	OBI1	Equus caballus (Horse)				NKDLYQK	0.98843	-1.7024	0	0	0	0	0	0	586.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SEW3	A0A9L0SEW3_HORSE	Sodium/potassium-transporting ATPase subunit beta	ATP1B2	Equus caballus (Horse)	monoatomic ion transport [GO:0006811]	membrane [GO:0016020]		VDSNVALAPR	0.88946	0.3665	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1529	1544.1	7824.1	7592.1	0	1388.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	682.06	629.18	0	0	0
A0A9L0SFA6	A0A9L0SFA6_HORSE	Zinc finger protein 592	ZNF592	Equus caballus (Horse)		nucleus [GO:0005634]		APKGAASGSQMGK	0.98783	-1.812	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1167.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	578.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SFD3	A0A9L0SFD3_HORSE	60S ribosomal protein L36a	RPL36AL	Equus caballus (Horse)		ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840]		LVEVALVHQR	0.97051	-0.06523	0	0	0	0	0	0	1163.6	0	0	0	0	0	0	0	0	0	0	3173.5	0	0	0	1813.9	0	1701.8	0	0	0	0	0	0	0	0	0	0	0	0	0	1459.9	0	0	0	0	0	0	0	0	0	0	0	0	0	1371.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1123	0	0	1005.8	0	0	0	0	0
A0A9L0SFF6	A0A9L0SFF6_HORSE	Tubulin tyrosine ligase like 13	TTLL13	Equus caballus (Horse)		mitochondrial membrane [GO:0031966]		SIGFHQDGLGSQELHSVNLVPLVLLRR	0.97577	0.07823	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1048.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SFH7	A0A9L0SFH7_HORSE	Netrin receptor UNC5	UNC5B	Equus caballus (Horse)		plasma membrane [GO:0005886]	netrin receptor activity [GO:0005042]	NKPVELR	0.97071	-0.029017	1689.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SFS6	A0A9L0SFS6_HORSE	WW and C2 domain containing 2	WWC2	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		QDLMHSLAK	0.96738	-0.080651	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	806.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SFX1	A0A9L0SFX1_HORSE	R3H domain containing 2	R3HDM2	Equus caballus (Horse)			nucleic acid binding [GO:0003676]	DDASMDR	0.98443	-0.23812	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1861.7	0	1822.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SG00	A0A9L0SG00_HORSE	Family with sequence similarity 149 member A	FAM149A	Equus caballus (Horse)				LSSPPVQTSR	0.36667	0.7427	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	550.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	531.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SG63	A0A9L0SG63_HORSE	Nephrocystin 4	NPHP4	Equus caballus (Horse)				VSLFDVTYR	0.96585	-0.076305	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	715.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SG66	A0A9L0SG66_HORSE	"Ribosomal RNA processing 9, U3 small nucleolar RNA binding protein"	RRP9	Equus caballus (Horse)				SFLDYTHPLCIK	0.85915	0.47178	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2924.2	0	0	0
A0A9L0SG76	A0A9L0SG76_HORSE	Family with sequence similarity 83 member H	FAM83H	Equus caballus (Horse)				SRARKPR	0.97044	0.1529	0	0	0	532.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1274.9	0	0	11742	0	0	0	0	153480	0	0	0	0	0	0	0	0	0	0	113320	148130	0	0	0	49719	0	0	0	0	0	0	89695	0	61094	0	0	0	0	126980	0	0	0	0	0	1349.5	0	0	0	0	0	0	0	0	27147	0	24495
A0A9L0SG99	A0A9L0SG99_HORSE	AMP deaminase (EC 3.5.4.6)	AMPD3	Equus caballus (Horse)			hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	CLLKCSEKR	0.14737	1.2258	686.47	0	0	0	0	699.99	951.49	1068	1010.2	0	557.57	0	854.21	766.06	919.01	1075.3	3359.5	3341.7	0	749.92	538.2	0	0	0	0	0	0	2256.1	3047.9	3002.5	1245.3	1968.5	1361.5	2640.5	2804.2	1989.2	0	899.82	0	0	1934.9	1787.5	0	0	0	0	4119.4	4134.8	670.41	734.03	0	0	0	0	0	0	0	1735.9	1665.8	1734.2	0	0	0	0	0	0	0	0	0	0	0	473.9	0	0	0
A0A9L0SGE4	A0A9L0SGE4_HORSE	OCA2 melanosomal transmembrane protein	OCA2	Equus caballus (Horse)		membrane [GO:0016020]		LCEVLNLDPR	0.96229	-0.14331	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	427.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SGH2	A0A9L0SGH2_HORSE	"NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial (Complex I-18 kDa) (NADH-ubiquinone oxidoreductase 18 kDa subunit)"	NDUFS4	Equus caballus (Horse)		mitochondrial inner membrane [GO:0005743]; respirasome [GO:0070469]		LDITTLTGVPEEHIKTRK	0.36449	0.73951	0	0	0	0	13992	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7115.3	0	9702.9	0	0	0	0	100100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24830	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SGH6	A0A9L0SGH6_HORSE	Septin-5	SEPTIN5	Equus caballus (Horse)		cytoskeleton [GO:0005856]	GTP binding [GO:0005525]	TQAQRRLK	0.98525	-0.87136	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	406.56	320.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SGX7	A0A9L0SGX7_HORSE	Nucleolar GTP-binding protein 1	GTPBP4	Equus caballus (Horse)	ribosome biogenesis [GO:0042254]	nucleolus [GO:0005730]	GTP binding [GO:0005525]	DVSGLRDVK	0.98334	-0.23106	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	608.62	667.23	595.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	744.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SH14	A0A9L0SH14_HORSE	Nuclear envelope integral membrane protein 1	NEMP1	Equus caballus (Horse)		nuclear inner membrane [GO:0005637]		VTQVENEEKLK	0.9826	-0.81081	328.57	0	0	346.99	358.77	349.39	1895.6	0	0	0	0	0	0	0	1401.1	2441.3	2366.8	2189.3	0	1265.2	0	0	344.98	0	0	0	0	0	0	1025.1	0	0	0	0	0	0	0	0	0	0	2929.4	3022	0	0	799.23	0	0	0	0	5259.8	0	0	1325.5	0	0	0	0	0	0	0	507.52	0	3082.6	0	548.87	636.45	1980.6	0	0	395.53	0	1066.2	0	0	0
A0A9L0SH33	A0A9L0SH33_HORSE	DNA topoisomerase II binding protein 1	TOPBP1	Equus caballus (Horse)				DFAPVEK	0.98297	-0.81044	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1771.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	536.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SHB5	A0A9L0SHB5_HORSE	BOS complex subunit TMEM147 (Transmembrane protein 147)	TMEM147	Equus caballus (Horse)		endoplasmic reticulum membrane [GO:0005789]; nuclear membrane [GO:0031965]; plasma membrane [GO:0005886]		SGGPGGR	0.95533	0.22316	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	407.45	397.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	316.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	308.85
A0A9L0SHL6	A0A9L0SHL6_HORSE	Phagosome assembly factor 1	PHAF1	Equus caballus (Horse)				VIEVYDLTKVK	0.98638	-1.9084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	585.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SHQ1	A0A9L0SHQ1_HORSE	Phosphoserine phosphatase (EC 3.1.3.3)	PSPH	Equus caballus (Horse)				VSHSELR	0.96329	-0.025029	0	0	0	0	0	0	0	0	0	0	0	0	0	0	587.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SHV0	A0A9L0SHV0_HORSE	ER membrane protein complex subunit 9	EMC9	Equus caballus (Horse)				AGPGGGR	0.95571	0.22439	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	609.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SHW5	A0A9L0SHW5_HORSE	"Junction mediating and regulatory protein, p53 cofactor"	JMY	Equus caballus (Horse)				TFKQRYPGQVILK	0.74693	0.54678	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1283.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SI59	A0A9L0SI59_HORSE	Tripeptidyl-peptidase 2 (EC 3.4.14.10) (Tripeptidyl aminopeptidase)	TPP2	Equus caballus (Horse)	proteolysis [GO:0006508]		aminopeptidase activity [GO:0004177]; serine-type endopeptidase activity [GO:0004252]	DVLPNNR	0.96922	0.030863	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2608.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SIC9	A0A9L0SIC9_HORSE	Cellular tumor antigen p53	TP53	Equus caballus (Horse)	apoptotic process [GO:0006915]; cell cycle [GO:0007049]; rhythmic process [GO:0048511]	centrosome [GO:0005813]; endoplasmic reticulum [GO:0005783]; mitochondrial matrix [GO:0005759]; PML body [GO:0016605]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	FAVFTAGMFPSK	0.93401	0.27773	0	0	0	0	0	0	0	0	365.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SIE4	A0A9L0SIE4_HORSE	Homeodomain interacting protein kinase 3	HIPK3	Equus caballus (Horse)			ATP binding [GO:0005524]	GSAFQTK	0.88538	0.37623	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	491.85	0	0	0	0	0	0	0	0	0	313.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	317.45	339.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SIH5	A0A9L0SIH5_HORSE	Cullin 7	CUL7	Equus caballus (Horse)				SLIQRALR	0.99249	-1.2423	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	385.96	0
A0A9L0SIQ9	A0A9L0SIQ9_HORSE	Reverse transcriptase domain-containing protein		Equus caballus (Horse)				RPTPRHR	0.98864	-1.768	829.25	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SJ28	A0A9L0SJ28_HORSE	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase (EC 2.7.4.24)	PPIP5K2	Equus caballus (Horse)	phosphorylation [GO:0016310]	cytosol [GO:0005829]	ATP binding [GO:0005524]; diphosphoinositol-pentakisphosphate kinase activity [GO:0033857]; inositol hexakisphosphate kinase activity [GO:0000828]	FSISFAR	0.98567	-1.3095	0	0	0	0	0	0	0	0	0	0	415.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	660.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SJ34	A0A9L0SJ34_HORSE	Regulator of microtubule dynamics protein 2 (Protein FAM82A1)	RMDN2	Equus caballus (Horse)				ADRLRLEESSK	0.82271	0.49362	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	501.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SJ40	A0A9L0SJ40_HORSE	Transformation/transcription domain associated protein	TRRAP	Equus caballus (Horse)	protein modification process [GO:0036211]; regulation of macromolecule metabolic process [GO:0060255]; regulation of nitrogen compound metabolic process [GO:0051171]; regulation of primary metabolic process [GO:0080090]			CATPLKDEERAEEIVAAQEK	0.93096	0.2582	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	534.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SJA5	A0A9L0SJA5_HORSE	Coiled-coil domain containing 97	CCDC97	Equus caballus (Horse)				ATFGGAR	0.95584	0.22316	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	413.92	0	0	0	368.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SJF3	A0A9L0SJF3_HORSE	FAD-dependent oxidoreductase domain-containing protein 1	FOXRED1	Equus caballus (Horse)				CGPIWPR	0.98228	-0.6381	0	0	0	0	0	0	0	0	410.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	817.68	0	0	0	0	0	0	0	0	0	0	565.57	644.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SJP3	A0A9L0SJP3_HORSE	"SPHK1 interactor, AKAP domain containing"	SPHKAP	Equus caballus (Horse)				EKVSDVVR	0.98788	-1.0759	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	462.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SJR5	A0A9L0SJR5_HORSE	Assembly factor for spindle microtubules	ASPM	Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]		AAISLQSYFRMGK	0.98587	-2.4506	1219.7	0	1749.8	0	0	0	399	524.98	629.94	2422.4	0	2868.8	393.85	0	377.71	3361	5361	0	0	2479.2	1732.1	1797.8	435.1	0	1457.5	0	0	1501.1	0	737.56	355.82	0	0	3126.5	3240.2	4620.2	1193.9	1974.3	3616.2	5014.3	3867.7	5289.5	0	0	1132.5	4686	5950	5410.8	753.66	720.65	1938.3	1899.6	1872.4	2025.5	0	0	0	0	776.39	0	0	761.92	0	0	0	0	0	0	0	0	499.53	484.75	0	0	0
A0A9L0SJT6	A0A9L0SJT6_HORSE	Pleckstrin homology domain containing M3	PLEKHM3	Equus caballus (Horse)				SVPCPRCVRR	0.97393	-0.194	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	948.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SJZ8	A0A9L0SJZ8_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				EICVEEAFRSPTFVNAK	0.96964	0.16674	0	726.69	0	543.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1521.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1138.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SK69	A0A9L0SK69_HORSE	Myosin light chain kinase 3	MYLK3	Equus caballus (Horse)			ATP binding [GO:0005524]	ASESKVRLK	0.96733	-0.17406	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	607.64	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SK93	A0A9L0SK93_HORSE	ISL LIM homeobox 2	ISL2	Equus caballus (Horse)	cell differentiation [GO:0030154]	nucleus [GO:0005634]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	LDPENKGVR	0.99107	-1.241	0	0	0	0	0	0	0	0	0	0	0	0	0	0	897.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SKB5	A0A9L0SKB5_HORSE	FYVE and coiled-coil domain autophagy adaptor 1	FYCO1	Equus caballus (Horse)			metal ion binding [GO:0046872]	ALEGESTKVQELNR	0.98585	-3.3584	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	506.2	0	0	0	0	1284.5	0	0	745.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SKE9	A0A9L0SKE9_HORSE	High mobility group nucleosome binding domain 5		Equus caballus (Horse)		nucleus [GO:0005634]		EEGEEKK	0.92913	0.25939	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	313.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SKI2	A0A9L0SKI2_HORSE	Plakophilin 1	PKP1	Equus caballus (Horse)	cell adhesion [GO:0007155]			GHKTTQNR	0.98762	-1.1989	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	655.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SKJ1	A0A9L0SKJ1_HORSE	Flotillin	FLOT1	Equus caballus (Horse)		caveola [GO:0005901]; endosome [GO:0005768]		KPAEAERYKLER	0.13187	1.2725	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	529.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SKL2	A0A9L0SKL2_HORSE	Uncharacterized protein		Equus caballus (Horse)				GAEGLHWR	0.96855	0.010436	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	692.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SKL5	A0A9L0SKL5_HORSE	Uncharacterized protein		Equus caballus (Horse)				VGTPCGSLR	0.98382	-1.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	791.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SKQ6	A0A9L0SKQ6_HORSE	Nucleoside diphosphate kinase (EC 2.7.4.6)	NME2	Equus caballus (Horse)	phosphorylation [GO:0016310]	nucleus [GO:0005634]	ATP binding [GO:0005524]; kinase activity [GO:0016301]	EPCRVPPR	0.98292	-0.68132	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	551.65	0	0	0	0	424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	711.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SKW0	A0A9L0SKW0_HORSE	Tyrosine-protein phosphatase non-receptor type (EC 3.1.3.48)	PTPN3	Equus caballus (Horse)		cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	phosphoprotein phosphatase activity [GO:0004721]	MRASSGK	0.68249	0.60491	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	400.03	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	349.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SKW4	A0A9L0SKW4_HORSE	NIMA related kinase 6	NEK6	Equus caballus (Horse)				AAPDRWRR	0.96829	0.02488	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3028.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SKZ2	A0A9L0SKZ2_HORSE	Keratin 82	KRT82 LOC100061458	Equus caballus (Horse)		intermediate filament [GO:0005882]		FASFIDK	0	15.456	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	706.97	888.74	709.23	0	0	0	446.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	666.04	500.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SKZ7	A0A9L0SKZ7_HORSE	Innate immunity activator	INAVA	Equus caballus (Horse)		cytoplasm [GO:0005737]		ALHREDPLSSLER	0.74555	0.55725	0	0	0	0	0	0	384.97	0	0	0	0	552.8	603.88	0	0	0	741.42	0	0	488.48	0	0	0	0	0	0	0	1001	0	0	0	0	1751.4	0	1328.8	844.28	0	0	593.85	0	1092.7	1001.6	442.74	392.42	518.44	604.3	0	516.82	0	0	0	1175	958.48	1193.1	1314.7	1053.6	882.62	1069	865.16	664.62	531.56	0	597.07	0	0	592.99	0	603.94	531.67	597.03	0	0	0	0	511.71
A0A9L0SL04	A0A9L0SL04_HORSE	Tubulin-specific chaperone E (Tubulin-folding cofactor E)	TBCE	Equus caballus (Horse)		cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]		KAFGNEWK	0.98398	-0.83465	0	0	0	0	0	0	0	669.76	580.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	920.06	0	1213.8	2184.3	558.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	969.18	0	0	0	0	0	0	839.16	0	0	0	0	0	0
A0A9L0SL09	A0A9L0SL09_HORSE	"TEF transcription factor, PAR bZIP family member"	TEF	Equus caballus (Horse)		nucleus [GO:0005634]		LDFVCADK	0.98545	-2.3946	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	324.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SL30	A0A9L0SL30_HORSE	N-acetylated alpha-linked acidic dipeptidase 2	NAALAD2	Equus caballus (Horse)		plasma membrane [GO:0005886]		ALKNYATSIYNLSK	0.70227	0.61998	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	732.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SL44	A0A9L0SL44_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				EWHKIFK	0.99005	-1.189	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	869.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	801.63	681.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	563.34	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SLH1	A0A9L0SLH1_HORSE	Interleukin 1 receptor accessory protein like 2	IL1RAPL2	Equus caballus (Horse)		membrane [GO:0016020]	hydrolase activity [GO:0016787]	HASVLLR	0.98904	-1.7574	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	502.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SLL3	A0A9L0SLL3_HORSE	Muscarinic acetylcholine receptor	CHRM2	Equus caballus (Horse)		postsynaptic membrane [GO:0045211]	G protein-coupled acetylcholine receptor activity [GO:0016907]	HLLMCHYK	0.96442	-0.1123	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	775.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SLZ3	A0A9L0SLZ3_HORSE	Ecotropic viral integration site 5 like	EVI5L	Equus caballus (Horse)				DGGRGGK	0.96712	0.1844	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	557.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SM46	A0A9L0SM46_HORSE	Elongation factor for RNA polymerase II	ELL	Equus caballus (Horse)	transcription by RNA polymerase II [GO:0006366]	nucleus [GO:0005634]		AGAGAGK	0.98787	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	435.31	1059.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SM72	A0A9L0SM72_HORSE	C-C motif chemokine receptor 4	CCR4	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	HVCFQAR	0.96193	-0.0071589	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	815.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SM74	A0A9L0SM74_HORSE	SH3 domain containing 21	SH3D21	Equus caballus (Horse)				LTDLWEELK	0.97156	-0.064164	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	376.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SM80	A0A9L0SM80_HORSE	Zinc finger and SCAN domain containing 12	ZSCAN12	Equus caballus (Horse)		nucleus [GO:0005634]		TSYREILLK	0.98828	-1.8888	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	452.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SM85	A0A9L0SM85_HORSE	Zinc finger protein 793	ZNF793	Equus caballus (Horse)				KTLPKER	0.97085	-0.067009	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	327.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SMC6	A0A9L0SMC6_HORSE	"Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 (Membrane-associated guanylate kinase inverted 3)"	MAGI3	Equus caballus (Horse)				SGSPKLDPSEVYLKSK	0.96822	0.17989	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	643.34	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SMG9	A0A9L0SMG9_HORSE	Acyl-CoA oxidase 2	ACOX2	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	LSGLPSLVTK	0.97047	-0.032291	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	526.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SMH2	A0A9L0SMH2_HORSE	Unc-45 myosin chaperone A	UNC45A	Equus caballus (Horse)	cell differentiation [GO:0030154]; muscle organ development [GO:0007517]	perinuclear region of cytoplasm [GO:0048471]		AAQALAK	0.95535	0.22651	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41759	0	0	0	0	0	0	0	0	0	0	0	38470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SMW0	A0A9L0SMW0_HORSE	Switching B cell complex subunit SWAP70	SWAP70	Equus caballus (Horse)				MLGAVACK	0.97431	0.050128	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	956.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SMW1	A0A9L0SMW1_HORSE	Armadillo repeat containing X-linked 4	ARMCX4	Equus caballus (Horse)		membrane [GO:0016020]		AGAGADK	0.98501	-2.2451	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	205.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2035.6	0	0	0	0	0	0	0	0	0	218.81	0	0	0	0	0	0	0	0	873.86	468.86	0	0	0	0	0	344.64	0	0	0	0	0	0	0	0	0	273.26	0	0	0	0
A0A9L0SMZ0	A0A9L0SMZ0_HORSE	RING-type E3 ubiquitin transferase (EC 2.3.2.27)	RNF111	Equus caballus (Horse)		nucleus [GO:0005634]		LTGRELR	0.9867	-1.5045	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	501.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SN36	A0A9L0SN36_HORSE	Basic proline-rich protein-like		Equus caballus (Horse)				LGTSTEPGQRR	0.98351	-0.8089	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	635.89	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SN38	A0A9L0SN38_HORSE	Inversin	INVS	Equus caballus (Horse)				GAGPEER	0.34359	0.77633	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	420.65	0	470.57	0	0	353.25	0	0	0	0	310.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	455.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SN54	A0A9L0SN54_HORSE	SH3KBP1 binding protein 1	SHKBP1	Equus caballus (Horse)				VLGGALGEHDK	0.97171	-0.063229	0	0	0	0	0	0	0	0	540.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SN73	A0A9L0SN73_HORSE	Src kinase-associated phosphoprotein 2 (Src family-associated phosphoprotein 2)	SKAP2	Equus caballus (Horse)				VYQFTAASPK	0.96274	-0.13817	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	860.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SN92	A0A9L0SN92_HORSE	Salvador family WW domain containing protein 1	SAV1	Equus caballus (Horse)				KTKGEAR	0.97021	0.16407	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1701.1	1637.6	0	1809.6	1731.7	1973.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SND5	A0A9L0SND5_HORSE	Ig-like domain-containing protein		Equus caballus (Horse)				IMGITWFWKNQVSKEESK	0.91715	0.29261	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24498	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SNF3	A0A9L0SNF3_HORSE	Family with sequence similarity 204 member A	FAM204A	Equus caballus (Horse)				LAWGFEAKK	0.97403	-0.20555	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	851.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SNJ8	A0A9L0SNJ8_HORSE	Guanylate cyclase soluble subunit alpha-1 (EC 4.6.1.2) (Soluble guanylate cyclase large subunit)	GUCY1A1	Equus caballus (Horse)		cytoplasm [GO:0005737]	GTP binding [GO:0005525]; lyase activity [GO:0016829]	NVQGNLPQR	0.9665	-0.079442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	671.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SNK1	A0A9L0SNK1_HORSE	Uncharacterized protein		Equus caballus (Horse)		membrane [GO:0016020]		CFFVSILFSLALK	0.98074	-0.51606	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	947.77
A0A9L0SNQ0	A0A9L0SNQ0_HORSE	Serine hydroxymethyltransferase (EC 2.1.2.1)	SHMT2	Equus caballus (Horse)	one-carbon metabolic process [GO:0006730]		transferase activity [GO:0016740]	SGLIFYRKGVR	0.97155	-0.20086	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2265.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	849.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SNU9	A0A9L0SNU9_HORSE	C2H2-type domain-containing protein		Equus caballus (Horse)				QSIRKHER	0.96683	-0.049211	0	0	0	0	0	0	0	0	0	0	659.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	805.68	0	0	800.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SNX3	A0A9L0SNX3_HORSE	RBPJ-interacting and tubulin-associated protein 1 (RBPJ-interacting and tubulin-associated protein)	RITA1	Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]		LSSNGLDPPRPLRR	0.98339	-0.82438	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3772.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SNY0	A0A9L0SNY0_HORSE	Ovo like zinc finger 2	OVOL2	Equus caballus (Horse)		nucleus [GO:0005634]	metal ion binding [GO:0046872]	LAALLQNK	0.9699	0.17245	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11599	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	117850	0	0	70622	0	21241	0	0	0	0	0	0	0	0	27147	0	24495
A0A9L0SP91	A0A9L0SP91_HORSE	C2H2-type domain-containing protein	ZNF275	Equus caballus (Horse)				ECGDTFRLK	0.98742	-4.179	0	0	0	0	0	0	0	0	0	1332.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1549
A0A9L0SPA9	A0A9L0SPA9_HORSE	Hepatocyte growth factor-regulated tyrosine kinase substrate	HGS	Equus caballus (Horse)	protein transport [GO:0015031]	early endosome membrane [GO:0031901]; multivesicular body membrane [GO:0032585]	metal ion binding [GO:0046872]; protein domain specific binding [GO:0019904]	QGDTQAK	0.98941	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	546.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SPC7	A0A9L0SPC7_HORSE	Striated muscle enriched protein kinase	SPEG	Equus caballus (Horse)			ATP binding [GO:0005524]	AASLDER	0.042857	1.7128	0	0	0	0	0	0	0	0	0	0	0	0	0	0	398.27	0	821.51	0	0	0	0	0	0	0	0	0	0	725.7	728.58	724.84	2706.3	2856	4407	642.44	0	610.22	0	820.38	801.84	756.53	1061.8	956.23	0	0	0	736.5	920.42	1879.9	455.97	424.81	440.79	0	1010.6	0	0	0	0	0	551.7	456.42	0	0	363.29	0	0	0	0	0	0	0	827.12	689.53	0	0	0
A0A9L0SPD5	A0A9L0SPD5_HORSE	Ligand dependent nuclear receptor corepressor like	LCORL	Equus caballus (Horse)				FGNSDSSLLEDSNNCTTNHEK	0.98597	-0.86763	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4663.9	0	0	0	0	0	0	964.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1958.8	0	0	0	0	0	0	0	0	0	0
A0A9L0SPM5	A0A9L0SPM5_HORSE	BET1-like protein		Equus caballus (Horse)	protein transport [GO:0015031]	Golgi apparatus [GO:0005794]; membrane [GO:0016020]		RPEPEPR	0.9615	-0.013236	0	0	0	0	0	0	0	0	0	0	0	0	0	0	870.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	812.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SPR5	A0A9L0SPR5_HORSE	Triadin	TRDN	Equus caballus (Horse)		sarcoplasmic reticulum membrane [GO:0033017]		ATAPGKK	0.55556	0.64803	0	0	0	467.88	515.13	520.53	0	0	0	0	0	0	0	0	38576	0	0	0	5477.3	0	0	0	0	589.1	0	0	0	0	0	57906	0	59729	0	0	0	0	0	0	0	0	0	0	0	0	0	35215	0	34817	0	0	38817	6240.4	0	0	0	7403.7	7511.5	0	49840	0	8687.5	0	0	10626	10875	10658	0	0	0	9470.9	0	0	0	11387	11171
A0A9L0SPT3	A0A9L0SPT3_HORSE	Methyl-CpG-binding domain protein 4 (EC 3.2.2.-)	MBD4 EFCAB12	Equus caballus (Horse)	DNA repair [GO:0006281]	nucleus [GO:0005634]	DNA binding [GO:0003677]; hydrolase activity [GO:0016787]	GKVTILKGIQIK	0.9873	-1.0532	0	0	0	0	0	0	0	0	0	0	567.27	0	0	0	0	491.97	651.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	656.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SQ64	A0A9L0SQ64_HORSE	Cyclin B3	CCNB3	Equus caballus (Horse)				ELLSFKR	0.97928	-0.28248	2101.1	2493.3	2698.7	2286.3	2039	2395.6	3722.4	0	3338	4166.9	6896.5	5659.6	2792.1	3187	3114.7	0	0	0	2542.2	3300.5	3263.2	2864.3	2808.3	2974.9	2139.1	2237	2405.2	0	0	0	0	0	0	0	0	0	2551.4	3055.1	2862.4	0	0	0	1931.7	2015.2	1766.7	0	0	0	3284.6	3307.3	3473	3002.6	3481.1	0	5147	6800.8	3299	0	0	2032.7	5690.3	3365.3	2386	5112.5	4534.3	1089.8	0	0	3009.4	6719.3	7497.5	18316	3788.1	3443.6	4018
A0A9L0SQ71	A0A9L0SQ71_HORSE	Lysine--tRNA ligase (EC 6.1.1.6) (Lysyl-tRNA synthetase)	KARS1	Equus caballus (Horse)			aminoacyl-tRNA ligase activity [GO:0004812]; ATP binding [GO:0005524]	GVECPPPR	0.98447	-0.81873	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	645.87	0	0	0	0	0	0	0
A0A9L0SQZ2	A0A9L0SQZ2_HORSE	Zinc finger protein 777	ZNF777	Equus caballus (Horse)			metal ion binding [GO:0046872]	AARARTDAR	0.98741	-1.5136	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1128.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SR28	A0A9L0SR28_HORSE	Acyl-CoA thioesterase 7	ACOT7	Equus caballus (Horse)			carboxylic ester hydrolase activity [GO:0052689]	DPGGDSR	0.95348	0.22543	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	587.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SR37	A0A9L0SR37_HORSE	THAP domain containing 7	THAP7	Equus caballus (Horse)			DNA binding [GO:0003677]	AEAALDALDKAQR	0.99083	-1.2352	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1627.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SR67	A0A9L0SR67_HORSE	Glutamate receptor	GRIK3	Equus caballus (Horse)	monoatomic ion transmembrane transport [GO:0034220]	postsynaptic membrane [GO:0045211]		FSLTCQRR	0.98128	-0.61968	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1270.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SR90	A0A9L0SR90_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				SSRRPSYLKK	0.97256	-0.20225	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	598.6	0	596.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SRF2	A0A9L0SRF2_HORSE	Matrix metallopeptidase 16	MMP16	Equus caballus (Horse)	proteolysis [GO:0006508]	membrane [GO:0016020]	metal ion binding [GO:0046872]; metallopeptidase activity [GO:0008237]	ILLTFSTGRR	0.98477	-0.84769	0	0	0	0	0	0	0	0	0	0	2760.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SRG3	A0A9L0SRG3_HORSE	ATP binding cassette subfamily A member 1	ABCA1	Equus caballus (Horse)		membrane [GO:0016020]	ATP binding [GO:0005524]	DPGFGTR	0.95599	0.23235	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	364.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SRI1	A0A9L0SRI1_HORSE	Mitochondrial ribosomal protein S17	ZNF713	Equus caballus (Horse)				LVLDPYLLKYFNK	0.90749	0.29838	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	520.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SRK6	A0A9L0SRK6_HORSE	Nudix hydrolase 14	NUDT14	Equus caballus (Horse)				AGHAPAR	0.98834	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	463.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SRK7	A0A9L0SRK7_HORSE	"alpha-1,2-Mannosidase (EC 3.2.1.-)"	MAN1A2	Equus caballus (Horse)	metabolic process [GO:0008152]	membrane [GO:0016020]	"hydrolase activity, acting on glycosyl bonds [GO:0016798]"	TTPALLPLSGRR	0.98494	-0.84563	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1168	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SRM1	A0A9L0SRM1_HORSE	Perilipin 3	PLIN3	Equus caballus (Horse)				GSPHAGHVGGAR	0.9206	0.29327	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	291.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SRP0	A0A9L0SRP0_HORSE	"Lectin, mannose binding 1 like"	LMAN1L	Equus caballus (Horse)				EPGGRRR	0.9716	-0.061971	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	982.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	529.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SRQ4	A0A9L0SRQ4_HORSE	Scribble planar cell polarity protein	SCRIB	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		EATHQEAVSALLRPCLELVLLVR	0.98569	-1.4081	0	0	0	0	0	0	0	0	340.15	0	0	0	622.39	0	0	887.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	328.9	0	0	0	0	0	0	0
A0A9L0SRQ6	A0A9L0SRQ6_HORSE	CobW C-terminal domain-containing protein	ZNG1A	Equus caballus (Horse)			hydrolase activity [GO:0016787]	VAVILNEFGEER	0.96819	-0.037511	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	491.92
A0A9L0SRS2	A0A9L0SRS2_HORSE	Large ribosomal subunit protein uL30 N-terminal eukaryotes domain-containing protein		Equus caballus (Horse)				IPLVPENLPK	0.96061	-0.14798	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3125.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SRU1	A0A9L0SRU1_HORSE	Protein argonaute-3 (Argonaute3) (Eukaryotic translation initiation factor 2C 3) (eIF-2C 3) (eIF2C 3)	AGO3 EIF2C3	Equus caballus (Horse)	miRNA-mediated gene silencing by inhibition of translation [GO:0035278]	P-body [GO:0000932]; RISC complex [GO:0016442]	miRNA binding [GO:0035198]	TVAQYFREK	0.98606	-2.5326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	951.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	508.19	0	0	0	0	0	0	0	0	602.03	0	0	0	0
A0A9L0SRU8	A0A9L0SRU8_HORSE	Carboxylic ester hydrolase (EC 3.1.1.-)		Equus caballus (Horse)			hydrolase activity [GO:0016787]	KSRLPVMVWIHK	0.91047	0.31191	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	430.4	0	0	0	603.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SRX6	A0A9L0SRX6_HORSE	Neurobeachin like 2	NBEAL2	Equus caballus (Horse)				LVPLALK	0.93145	0.26854	0	0	0	0	78730	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	537.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	742.85	640.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SS18	A0A9L0SS18_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				FVNVKRATPQHIVVK	0.91002	0.30059	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	954.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	820.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SS76	A0A9L0SS76_HORSE	Actin related protein 6	ACTR6	Equus caballus (Horse)				LLTNHLK	0.97311	0.13893	0	0	0	0	0	0	0	444.04	0	0	0	0	0	0	0	0	472.93	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	565.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SSF2	A0A9L0SSF2_HORSE	SCAN box domain-containing protein		Equus caballus (Horse)		nucleus [GO:0005634]		MAVSVDR	0.96936	0.034786	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	830.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SSL7	A0A9L0SSL7_HORSE	Nuclear pore complex protein Nup98-Nup96	NUP98	Equus caballus (Horse)	mRNA transport [GO:0051028]; protein transport [GO:0015031]	nuclear membrane [GO:0031965]; nuclear pore [GO:0005643]		ELLTRHCQLLETPESWAK	0.91509	0.30274	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37857	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19598	15402	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SSN3	A0A9L0SSN3_HORSE	Potassium channel tetramerization domain containing 21	KCTD21	Equus caballus (Horse)				DGKVFRYILNFLR	0.70323	0.61934	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	472.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SSP7	A0A9L0SSP7_HORSE	Dynein axonemal heavy chain 8	DNAH8	Equus caballus (Horse)		axoneme [GO:0005930]; dynein complex [GO:0030286]; microtubule [GO:0005874]; motile cilium [GO:0031514]	ATP binding [GO:0005524]	GICIFFVR	0.98637	-2.434	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	937.86	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	706.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	474.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SSV5	A0A9L0SSV5_HORSE	Nucleolar and spindle associated protein 1	NUSAP1	Equus caballus (Horse)		cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; nucleus [GO:0005634]		GVVATPVPLQGR	0.92176	0.29102	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	734.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SSV6	A0A9L0SSV6_HORSE	RNA helicase (EC 3.6.4.13)	DDX42	Equus caballus (Horse)			ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]	GVAYTLLTPK	0.86782	0.40311	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	291.61	0	0	0	0	253.13	0	0	0	0	0	0	0	0	224.38	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SSW5	A0A9L0SSW5_HORSE	Immunoglobulin subtype domain-containing protein		Equus caballus (Horse)				VGHMAAMVTQKPR	0.86659	0.40542	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	710.4	0	0	0	0	0	1124.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0ST71	A0A9L0ST71_HORSE	Mitochondria-eating protein (Spermatogenesis-associated protein 18)	SPATA18	Equus caballus (Horse)		mitochondrial outer membrane [GO:0005741]		SLQAQEDAR	0.96802	-0.097568	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1131.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0STD2	A0A9L0STD2_HORSE	Reverse transcriptase domain-containing protein		Equus caballus (Horse)				DHLKTLNDFQK	0.20513	1.0769	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	463.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0STF4	A0A9L0STF4_HORSE	Zinc finger C4H2-type containing	ZC4H2	Equus caballus (Horse)				LYEMENTIK	0.96803	-0.097568	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	341.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0STI3	A0A9L0STI3_HORSE	Capping protein regulator and myosin 1 linker 1	CARMIL1	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		TVFSHRK	0.96987	0.15664	725.2	0	0	0	0	0	1040.4	0	0	0	0	0	0	0	3242.9	3413.2	0	0	0	0	0	0	0	0	0	0	0	4337.3	0	0	0	0	0	0	0	0	603.97	3790.2	0	3149.5	0	0	0	0	0	0	3128.3	2755.3	0	0	2385.1	0	0	1329.7	0	0	0	0	0	0	0	0	1178.9	0	0	0	0	0	0	0	0	2122.6	770.17	0	0
A0A9L0STJ6	A0A9L0STJ6_HORSE	cAMP-responsive element-binding protein-like 2	CREBL2	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	ALLTGEEQSKSQQNSSR	0.98639	-1.9123	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	710.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0STL5	A0A9L0STL5_HORSE	Uncharacterized protein		Equus caballus (Horse)		membrane [GO:0016020]		ILLAYYK	0.97298	0.051947	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1817.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1462.4	0	0	0	0	0	1390	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	566.24
A0A9L0STL7	A0A9L0STL7_HORSE	Phosphatidylinositol transfer protein membrane associated 1	PITPNM1	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		LTFPVPTER	0.97326	0.13232	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1875.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0STV0	A0A9L0STV0_HORSE	Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 2	NYAP2	Equus caballus (Horse)				NETNLAYLK	0.96616	-0.10176	0	0	0	0	0	0	0	0	0	1079	0	0	0	0	0	0	0	0	0	0	0	0	0	730.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	786.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1619	0	0
A0A9L0SU21	A0A9L0SU21_HORSE	Cilia and flagella associated protein 100	CFAP100	Equus caballus (Horse)				GAQEDKLLESLNHK	0.98732	-1.0663	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	762.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SUI9	A0A9L0SUI9_HORSE	Ras-GEF domain-containing protein	LOC106781089	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]	VVELWIRVAENRR	0.71733	0.57554	0	0	0	0	0	0	0	0	0	0	0	0	645.87	0	0	0	1155.6	0	0	0	0	0	0	421.8	0	0	0	0	0	1328.8	0	0	0	0	0	0	0	703.1	0	957.48	0	0	0	0	0	905.96	1043.4	0	962.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SUR4	A0A9L0SUR4_HORSE	GDP-D-glucose phosphorylase 1 (EC 2.7.7.78)	GDPGP1	Equus caballus (Horse)		cytoplasm [GO:0005737]	hydrolase activity [GO:0016787]; nucleotide binding [GO:0000166]; transferase activity [GO:0016740]	RRPQNIRSVR	0.9796	-0.26756	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	477.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SUT3	A0A9L0SUT3_HORSE	MORN repeat-containing protein 5	MORN5	Equus caballus (Horse)		cilium [GO:0005929]		IVKDYKNR	0.98443	-0.98803	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	523.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SUY5	A0A9L0SUY5_HORSE	Zinc finger protein 280D	ZNF280D	Equus caballus (Horse)		nucleus [GO:0005634]		LIMLVNDFYYGK	0.79513	0.49814	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	774.12	0	0	0	0	0	0	0	0	0	0	0	1213.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SV75	A0A9L0SV75_HORSE	Methylated-DNA--protein-cysteine methyltransferase	MGMT	Equus caballus (Horse)				AVGGAMR	0.98365	-0.96026	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	715.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	660.18	0	0	0	0	0	0	453.19	0	0	0	0	0	1094.5	0	0	0	0	0	0	0	0	0	0	0	0	596.8
A0A9L0SV78	A0A9L0SV78_HORSE	Dedicator of cytokinesis 1	DOCK1	Equus caballus (Horse)		cytoplasm [GO:0005737]	guanyl-nucleotide exchange factor activity [GO:0005085]	AVFTDLGSKDLK	0.98499	-2.1426	0	0	0	0	0	0	0	0	518.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SV80	A0A9L0SV80_HORSE	"Troponin T, fast skeletal muscle"	TNNT3	Equus caballus (Horse)				APTASSPK	0.98883	-1.6962	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1021.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SV81	A0A9L0SV81_HORSE	Dense incisors		Equus caballus (Horse)				AEKQGCR	0.69649	0.61804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	555.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	310.05	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SVG3	A0A9L0SVG3_HORSE	Ral guanine nucleotide dissociation stimulator like 2	RGL2	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]	GLGPGTR	0.9099	0.31089	0	624.82	643.97	483.65	500.84	0	699.8	1170.8	1103.3	1559	2190.4	1166.3	505.41	1026.3	532.68	588.68	0	0	0	610.31	0	531.26	0	604.97	0	0	448.03	380.32	0	0	562.5	617.47	0	420.08	415.1	0	711.18	538.09	562.5	0	0	0	0	0	0	0	0	0	352.12	1468.4	646.62	566	0	483.01	16467	0	0	0	306.18	0	0	0	487.35	0	0	0	0	665.46	0	589.02	812.84	727.97	469.21	0	460.08
A0A9L0SVP3	A0A9L0SVP3_HORSE	DExH-box helicase 57	DHX57	Equus caballus (Horse)			ATP binding [GO:0005524]; helicase activity [GO:0004386]; metal ion binding [GO:0046872]	YGFNTER	0.90876	0.31821	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	354.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	844.6	0	0	0	0
A0A9L0SVP6	A0A9L0SVP6_HORSE	Leucine rich repeat containing 42	LRRC42	Equus caballus (Horse)				NRWEAGSNR	0.98755	-1.8641	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	461.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SVR1	A0A9L0SVR1_HORSE	HIV-1 Tat specific factor 1	HTATSF1	Equus caballus (Horse)			RNA binding [GO:0003723]	HPDGVASVSFR	0.36408	0.75003	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1020.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SVU2	A0A9L0SVU2_HORSE	WD repeat domain 73	WDR73	Equus caballus (Horse)				GVFVAGYESR	0.91328	0.31489	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	424.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SVU7	A0A9L0SVU7_HORSE	UPF1 RNA helicase and ATPase	UPF1	Equus caballus (Horse)	regulation of gene expression [GO:0010468]	cytoplasm [GO:0005737]	zinc ion binding [GO:0008270]	DFIILSCVR	0.97066	0.16454	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	926.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SVX5	A0A9L0SVX5_HORSE	Meiosis-specific nuclear structural protein 1	MNS1	Equus caballus (Horse)		axoneme [GO:0005930]; motile cilium [GO:0031514]; nucleus [GO:0005634]		KIENQIRDR	0.26351	0.90953	0	0	0	0	0	0	0	0	778.78	0	0	805.62	998.24	0	1005.3	0	0	0	0	0	0	0	0	0	0	0	0	0	1167.6	1193.4	1250.1	0	0	0	0	1006	635.32	1734.7	1584.7	958.66	893.11	957.09	820.29	710.3	773.56	777.49	880.61	1145.3	1260.4	1277.6	0	0	1232.4	0	0	0	0	1304.6	1310.7	1167.7	0	759.38	0	521.34	0	395.45	619.26	739.28	0	505.13	0	1801.8	437.65	0	467.46
A0A9L0SW42	A0A9L0SW42_HORSE	SH2 domain containing 6	SH2D6	Equus caballus (Horse)				AAVGYSR	0.96634	0.19184	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1012.3	1851.7	0	0	0	0	2593.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SW61	A0A9L0SW61_HORSE	PHD finger protein 20	PHF20	Equus caballus (Horse)		nucleus [GO:0005634]	metal ion binding [GO:0046872]	IVATHQLLGDVQR	0.98849	-1.205	530.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1096.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SW99	A0A9L0SW99_HORSE	Vesicle transport through interaction with t-SNAREs 1A	VTI1A	Equus caballus (Horse)	protein transport [GO:0015031]	cytoplasm [GO:0005737]; endomembrane system [GO:0012505]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]		GENKDEK	0.98135	-0.5493	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	280.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SWC7	A0A9L0SWC7_HORSE	Coiled-coil domain containing 170	CCDC170	Equus caballus (Horse)				FECAQSELR	0.97078	-0.065167	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	343.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SWD9	A0A9L0SWD9_HORSE	RLF zinc finger	RLF	Equus caballus (Horse)				APISFKTR	0.9879	-1.6076	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3551.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1585.5	0	0	0	0	0	0
A0A9L0SWH4	A0A9L0SWH4_HORSE	Biotinidase (EC 3.5.1.12)	BTD	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]	hydrolase activity [GO:0016787]	GEFPSLR	0.96702	-0.026768	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2655.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SWQ6	A0A9L0SWQ6_HORSE	Fibroblast growth factor receptor (EC 2.7.10.1)	FGFR4	Equus caballus (Horse)	phosphorylation [GO:0016310]	plasma membrane [GO:0005886]	ATP binding [GO:0005524]; protein tyrosine kinase activity [GO:0004713]	VTRVGPDSKR	0.96789	-0.17133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	456.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SWS0	A0A9L0SWS0_HORSE	Eukaryotic translation initiation factor 5B (Translation initiation factor IF-2)	EIF5B	Equus caballus (Horse)			GTP binding [GO:0005525]; translation initiation factor activity [GO:0003743]	PLYARILGEKGVR	0.91983	0.29326	0	0	0	0	0	0	0	0	0	0	0	2853.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SX05	A0A9L0SX05_HORSE	Peptidylprolyl isomerase like 6	PPIL6	Equus caballus (Horse)				ASGNPGK	0.95581	0.22429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	452.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SX18	A0A9L0SX18_HORSE	Zinc finger SWIM-type containing 8	ZSWIM8	Equus caballus (Horse)				TGPGGGK	0.98349	-0.89371	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	465.93	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SX22	A0A9L0SX22_HORSE	Valosin containing protein lysine methyltransferase	VCPKMT	Equus caballus (Horse)	methylation [GO:0032259]		methyltransferase activity [GO:0008168]	VTCAVPSRSHAR	0.98849	-1.8052	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1884.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SX24	A0A9L0SX24_HORSE	Phosphatidylinositol transfer protein membrane associated 2	PITPNM2	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		VPRLPDLDIR	0.98653	-1.9141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1453.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SX62	A0A9L0SX62_HORSE	Mitochondrial inner membrane protease subunit 2 (IMP2-like protein)	IMMP2L	Equus caballus (Horse)		membrane protein complex [GO:0098796]; mitochondrial inner membrane [GO:0005743]		NRYVKVPR	0.96716	-0.075309	0	0	0	0	0	0	0	0	0	0	0	2669.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1531.7	0	0	0	0	0	0	3049.5	3057.4	3039	0	0	0	0	0	1296.7	0	0	0	0	1604.9	0	0	0	0	0	0	1843.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SXC1	A0A9L0SXC1_HORSE	DNA topoisomerase I (EC 5.6.2.1) (DNA topoisomerase 1)	TOP1	Equus caballus (Horse)	DNA topological change [GO:0006265]	nucleus [GO:0005634]	"DNA binding [GO:0003677]; DNA topoisomerase type I (single strand cut, ATP-independent) activity [GO:0003917]"	KVPEPDSK	0.98148	-0.62399	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2676.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SXF9	A0A9L0SXF9_HORSE	Hexosyltransferase (EC 2.4.1.-)	B4GALNT3	Equus caballus (Horse)		Golgi cisterna membrane [GO:0032580]	hexosyltransferase activity [GO:0016758]	AVVHFIVPVK	0.972	0.04684	0	0	0	0	0	0	0	0	0	0	0	380.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	467.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	606.12	0	567.55	0	0	0	0	0	0
A0A9L0SXJ6	A0A9L0SXJ6_HORSE	Protein VAC14 homolog	VAC14	Equus caballus (Horse)		endosome membrane [GO:0010008]		QAEPLRR	0.98286	-0.71779	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	955.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SXM4	A0A9L0SXM4_HORSE	Mitochondrial transcription termination factor 3	MTERF3	Equus caballus (Horse)				MLTANKR	0.9854	-1.9577	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2282.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SXS2	A0A9L0SXS2_HORSE	L-lactate dehydrogenase (EC 1.1.1.27)	LDHAL6B	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	SVNAARASFLSPR	0.98667	-1.8399	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3929.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SXV5	A0A9L0SXV5_HORSE	Telomeric repeat-binding factor 2-interacting protein 1 (TERF2-interacting telomeric protein 1) (Repressor/activator protein 1 homolog)	TERF2IP	Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]; telomere maintenance via telomere lengthening [GO:0010833]	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]"		APVLVGRHR	0.97249	-0.1822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	511.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SXX1	A0A9L0SXX1_HORSE	Acyl-coenzyme A oxidase	ACOX3	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	ELNFLRCR	0.98525	-1.4747	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	666.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SXZ0	A0A9L0SXZ0_HORSE	Lebercilin-like protein (Leber congenital amaurosis 5-like protein)	LCA5L	Equus caballus (Horse)				DKQAAPNSKTSFR	0.98619	-2.5319	0	0	0	0	0	0	0	0	387.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	496.15	0	0	0	0	437.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SY12	A0A9L0SY12_HORSE	Suppressor of fused homolog	SUFU	Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]		EYSWPEKK	0.98686	-2.6002	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	626.85	0	0	0	0	0	420.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SY56	A0A9L0SY56_HORSE	Phosphatidylinositol transfer protein cytoplasmic 1	PITPNC1	Equus caballus (Horse)				LGTIIPTR	0.91588	0.30275	27440	0	0	0	0	0	1315.4	0	0	11798	0	0	0	0	0	0	0	0	0	0	0	0	0	11794	0	12805	0	0	0	145100	0	0	0	0	0	0	0	0	0	148130	0	0	0	0	0	0	141870	0	0	0	0	0	0	0	0	1631.3	0	0	0	0	0	0	0	2122.2	0	0	0	60664	0	0	0	0	0	0	0
A0A9L0SY91	A0A9L0SY91_HORSE	"Proteasome 26S subunit, non-ATPase 3"	PSMD3	Equus caballus (Horse)		proteasome complex [GO:0000502]		KAPQHTAVGFKQTVHK	0.89327	0.33351	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	452.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SYB3	A0A9L0SYB3_HORSE	Cytochrome b561 family member D2	CYB561D2	Equus caballus (Horse)				SGGARSK	0.98575	-0.86442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1077.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1767.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SYH6	A0A9L0SYH6_HORSE	FERM and PDZ domain containing 3	FRMPD3	Equus caballus (Horse)		membrane [GO:0016020]		HPSPCPLPACSQKMMKK	0.72414	0.57102	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	627.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SYR7	A0A9L0SYR7_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				EWNDIFKILK	0.99031	-1.2546	0	0	0	0	0	0	0	0	0	0	0	910.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SYS5	A0A9L0SYS5_HORSE	Calcium/calmodulin dependent protein kinase ID	CAMK1D	Equus caballus (Horse)				ATRLWKGR	0.96775	-0.045705	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3642.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SZ13	A0A9L0SZ13_HORSE	Integrator complex subunit 9	INTS9	Equus caballus (Horse)		nucleus [GO:0005634]		AEVLALPFK	0.96375	-0.1281	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2422.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SZ37	A0A9L0SZ37_HORSE	TELO2 interacting protein 1	TTI1	Equus caballus (Horse)				LDLGEGDLNK	0.96681	0.19279	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	489.11	0	0	0	0	0	0	0	0	0	0	0	346.98	0	0	0	0	417.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	546.43	0	0	0	0	0	0	0	0	2641.7	2549.9	0	0	0	0	0	0	0	0	0	0	473.83	348.59	0	0	0
A0A9L0SZH0	A0A9L0SZH0_HORSE	Phospholipid-transporting ATPase (EC 7.6.2.1)	NFATC1	Equus caballus (Horse)		membrane [GO:0016020]	ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]	LLQQRTGK	0.988	-1.7805	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3286.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SZJ7	A0A9L0SZJ7_HORSE	Coiled-coil domain containing 50	CCDC50	Equus caballus (Horse)				EAVSTPSRVTHR	0.88141	0.35617	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	535.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SZK2	A0A9L0SZK2_HORSE	Peptidase S1 domain-containing protein	LOC100053869	Equus caballus (Horse)	proteolysis [GO:0006508]		serine-type peptidase activity [GO:0008236]	MMKNILK	0.98816	-1.7901	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	544.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SZP9	A0A9L0SZP9_HORSE	Ankyrin repeat domain 9	ANKRD9	Equus caballus (Horse)				LPGRCPR	0.9883	-1.7146	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3219.3	0	0	0	0	0	0	0	0	0	0	1083.2	0	0	0	0	0	0	0	0	0	0	0	0	1572.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0SZY0	A0A9L0SZY0_HORSE	Arsenite methyltransferase (EC 2.1.1.137)	AS3MT	Equus caballus (Horse)				FVSATFR	0.95947	-0.019764	0	0	0	0	0	0	0	0	0	0	0	0	631.39	0	0	0	0	0	0	631.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2974.5	0	0	0	0	0	0	0	0	0	1754	0	0	0	0	614.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T083	A0A9L0T083_HORSE	Signal induced proliferation associated 1 like 1	SIPA1L1	Equus caballus (Horse)			GTPase activator activity [GO:0005096]	FPFISLASK	0.98421	-1.3029	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	558.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T0F9	A0A9L0T0F9_HORSE	Ankyrin repeat domain 40	ANKRD40	Equus caballus (Horse)				CISSRPGR	0.99057	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	429.04	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T0G0	A0A9L0T0G0_HORSE	Protein phosphatase 1 regulatory subunit	PPP1R12A	Equus caballus (Horse)		cytoplasm [GO:0005737]; stress fiber [GO:0001725]	phosphatase regulator activity [GO:0019208]	SLLEMEK	0.96838	0.033658	0	0	0	0	0	0	0	0	0	0	0	1003.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1213.2	1152.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1289.5	0	0	0	0
A0A9L0T0G7	A0A9L0T0G7_HORSE	Zinc finger and BTB domain containing 7A	ZBTB7A	Equus caballus (Horse)				VIQGAGK	0.98837	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T0R8	A0A9L0T0R8_HORSE	PHD finger protein 24	PHF24	Equus caballus (Horse)				MGVLMSK	0.98446	-0.69806	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	527.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T0U3	A0A9L0T0U3_HORSE	Janus kinase and microtubule interacting protein 1	JAKMIP1	Equus caballus (Horse)				TALLAEAR	0.99026	-1.1895	0	0	0	0	0	0	0	0	363.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T0V0	A0A9L0T0V0_HORSE	Beta-carotene oxygenase 1	BCO1	Equus caballus (Horse)	isoprenoid metabolic process [GO:0006720]		metal ion binding [GO:0046872]	LTSTTARALK	0.98792	-1.9022	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	774.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T0W2	A0A9L0T0W2_HORSE	Diacylglycerol lipase beta	DAGLB	Equus caballus (Horse)				IIHLEEEGTSGR	0.9706	-0.067373	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1097.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T0X2	A0A9L0T0X2_HORSE	AP complex mu/sigma subunit domain-containing protein		Equus caballus (Horse)	protein transport [GO:0015031]			ELKLVYKR	0.96645	-0.038323	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	398.33	491.1	365.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T0Z5	A0A9L0T0Z5_HORSE	Uncharacterized protein		Equus caballus (Horse)				TETLLLNIYK	0.96252	-0.1428	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	473.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T101	A0A9L0T101_HORSE	Filamin B	FLNB	Equus caballus (Horse)		intracellular non-membrane-bounded organelle [GO:0043232]	actin binding [GO:0003779]	GPKGLEELVKQK	0.97839	-0.40315	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	697.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T105	A0A9L0T105_HORSE	Terminal uridylyl transferase 7	TUT7 ISCA1	Equus caballus (Horse)				EDKEIQNK	0.98587	-1.1807	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	618.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T143	A0A9L0T143_HORSE	Lactotransferrin	LTF	Equus caballus (Horse)				CLENGAGDVAFVK	0	3.5641	0	0	0	0	0	0	794.85	764.02	724.21	0	580.36	0	1006.4	1047.1	1070.3	612.75	0	893.7	0	1139.3	939.9	0	0	0	0	0	0	744.01	959.49	914.79	763.92	716.16	848.35	714.68	826.3	703.65	0	676.39	0	719.28	0	0	0	0	0	848.34	0	1113.8	809.86	733.26	797.64	0	973.36	0	0	0	0	0	0	549.88	0	831.96	858.46	405.66	0	0	598.29	642.77	662.64	0	0	0	0	0	0
A0A9L0T169	A0A9L0T169_HORSE	Phosphodiesterase 11A	PDE11A	Equus caballus (Horse)			hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]	WSEQLKNLNGK	0.9725	0.20813	0	0	0	0	0	0	0	0	2311.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2888.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T179	A0A9L0T179_HORSE	Nuclear receptor binding SET domain protein 1	NSD1	Equus caballus (Horse)		nucleus [GO:0005634]	histone H3 methyltransferase activity [GO:0140938]; metal ion binding [GO:0046872]; protein-lysine N-methyltransferase activity [GO:0016279]	IPEKGSSFENR	0.98736	-1.192	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2184	2041.6	1940.6	0	0	0	0	0	0	0	0	0	0	0	510.71	0	0	0	0	0	0	0	0	0	0	0	0	1183.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T195	A0A9L0T195_HORSE	Estrogen receptor binding site associated antigen 9	EBAG9	Equus caballus (Horse)				DMTPTIRK	0.98374	-0.92681	0	689.56	0	0	0	0	0	581.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T1C5	A0A9L0T1C5_HORSE	[histone H3]-lysine(4) N-trimethyltransferase (EC 2.1.1.354)	SMYD3	Equus caballus (Horse)			metal ion binding [GO:0046872]	ALVPLRPGELLFR	0.98679	-1.3893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2213.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T1F9	A0A9L0T1F9_HORSE	Guanine nucleotide-binding protein G(o) subunit alpha	GNAO1	Equus caballus (Horse)	signal transduction [GO:0007165]		GTP binding [GO:0005525]	ALPATASLR	0.96653	-0.089582	0	2283.4	0	0	0	1704.8	0	0	0	2544.1	0	0	0	0	1601.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1527.7	0	0	0	0	0	0	0	0	0	0	1825.8	0	0	0	0	0	0	1414.1	0	0	0	0	0	0	0	0	0	0	0	0	0	2343.4
A0A9L0T1L3	A0A9L0T1L3_HORSE	Sodium/potassium-transporting ATPase subunit beta-3 (Sodium/potassium-dependent ATPase subunit beta-3)	ATP1B3	Equus caballus (Horse)		membrane [GO:0016020]		AGSFLRAR	0.97984	-0.44393	0	0	0	0	0	0	0	0	0	0	1272	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T1L5	A0A9L0T1L5_HORSE	Uncharacterized protein		Equus caballus (Horse)				LASPGSAAGRR	0.98321	-0.82442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	470.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T1L7	A0A9L0T1L7_HORSE	Caspase recruitment domain family member 8	LOC102148661	Equus caballus (Horse)		cytoplasm [GO:0005737]		ALPSPRAILVMK	0.98485	-2.124	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3265.3	0	0	0	0	0	0	0	0	0	0	0	0	2184.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T1R8	A0A9L0T1R8_HORSE	G protein-coupled receptor 12	GPR12	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	VNLSGLPR	0.97169	0.1232	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2608.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T221	A0A9L0T221_HORSE	TEA domain transcription factor 2	TEAD2	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	RKIILSDEGK	0.92616	0.28668	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	446.46	0	0	0	0	0	0	0	0
A0A9L0T252	A0A9L0T252_HORSE	Uncharacterized protein		Equus caballus (Horse)				LASHNWK	0.9616	-0.0071589	0	0	0	0	0	0	0	0	1305.7	0	0	0	0	1078.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2298.7	2107.4	0	0	0	0	0	0	0	976.94	0	0	0	0	0	0	1075.3	0	0	0	0	0	0	0	0	0	0	1256.2	1572.7	0	0	0	0	0	0	0	0	0	1149.5	0	0	0	0	0	0
A0A9L0T2C0	A0A9L0T2C0_HORSE	LIM domain only 1	LMO1	Equus caballus (Horse)			metal ion binding [GO:0046872]	LSVQPKGK	0.98771	-1.5442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3337.2	0
A0A9L0T2D1	A0A9L0T2D1_HORSE	CYFIP related Rac1 interactor B	CYRIB	Equus caballus (Horse)		membrane [GO:0016020]		YLNMGNLLK	0.96849	-0.097568	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	287.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T2D9	A0A9L0T2D9_HORSE	Protein phosphatase 4 regulatory subunit 3B	PPP4R3B	Equus caballus (Horse)				MGRSRHR	0.96866	-0.072068	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	707.29	0	770.06	0	0	0	1416.6	0	0
A0A9L0T2E7	A0A9L0T2E7_HORSE	"Zyg-11 family member B, cell cycle regulator"	ZYG11B	Equus caballus (Horse)				TKPEILK	0.97332	-0.19082	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	320.29	0	0	0
A0A9L0T2I6	A0A9L0T2I6_HORSE	Carbonic anhydrase (EC 4.2.1.1)	CA9	Equus caballus (Horse)		membrane [GO:0016020]	carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]	GPGESGR	0.98925	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	438.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T2K6	A0A9L0T2K6_HORSE	Laminin subunit gamma 1	LAMC1	Equus caballus (Horse)		basement membrane [GO:0005604]; extracellular region [GO:0005576]		ANRGFIR	0.98835	-1.8039	0	0	0	0	0	0	0	763.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T2V9	A0A9L0T2V9_HORSE	Aldehyde dehydrogenase	ALDH3B1	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	FDYIFFTGSPR	0.96337	-0.13657	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1273.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T315	A0A9L0T315_HORSE	HPS4 biosis of lysosomal organelles complex 3 subunit 2	HPS4	Equus caballus (Horse)				ASALKEGATR	0.98779	-1.9022	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1394.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T318	A0A9L0T318_HORSE	Insulin like growth factor 2 receptor	IGF2R	Equus caballus (Horse)		membrane [GO:0016020]		APGYTWEAVDIK	0.97913	-0.30073	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	600.6	0	0	0	0	0	0	0
A0A9L0T335	A0A9L0T335_HORSE	Phosphorylated CTD interacting factor 1	PCIF1	Equus caballus (Horse)				LVYCYPVR	0.86338	0.48412	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	625.07	0	0	0	0	0	0	0	0	0	462.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T372	A0A9L0T372_HORSE	Large ribosomal subunit protein eL38 (60S ribosomal protein L38)	RPL38	Equus caballus (Horse)		ribonucleoprotein complex [GO:1990904]; ribosome [GO:0005840]		DFLLTARRK	0.9727	-0.19587	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3049.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T378	A0A9L0T378_HORSE	Prickle planar cell polarity protein 2	PRICKLE2	Equus caballus (Horse)			metal ion binding [GO:0046872]	SSSLAMK	0.96854	-0.044576	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2690.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T383	A0A9L0T383_HORSE	Fucose kinase	FCSK	Equus caballus (Horse)	organic substance metabolic process [GO:0071704]; primary metabolic process [GO:0044238]		"ATP binding [GO:0005524]; kinase activity [GO:0016301]; phosphotransferase activity, alcohol group as acceptor [GO:0016773]"	MLLLSGSPSALAR	0.40678	0.69402	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1049.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T386	A0A9L0T386_HORSE	2'-5' oligoadenylate synthase (EC 2.7.7.84)	OAS1	Equus caballus (Horse)	defense response to virus [GO:0051607]; innate immune response [GO:0045087]	cytoplasm [GO:0005737]		LPAAWGLLLAR	0.96786	-0.047082	0	0	0	0	0	0	0	0	0	0	0	464.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	577.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T390	A0A9L0T390_HORSE	Pre-mRNA processing factor 38B	PRPF38B STXBP3	Equus caballus (Horse)	protein transport [GO:0015031]			DRSAEETFQLSRWTPFIK	0.98466	-1.3072	0	0	0	0	13992	0	14136	0	0	0	0	0	0	714.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1140.3	0	825.95	0	0	0	0	0	0
A0A9L0T3B4	A0A9L0T3B4_HORSE	Uveal autoantigen with coiled-coil domains and ankyrin repeats	UACA	Equus caballus (Horse)				LKLQNELAHK	0.98701	-1.9063	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	711.3	0	1325	1431.6	0	1522.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T3F9	A0A9L0T3F9_HORSE	Elongation factor like GTPase 1	EFL1	Equus caballus (Horse)				MAKKFTINPK	0.97474	-0.19895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	506.99	503.47	511.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T3G8	A0A9L0T3G8_HORSE	LisH domain-containing protein ARMC9	ARMC9	Equus caballus (Horse)	cell projection organization [GO:0030030]	centriole [GO:0005814]; cilium [GO:0005929]; cytoplasm [GO:0005737]		LTTSHPGEQR	0.96736	-0.048612	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	579.82	571.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	553.52	0	0	0
A0A9L0T3T2	A0A9L0T3T2_HORSE	Tudor and KH domain containing	TDRKH	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]	RNA binding [GO:0003723]	KGGGDMAVVGPK	0.98321	-0.71031	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	405.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T3T6	A0A9L0T3T6_HORSE	"Papilin, proteoglycan like sulfated glycoprotein"	PAPLN	Equus caballus (Horse)				TSYLYQPR	0.33679	0.78209	0	0	0	0	0	0	635.72	634.45	697.57	0	0	0	0	529.5	501.31	1357.9	907.92	832.33	0	679.87	0	0	0	0	0	0	0	0	0	0	526.51	638.59	0	0	1272.3	0	0	706.83	652.28	1053.3	887.65	795.25	0	0	0	1432.1	882.67	1052.3	0	927.2	0	0	0	511.4	0	0	0	0	992.95	1080.5	0	0	856.84	0	0	0	987.31	981.08	984.39	0	0	0	0	0	0
A0A9L0T413	A0A9L0T413_HORSE	Engulfment and cell motility 1	ELMO1	Equus caballus (Horse)	apoptotic process [GO:0006915]; phagocytosis [GO:0006909]	cytoplasm [GO:0005737]	SH3 domain binding [GO:0017124]	GALKQNK	0.98664	-1.0082	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	630.24	0	0	0	1130.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T4F9	A0A9L0T4F9_HORSE	Ubiquitin conjugating enzyme E2 T	UBE2T	Equus caballus (Horse)			ATP binding [GO:0005524]; transferase activity [GO:0016740]	ICLDVLKLPPK	0.98654	-1.9173	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1383.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T4G4	A0A9L0T4G4_HORSE	Translocation associated membrane protein 2	TRAM2	Equus caballus (Horse)	protein transport [GO:0015031]	membrane [GO:0016020]		GVCGGRR	0.98786	-1.5534	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2471.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1113.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	435.3	0	0	0	0
A0A9L0T4K5	A0A9L0T4K5_HORSE	Protein tyrosine phosphatase receptor type E	PTPRE	Equus caballus (Horse)				IMKENMR	0.68235	0.60374	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	545.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T4K9	A0A9L0T4K9_HORSE	F-box and leucine rich repeat protein 17	FBXL17	Equus caballus (Horse)				METTGARAGR	0.98805	-1.8994	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	846.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T4M3	A0A9L0T4M3_HORSE	Zinc finger protein 35	ZNF35	Equus caballus (Horse)				NPSYQEESR	0.96675	-0.10349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3543.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T4M7	A0A9L0T4M7_HORSE	Cyclin P	CCNP	Equus caballus (Horse)				AAIFLKYARPQRR	0.91832	0.29326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	368.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T4R6	A0A9L0T4R6_HORSE	Scavenger receptor class B member 2	SCARB2	Equus caballus (Horse)		membrane [GO:0016020]		IVEWNGK	0.97407	0.055142	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1953.7	2331	2547.4	0	0	0	0	2776	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T4S0	A0A9L0T4S0_HORSE	Phosphodiesterase 7A	PDE7A	Equus caballus (Horse)				SRAGFESERR	0.7773	0.5097	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	519.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T4T6	A0A9L0T4T6_HORSE	Eukaryotic translation initiation factor 3 subunit I (eIF3i) (Eukaryotic translation initiation factor 3 subunit 2) (eIF-3-beta) (eIF3 p36)	EIF3I EIF3S2	Equus caballus (Horse)	formation of cytoplasmic translation initiation complex [GO:0001732]	eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]	translation initiation factor activity [GO:0003743]	QKEQHMQR	0.98813	-1.2742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	484.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T507	A0A9L0T507_HORSE	Myelin transcription factor 1 like	MYT1L	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	SASGCPLAAK	0.92136	0.29352	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	702.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T5A3	A0A9L0T5A3_HORSE	Zinc finger protein 782	LOC100062166	Equus caballus (Horse)			metal ion binding [GO:0046872]	TFLWKSILR	0.98605	-1.4503	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3057.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	782.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	614.59	0	0	0
A0A9L0T5A6	A0A9L0T5A6_HORSE	Pyridoxal kinase (EC 2.7.1.35) (Pyridoxine kinase)	PDXK	Equus caballus (Horse)	vitamin B6 metabolic process [GO:0042816]			VPSGAEVRGR	0.98857	-1.8982	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	735.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T5C3	A0A9L0T5C3_HORSE	Heat shock protein family A (Hsp70) member 14	HSPA14	Equus caballus (Horse)				MQQEGFR	0.9664	-0.026768	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	475.04	0	0	0
A0A9L0T5E1	A0A9L0T5E1_HORSE	Dynein 2 intermediate chain 1	DYNC2I1	Equus caballus (Horse)				AERKVPAVSK	0.92857	0.25706	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2271.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T5I0	A0A9L0T5I0_HORSE	Cilia and flagella associated protein 54	CFAP54	Equus caballus (Horse)				IGHTVAK	0.97971	-0.48078	0	458.89	0	0	0	0	755.42	0	0	0	0	1330.4	0	0	0	0	0	0	0	0	887.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1433.2	1170.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1702.5	1239.3	0	0	0	0	0	0	0	0	1413.5	1541.8	0	0	0	2238.9	1333.5	0	0	0	0	2266.4
A0A9L0T5J3	A0A9L0T5J3_HORSE	Potassium channel tetramerization domain containing 6	KCTD6	Equus caballus (Horse)				VHHMSER	0.97007	-0.031343	0	0	0	0	0	0	0	0	0	0	0	0	511.52	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T5L2	A0A9L0T5L2_HORSE	"beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminide alpha-2,3-sialyltransferase (EC 2.4.3.2) (Monosialoganglioside sialyltransferase)"	ST3GAL1	Equus caballus (Horse)		Golgi apparatus [GO:0005794]; membrane [GO:0016020]	glycosyltransferase activity [GO:0016757]	VVPGNVDPLLGK	0.96271	-0.13292	480.74	0	497.76	951.7	1073.5	1189.6	1155.6	0	0	0	0	0	0	584.24	578.36	0	0	0	0	0	1594.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1272	0	0	0	0	949.99	0	962.42	0	0	0	0	0	696.69	0	0	1544.8	1121.4	0	0	0	0	0	0	0	1336.8	0	0	0	1166.9	0	1069.5	0	0	0	0	1725.1	0
A0A9L0T5N2	A0A9L0T5N2_HORSE	Zinc finger protein 709-like	LOC106783425	Equus caballus (Horse)			metal ion binding [GO:0046872]	GQILAQLGK	0.96385	-0.021745	0	0	0	772.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	585.72	0	616.99	0	0	0	0	0	0	0	0	0	0	0	0	802.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1429.6	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T5P7	A0A9L0T5P7_HORSE	Cubilin	CUBN	Equus caballus (Horse)				LQSLQQTVDRK	0.89719	0.33637	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	933.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3560.9	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T609	A0A9L0T609_HORSE	Caspase recruitment domain family member 9	CARD9	Equus caballus (Horse)				SLQEKDGLR	0.98357	-0.92821	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	452.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T6Y8	A0A9L0T6Y8_HORSE	TBC1 domain family member 25	TBC1D25	Equus caballus (Horse)				EFAFDDALR	0.98764	-1.7281	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2498.5	0	3974.1	0	0	0	0	5993.4	4934.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T749	A0A9L0T749_HORSE	Spalt like transcription factor 4	SALL4	Equus caballus (Horse)				SPDAGGK	0.94987	0.24043	0	0	845.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	467.84	0	0	0	0	1569.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T7A0	A0A9L0T7A0_HORSE	Transmembrane and coiled-coil domain family 1	TMCC1	Equus caballus (Horse)				TLQTFLW	0.97047	0.034786	0	0	0	0	0	0	0	0	0	0	0	0	615.03	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T7A1	A0A9L0T7A1_HORSE	RUNX family transcription factor 1	RUNX1	Equus caballus (Horse)		nucleus [GO:0005634]		LSELEQLRRTAMR	0.25362	0.9415	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	449.28	481.18	431.62	467.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	623.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	386.99	402.06	0
A0A9L0T7A2	A0A9L0T7A2_HORSE	Major facilitator superfamily domain containing 13A	MFSD13A	Equus caballus (Horse)		membrane [GO:0016020]		LGTGLSSRAVVLAR	0.96448	-0.024243	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	698.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T7I7	A0A9L0T7I7_HORSE	Iodothyronine deiodinase	DIO2	Equus caballus (Horse)	hormone biosynthetic process [GO:0042446]		oxidoreductase activity [GO:0016491]	GNGAQGK	0.92956	0.26262	0	922.38	0	889.89	0	840.75	0	0	0	927.46	678.84	0	0	0	0	0	0	0	0	0	675.12	2091	0	0	1062.9	1128.1	1102.1	0	0	0	0	0	0	0	0	0	815.64	0	0	0	0	0	967.77	966.49	924.03	0	0	0	0	634.42	666.1	0	991.41	1102	0	0	0	0	0	0	971.47	665.66	0	0	0	0	797.08	763.53	727.2	0	0	0	0	0	0
A0A9L0T7M3	A0A9L0T7M3_HORSE	Zinc finger protein 829	ZNF829	Equus caballus (Horse)			metal ion binding [GO:0046872]	TINEKKPYECKICGK	0.88809	0.36291	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1277.1	0	0	0	0	0	0	0	0	0	0	0	0	1093.7	0	0	0	0	0	0	1091.5	0	0	0	0	0	0	758.42	755.81	0	0	0	0	0	782.89	0
A0A9L0T7R8	A0A9L0T7R8_HORSE	"ERCC excision repair 6, chromatin remodeling factor"	ERCC6	Equus caballus (Horse)			ATP binding [GO:0005524]	DAKFEGTR	0.9884	-1.5344	828.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T827	A0A9L0T827_HORSE	Cilia and flagella associated protein 99	CFAP99	Equus caballus (Horse)				KEETAELMQQYAERR	0.65986	0.63553	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	726.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T849	A0A9L0T849_HORSE	IQ motif containing with AAA domain 1	IQCA1	Equus caballus (Horse)				ELPAKTGKK	0.98524	-1.4655	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	344.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1215.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T886	A0A9L0T886_HORSE	Coiled-coil domain containing 183	CCDC183 RABL6	Equus caballus (Horse)				ITFEGLEEDMIVK	0.97961	-0.34152	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	801.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T895	A0A9L0T895_HORSE	Zinc finger protein 283	ZNF283	Equus caballus (Horse)				TVASSSPKNR	0.93256	0.27766	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1414.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	237.32	0	0	0	0	0	1580.6	0	0	0	0	0
A0A9L0T8D5	A0A9L0T8D5_HORSE	Uncharacterized protein		Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		RRALEETK	0.96054	-0.0022997	0	0	0	0	0	0	0	0	0	0	364.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T8J0	A0A9L0T8J0_HORSE	Mitochondrial import inner membrane translocase subunit Tim21	TIMM21	Equus caballus (Horse)	protein import into mitochondrial matrix [GO:0030150]	TIM23 mitochondrial import inner membrane translocase complex [GO:0005744]		IYGKALEKCR	0.87652	0.39604	794.02	967.12	701.6	850.14	400.57	383.13	0	3626.9	3574.9	1240.3	3809.2	3971.4	6134.1	6663.6	6705.4	10134	10987	10234	536.91	2796.8	2633	930.19	1052	1315.4	959.24	1064.1	1112.5	10385	9594.6	9342.6	11185	10828	10586	6464	6984.4	4095.9	3282.2	10204	9766	5908	4898.6	5290.9	4567.1	4344.6	4183.3	6809	5968.3	6087	7024	6443.2	6577.9	2027.6	6638.6	5194.9	1471.5	1611.1	1642.5	9467.7	9693	9859.3	1958.1	2826.4	0	2536.4	2431.6	2290.2	4715.6	4628.4	4570.7	2845.2	7041.1	5855.8	3366.3	2976.6	3062.8
A0A9L0T8J6	A0A9L0T8J6_HORSE	receptor protein-tyrosine kinase (EC 2.7.10.1)	TEK	Equus caballus (Horse)	cell differentiation [GO:0030154]; circulatory system development [GO:0072359]	membrane [GO:0016020]	ATP binding [GO:0005524]; protein tyrosine kinase activity [GO:0004713]	MKTYVKPKFEK	0.9728	-0.20237	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	805.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T8J8	A0A9L0T8J8_HORSE	Polypeptide N-acetylgalactosaminyltransferase like 6	GALNTL6	Equus caballus (Horse)		membrane [GO:0016020]		TALTFKKSSVLPISR	0.91219	0.30087	0	0	0	0	0	0	0	0	0	0	1274.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1466.5	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T8N0	A0A9L0T8N0_HORSE	FA core complex associated protein 20	FAAP20	Equus caballus (Horse)				ACAGSGGLR	0.97005	0.15031	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	392.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T8N9	A0A9L0T8N9_HORSE	D-dopachrome decarboxylase (EC 4.1.1.84)	DDT	Equus caballus (Horse)				NKFLPLQK	0.98806	-1.734	0	0	0	0	2196.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4934.2	0	0	0	0	0	0	0	0	0	0	2422.9	2498.2	0	0	0	0	0	0	0	1224.6	0	0	0	1526.6	0	0	1874.7	0	0	0	0	0	0	0	0	2648.6	0	0	0
A0A9L0T8R5	A0A9L0T8R5_HORSE	Nucleoprotein TPR	TPR	Equus caballus (Horse)		nuclear periphery [GO:0034399]; nuclear pore [GO:0005643]		AESQLLECK	0.98513	-1.3207	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2282.1	0	991.34	0	0	0	0	0	0	941.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1040.1	0	1036.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T8S9	A0A9L0T8S9_HORSE	UPF2 regulator of nonsense mediated mRNA decay	UPF2	Equus caballus (Horse)		cytoplasm [GO:0005737]		LLYKDLSKVTTEK	0.65529	0.63843	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1530.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T936	A0A9L0T936_HORSE	Inositol polyphosphate-4-phosphatase type II B	INPP4B	Equus caballus (Horse)				EQLLALSLR	0.91871	0.30798	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1918.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T956	A0A9L0T956_HORSE	APC regulator of WNT signaling pathway 2	APC2	Equus caballus (Horse)	cellular component organization [GO:0016043]; Wnt signaling pathway [GO:0016055]	cell periphery [GO:0071944]; cytoplasm [GO:0005737]; intracellular membrane-bounded organelle [GO:0043231]; microtubule [GO:0005874]		AEGQAGSGVRPEKR	0.98686	-2.6268	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1942.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1561.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T960	A0A9L0T960_HORSE	NOP14 nucleolar protein	NOP14	Equus caballus (Horse)	ribosome biogenesis [GO:0042254]	nucleolus [GO:0005730]		APGIPVGARGGR	0.99214	-1.2218	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1229.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T979	A0A9L0T979_HORSE	Ras association domain family member 7	RASSF7	Equus caballus (Horse)				GRGGAGHR	0.98871	-1.711	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3471.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T989	A0A9L0T989_HORSE	WWC family member 3	WWC3	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		AICTGEKERR	0.9663	-0.15441	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6215.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T9L6	A0A9L0T9L6_HORSE	Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH/PTHrP type I receptor) (Parathyroid hormone 1 receptor)	PTH1R	Equus caballus (Horse)		plasma membrane [GO:0005886]		FLTNETR	0.97028	0.027053	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	840.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0T9X1	A0A9L0T9X1_HORSE	Uncharacterized protein		Equus caballus (Horse)				LVQPLWKTV	0.76471	0.52353	0	0	0	0	0	0	0	421.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TA52	A0A9L0TA52_HORSE	Olfactory receptor	OR1J43	Equus caballus (Horse)	sensory perception of smell [GO:0007608]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	VPSTKRICK	0.97257	0.044431	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	645.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TAA6	A0A9L0TAA6_HORSE	Neuropeptide S receptor 1	NPSR1	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	YHAIVYPMK	0.96735	-0.072935	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1167.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TAM3	A0A9L0TAM3_HORSE	Outer dense fiber of sperm tails 2 like	ODF2L	Equus caballus (Horse)		centrosome [GO:0005813]; cytoplasm [GO:0005737]		ILDLETELRKK	0.9797	-0.46885	0	0	0	0	0	0	0	0	0	474.44	0	602.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	744.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TAP3	A0A9L0TAP3_HORSE	FAM161 centrosomal protein B	FAM161B	Equus caballus (Horse)				IQMRALDMLQK	0.98607	-1.2783	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	375.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TAQ6	A0A9L0TAQ6_HORSE	Cullin-associated NEDD8-dissociated protein 1 (Cullin-associated and neddylation-dissociated protein 1)	CAND1	Equus caballus (Horse)				HTVDDGLDIR	0.86898	0.40152	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	744.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TAR6	A0A9L0TAR6_HORSE	Palmitoyltransferase (EC 2.3.1.225)	ZDHHC22	Equus caballus (Horse)		membrane [GO:0016020]	acyltransferase activity [GO:0016746]	LGPTRTPLPR	0.987	-1.856	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	569.92	0	0	0	0	0	0	0
A0A9L0TAV1	A0A9L0TAV1_HORSE	Essential meiotic structure-specific endonuclease 1	EME1	Equus caballus (Horse)			hydrolase activity [GO:0016787]	RTKHSQK	0.95546	0.22755	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	346.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TAW6	A0A9L0TAW6_HORSE	Uncharacterized protein		Equus caballus (Horse)				IKQPNYKMGR	0.97232	0.042375	0	0	0	0	0	0	0	0	0	0	480.79	0	0	688.76	0	1752.9	0	0	0	0	512.03	0	0	0	0	0	0	957.61	0	0	0	0	0	0	0	0	1211.8	0	1587.1	0	1908.1	0	664.73	720.93	0	1222.9	0	0	0	670.05	0	0	1201.1	720.34	754.08	0	683.67	1556.3	0	0	0	909.32	914.31	995.47	806.68	638.96	0	1011	0	0	0	0	0	728.88	994.55
A0A9L0TAY5	A0A9L0TAY5_HORSE	Semaphorin-3C	SEMA3C	Equus caballus (Horse)	nervous system development [GO:0007399]	extracellular region [GO:0005576]		QTVAKINLK	0.98513	-2.2122	0	0	0	0	0	0	642.29	0	574.97	0	0	0	0	0	0	0	0	0	0	0	553.71	0	0	0	0	0	0	1225.9	1050	0	0	0	0	0	0	0	0	0	0	0	0	551.02	0	0	0	0	973.5	0	0	0	699.47	0	0	458.36	0	363.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	617.05	0	0	0
A0A9L0TAZ6	A0A9L0TAZ6_HORSE	DNA replication licensing factor MCM6 (EC 3.6.4.12)	MCM6	Equus caballus (Horse)	cell cycle [GO:0007049]; DNA replication initiation [GO:0006270]	chromosome [GO:0005694]; MCM complex [GO:0042555]; nucleus [GO:0005634]	ATP binding [GO:0005524]; DNA binding [GO:0003677]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]	GSIPRSLEVILR	0.98729	-3.9893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2086.7	0	0	0	0	0	0	0	0	0	0	0	0	0	515.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TB21	A0A9L0TB21_HORSE	Formiminotransferase N-terminal subdomain domain-containing protein	LOC100070852	Equus caballus (Horse)				GGKDPGP	0.67705	0.59401	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	551.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TB23	A0A9L0TB23_HORSE	Kelch like family member 31	KLHL31	Equus caballus (Horse)				TPLEVAR	0.9879	-1.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1010.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TB61	A0A9L0TB61_HORSE	Tigger transposable element derived 7	TIGD7	Equus caballus (Horse)				DICLPGRKINK	0.99057	-1.6549	0	0	0	0	0	0	0	0	0	0	0	439.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	750.92	0	0	334.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TB71	A0A9L0TB71_HORSE	BTG anti-proliferation factor 2	BTG2	Equus caballus (Horse)				AAASGFR	0.96254	0.21674	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	501.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TB72	A0A9L0TB72_HORSE	Gamma-tubulin complex component	TUBGCP2	Equus caballus (Horse)		centrosome [GO:0005813]; cytosol [GO:0005829]; microtubule [GO:0005874]		ISMQELEELRK	0.98785	-1.8784	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	664.29	0	0	0	0	0	0	0
A0A9L0TBA1	A0A9L0TBA1_HORSE	Thioredoxin domain containing 16	TXNDC16	Equus caballus (Horse)				KELTETLRIK	0.76586	0.51349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	505.79	1544.1	0	0	424.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TBB7	A0A9L0TBB7_HORSE	"SEC22 homolog C, vesicle trafficking protein"	SEC22C	Equus caballus (Horse)				MSMILFACVVRVR	0.93309	0.26516	0	0	0	0	0	0	0	0	0	402.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TBH6	A0A9L0TBH6_HORSE	"Macrophage erythroblast attacher, E3 ubiquitin ligase"	MAEA	Equus caballus (Horse)		cytoplasm [GO:0005737]	metal ion binding [GO:0046872]; transferase activity [GO:0016740]	VPYETLNKR	0.98315	-0.80966	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	517.42	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TBI9	A0A9L0TBI9_HORSE	"Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1"	GBGT1	Equus caballus (Horse)		membrane [GO:0016020]	glycosyltransferase activity [GO:0016757]	LQYKGEK	0.98848	-1.8029	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	636.43	0	0	0	0	0	0	0
A0A9L0TBL2	A0A9L0TBL2_HORSE	Receptor expression-enhancing protein	REEP5	Equus caballus (Horse)		membrane [GO:0016020]		WGTLGPK	0.97786	0.066131	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1150.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TBQ5	A0A9L0TBQ5_HORSE	Isopropylmalate dehydrogenase-like domain-containing protein	LOC102148971	Equus caballus (Horse)	tricarboxylic acid cycle [GO:0006099]	mitochondrion [GO:0005739]		HKNVDILVVR	0.97928	-0.45371	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1714.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2813.5	0	0	0
A0A9L0TBR7	A0A9L0TBR7_HORSE	DNA polymerase eta	POLH	Equus caballus (Horse)	DNA biosynthetic process [GO:0071897]; DNA repair [GO:0006281]	nucleus [GO:0005634]		ADLTKYR	0.98278	-0.8997	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	286.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TBU2	A0A9L0TBU2_HORSE	Zinc finger protein 709-like	LOC100064925	Equus caballus (Horse)			metal ion binding [GO:0046872]	LRSHMVER	0.98802	-1.5903	0	0	0	0	0	0	0	0	0	0	0	0	879.95	0	0	3633	0	3285.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TC19	A0A9L0TC19_HORSE	Endoribonuclease Dicer (EC 3.1.26.3)	DICER1	Equus caballus (Horse)	cellular component organization [GO:0016043]; pre-miRNA processing [GO:0031054]		ATP binding [GO:0005524]; endonuclease activity [GO:0004519]; helicase activity [GO:0004386]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]	ETPFVFK	0.98436	-0.8799	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2875.7	0	0	0	0	790.44	664.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	766.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TC79	A0A9L0TC79_HORSE	Desmoplakin	DSP	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		IEVLEEELR	0.075	1.5312	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	538.19	812.42	0	0	0	0	0	0	308.04	0	0	0	0	0	499.26	514.97	0	304.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	814.45	887.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TC96	A0A9L0TC96_HORSE	Envoplakin	EVPL	Equus caballus (Horse)				HPQAEEIEK	0.98618	-2.519	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	640.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2581.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TCB4	A0A9L0TCB4_HORSE	"ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6"	ST6GALNAC6	Equus caballus (Horse)		Golgi apparatus [GO:0005794]; membrane [GO:0016020]	glycosyltransferase activity [GO:0016757]	RSADPGPR	0.98266	-0.71406	860.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TCD2	A0A9L0TCD2_HORSE	Synaptonemal complex protein 1	SYCP1	Equus caballus (Horse)				LELELEGAK	0.97246	0.14713	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	929.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TCH5	A0A9L0TCH5_HORSE	"Spliceosome associated factor 1, recruiter of U4/U6.U5 tri-snRNP"	SART1	Equus caballus (Horse)	mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	nucleus [GO:0005634]		CSHFASSGLGGGRAR	0.98804	-1.6072	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1286.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TCI7	A0A9L0TCI7_HORSE	Endoplasmic reticulum-Golgi intermediate compartment protein	ERGIC2	Equus caballus (Horse)	"endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum [GO:0006890]"	COPII-coated ER to Golgi transport vesicle [GO:0030134]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; Golgi membrane [GO:0000139]		KKTLNLVK	0.96631	-0.1064	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	965.38	0	0	0	0	0	0	0	873.02	0	0
A0A9L0TCL8	A0A9L0TCL8_HORSE	RNA binding motif protein 43	RBM43	Equus caballus (Horse)			RNA binding [GO:0003723]	EVMKLLRQR	0.96794	-0.15866	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	412.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	348.28	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TCN7	A0A9L0TCN7_HORSE	AT-hook DNA binding motif containing 1	AHDC1	Equus caballus (Horse)		nucleus [GO:0005634]		AGGFGGR	0.87037	0.46138	0	1204.4	1168.2	0	906.91	898.44	2041.1	1771.6	1850.5	1347.9	2361.6	1937.2	0	0	1234.4	0	0	601.53	0	0	0	1098.8	1015.6	1129.3	960.19	957	0	0	0	0	2399.1	2045.8	2228.2	770.33	0	0	1344.4	0	0	0	0	0	0	0	0	300.62	0	0	0	0	0	0	0	1038.1	907.68	0	0	0	0	0	869.48	1573.1	405.55	853.17	0	807.31	0	876.99	930.66	2176.2	2477.5	2402	0	1647	0
A0A9L0TCR3	A0A9L0TCR3_HORSE	Lecithin retinol acyltransferase	LRAT	Equus caballus (Horse)				LLLGVICR	0.96315	-0.0062983	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3308.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TCT9	A0A9L0TCT9_HORSE	Uncharacterized protein		Equus caballus (Horse)				GLGARRGR	0.93729	0.25019	0	0	0	0	0	0	48030	0	0	0	31349	29028	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	77499	0	0	0	0	0	0	0	0	0	0	68641	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30581	0	0	0	0	0	0	14915
A0A9L0TCZ2	A0A9L0TCZ2_HORSE	Ski oncogene (Proto-oncogene c-Ski)	SKI	Equus caballus (Horse)		cellular anatomical entity [GO:0110165]		EAREHLEK	0.98857	-1.581	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2411	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2568.1	0	0	0	0	0	0	0	0	0	0	0	330.23	0	0	0	0	0	0	0	0	2490.1	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TD54	A0A9L0TD54_HORSE	Ubiquitin specific peptidase 8	USP8	Equus caballus (Horse)				IHFIFLYG	0.98567	-1.3102	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	803.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TD72	A0A9L0TD72_HORSE	AHNAK nucleoprotein	AHNAK	Equus caballus (Horse)				FKMPKIHMSGPK	0.98741	-3.942	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1267.1	9183.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1329.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TD75	A0A9L0TD75_HORSE	Zinc finger protein 268	ZNF268	Equus caballus (Horse)			metal ion binding [GO:0046872]	ESFLRSEHEQTVIGIK	0.89593	0.32811	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	518.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TD89	A0A9L0TD89_HORSE	Inhibitory synaptic factor 1	INSYN1	Equus caballus (Horse)				FNYCFPHR	0.97677	0.073769	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	888.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TDN0	A0A9L0TDN0_HORSE	Chromosome 8 C22orf15 homolog	C8H22orf15	Equus caballus (Horse)				VGSLPPR	0.97098	0.027225	0	0	0	0	0	0	0	0	0	0	667.6	613.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	644.37	562.15	529.34	0	0	0	0	0	0	0	653.6	628.48	0	0	0	0	0	0	0	816.84	800.27	0	0	0	664.74	626.85	712.94	0	0	0	0	0	0
A0A9L0TDQ8	A0A9L0TDQ8_HORSE	Spindle and centriole-associated protein 1 (Coiled-coil domain-containing protein 52)	SPICE1	Equus caballus (Horse)	cell cycle [GO:0007049]; cell division [GO:0051301]	centriole [GO:0005814]; cytoplasm [GO:0005737]; spindle [GO:0005819]		LTRYLKEAR	0.98635	-1.3786	0	0	0	404.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	640.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	604.53	0	0	0	0	562.39	639.44
A0A9L0TE11	A0A9L0TE11_HORSE	Large 60S subunit nuclear export GTPase 1	LSG1	Equus caballus (Horse)			nucleotide binding [GO:0000166]	FVHPEAR	0.96712	-0.027742	0	0	0	0	0	0	0	1326.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1187.7	0	0	0	0	0	0	0	0	0	2250.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	918.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TE26	A0A9L0TE26_HORSE	ubiquitinyl hydrolase 1 (EC 3.4.19.12)	OTUD3	Equus caballus (Horse)				GVGPGSR	0.94864	0.23726	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	774.31	605.96	0
A0A9L0TE60	A0A9L0TE60_HORSE	Ubiquitin-conjugating enzyme E2 variant 1	UBE2V1	Equus caballus (Horse)				LCFEVFR	0.96923	0.028538	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	245.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TE67	A0A9L0TE67_HORSE	Ornithine aminotransferase (EC 2.6.1.13)	OAT	Equus caballus (Horse)			transaminase activity [GO:0008483]	SLTLNACSSLWTGIYVWDVEGR	0.89314	0.42018	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	746.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TED0	A0A9L0TED0_HORSE	Sperm associated antigen 17	SPAG17	Equus caballus (Horse)				IGTKGLEK	0.99161	-1.2348	0	1998.1	0	0	1951	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3226.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2075.3	0	0	0	0	0	0	0	0	0	0	0	950.07	0	0	0	0	1380.5	0	12783	0	0	0	0
A0A9L0TEF2	A0A9L0TEF2_HORSE	G-protein coupled receptors family 1 profile domain-containing protein	LOC102147723	Equus caballus (Horse)		membrane [GO:0016020]	G protein-coupled receptor activity [GO:0004930]	MPPEHPR	0.96708	-0.026984	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	701.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TEF9	A0A9L0TEF9_HORSE	Ferroptosis suppressor protein 1 (Apoptosis-inducing factor homologous mitochondrion-associated inducer of death) (p53-responsive gene 3 protein)	AIFM2	Equus caballus (Horse)				AYVPGSLTFLLALGR	0.87013	0.45573	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	660.24	0	0	0
A0A9L0TEG9	A0A9L0TEG9_HORSE	Zinc finger protein 454	ZNF454	Equus caballus (Horse)				VFTKSSVLNK	0.9887	-1.8981	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	341.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TEK1	A0A9L0TEK1_HORSE	EF-hand calcium binding domain 14	EFCAB14	Equus caballus (Horse)				IESGELGLNR	0.96057	-0.020659	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	684.1	700.52	656.88	0	0	0	0	0	0	0	0	0	0	0	347.65	0	0	0	0	587.69	0	0	0	0	0	0	0	0	0	0	0	870.42	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TEQ1	A0A9L0TEQ1_HORSE	Splicing factor U2AF subunit (U2 snRNP auxiliary factor large subunit)	U2AF2	Equus caballus (Horse)	mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	nucleus [GO:0005634]	RNA binding [GO:0003723]	RGPRPGK	0.57143	0.64803	2758.7	3201.2	3344.9	2698.3	2501.4	3025.2	3137.2	2929.4	3102.3	4042.7	5458.6	5877.1	2398.7	2565.1	2651	0	2471.3	0	2451.8	2872.4	2557.5	2517.8	2407.8	2509.8	2148.6	2000.6	2121.2	0	0	0	0	0	0	0	0	0	3162	3647.4	3635.8	0	0	0	2235.4	2508.2	2114.7	0	0	0	4193.9	4580.4	4141.3	0	2561.8	2941.3	0	0	0	0	0	0	0	2483.9	2266.1	1038.8	1172.1	1330.6	2109.9	2102.6	2018.2	0	5912.5	5064	3812.2	3539.9	3447.6
A0A9L0TEQ4	A0A9L0TEQ4_HORSE	"phosphatidylinositol-4,5-bisphosphate 3-kinase (EC 2.7.1.153)"	PIK3CA	Equus caballus (Horse)	phosphorylation [GO:0016310]		ATP binding [GO:0005524]; kinase activity [GO:0016301]	SLWVINSALR	0.95929	-0.016356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	453.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	751.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TER6	A0A9L0TER6_HORSE	Septin 12	SEPTIN12	Equus caballus (Horse)		cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	GTP binding [GO:0005525]	LPQEPRATRCHTR	0.92352	0.29434	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	863.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	683.48	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TEU7	A0A9L0TEU7_HORSE	dUTPase-like domain-containing protein		Equus caballus (Horse)				VIDPDYK	0.9893	-1.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1330.9	0	0	0	0	0	0	0	0	0	0	0	993.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TEW0	A0A9L0TEW0_HORSE	BAR/IMD domain containing adaptor protein 2	BAIAP2	Equus caballus (Horse)				IQTPSGR	0.97466	0.085077	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2482	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	508.13	0	0	0	0	0	0	0	0
A0A9L0TF04	A0A9L0TF04_HORSE	Rab3 GTPase-activating protein catalytic subunit	RAB3GAP1	Equus caballus (Horse)		endoplasmic reticulum [GO:0005783]	GTPase activator activity [GO:0005096]	LGTSAEGAHLR	0.96707	-0.095616	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1012.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TF17	A0A9L0TF17_HORSE	"Inositol-tetrakisphosphate 1-kinase (EC 2.7.1.134) (EC 2.7.1.159) (Inositol 1,3,4-trisphosphate 5/6-kinase)"	ITPK1	Equus caballus (Horse)	phosphorylation [GO:0016310]		isomerase activity [GO:0016853]; kinase activity [GO:0016301]; metal ion binding [GO:0046872]	QTFLKGKR	0.96626	0.0036643	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	356.63	0	360.67
A0A9L0TF18	A0A9L0TF18_HORSE	Tetratricopeptide repeat protein 9C	TTC9C	Equus caballus (Horse)				LRLTRQHGAR	0.97292	-0.20967	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1134.2	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TFC5	A0A9L0TFC5_HORSE	Centrosomal protein 43 (FGFR1 oncogene partner)	CEP43	Equus caballus (Horse)	cell projection organization [GO:0030030]	centriole [GO:0005814]		APGAWPWPRR	0.98475	-0.84344	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	825.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TFD3	A0A9L0TFD3_HORSE	Phospholipase (EC 3.1.4.4)	PLD1	Equus caballus (Horse)	lipid catabolic process [GO:0016042]		N-acylphosphatidylethanolamine-specific phospholipase D activity [GO:0070290]; phospholipase D activity [GO:0004630]	EAGRAGH	0.98525	-2.4808	0	0	0	0	0	0	0	351.75	410.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	405.12	0	0	0	0	0	0	0	0	0	0	3094.7	435.07	0	0	0	0	0	0	0	0	0	0	0	0	0	254.53	0	0	0	0	0	0	0	0	0	0	293.4	0	0	0	0
A0A9L0TFP7	A0A9L0TFP7_HORSE	Coiled-coil domain containing 183	CCDC183 RABL6	Equus caballus (Horse)				GVQYNMK	0.95148	0.23895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	305.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TFQ1	A0A9L0TFQ1_HORSE	Nucleotide binding oligomerization domain containing 1	NOD1	Equus caballus (Horse)	innate immune response [GO:0045087]	cytoplasm [GO:0005737]		NMRSQSEAFR	0.98685	-2.5661	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	805.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TFS0	A0A9L0TFS0_HORSE	Midnolin	MIDN	Equus caballus (Horse)		nucleus [GO:0005634]		SPLTLALR	0.9684	0.16145	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12805	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TFT0	A0A9L0TFT0_HORSE	"39S ribosomal protein L23, mitochondrial"	MRPL23	Equus caballus (Horse)				GKPGSNR	0.95691	0.23342	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	212.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TFV9	A0A9L0TFV9_HORSE	Docking protein 5	DOK5	Equus caballus (Horse)				GAWWCGRLQIYQRCWLVFK	0.93436	0.24882	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	671.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	793.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TFY3	A0A9L0TFY3_HORSE	Endoplasmin (Heat shock protein 90 kDa beta member 1)	HSP90B1	Equus caballus (Horse)		melanosome [GO:0042470]	ATP binding [GO:0005524]	ETLQQHKLLK	0.98764	-1.7242	0	339.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TFZ7	A0A9L0TFZ7_HORSE	Destrin (Actin-depolymerizing factor)	DSTN	Equus caballus (Horse)			actin binding [GO:0003779]	CIIVEEGK	0.99009	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	449.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	955.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TG09	A0A9L0TG09_HORSE	Uncharacterized protein	LOC100062745	Equus caballus (Horse)			metal ion binding [GO:0046872]	LCLFAALK	0.96699	-0.082539	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1860.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TG42	A0A9L0TG42_HORSE	Synapsin III	SYN3	Equus caballus (Horse)				SFKPDFILVR	0.9652	-0.15131	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	613.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TG55	A0A9L0TG55_HORSE	Ryanodine receptor 2	RYR2	Equus caballus (Horse)		sarcoplasmic reticulum membrane [GO:0033017]	calcium channel activity [GO:0005262]; calmodulin binding [GO:0005516]	DLYAFYPLLIR	0.97986	-0.36416	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	644.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TGD5	A0A9L0TGD5_HORSE	Leucine rich repeat containing 14B	LRRC14B	Equus caballus (Horse)				LEVVHNVR	0.96825	-0.044607	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	569.48	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TGE2	A0A9L0TGE2_HORSE	Glycogen [starch] synthase (EC 2.4.1.11)	GYS1	Equus caballus (Horse)	glycogen biosynthetic process [GO:0005978]		glycosyltransferase activity [GO:0016757]	LSDLLDWK	0.97336	0.11161	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	596.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TGF3	A0A9L0TGF3_HORSE	Spectrin repeat containing nuclear envelope family member 3	SYNE3	Equus caballus (Horse)		membrane [GO:0016020]; nuclear envelope [GO:0005635]		DLLLNSLLQRK	0.97942	-0.3441	0	0	0	0	0	0	0	0	0	0	339.34	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TGL3	A0A9L0TGL3_HORSE	Regulation of nuclear pre-mRNA domain containing 2	RPRD2	Equus caballus (Horse)				SIERIFK	0.98816	-1.1861	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1146.9	0	0	0	0
A0A9L0TGP5	A0A9L0TGP5_HORSE	Cerebellar deration related protein 2 like	CDR2L	Equus caballus (Horse)				LKWTLIHPR	0.98864	-1.8759	0	0	0	0	0	0	0	1356.7	0	2291.5	0	0	0	0	0	0	2929.2	0	0	0	0	0	0	0	0	0	1182.6	0	0	0	0	3078.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	984.47	0	0	0	0
A0A9L0TGR8	A0A9L0TGR8_HORSE	Cyclin-dependent kinase 8 (EC 2.7.11.22) (EC 2.7.11.23) (Cell division protein kinase 8)	CDK8	Equus caballus (Horse)			ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	NTYTNCSLIKYMEK	0.8934	0.32794	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1657.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TGT6	A0A9L0TGT6_HORSE	Mitochondrial translation release factor 1	MTRF1	Equus caballus (Horse)		mitochondrion [GO:0005739]		LVVFRQNR	0.99094	-1.2586	0	0	0	1878	0	2000.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3451.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1836.8	0	0	0	0	0	0	0	0	0	1163.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TGW9	A0A9L0TGW9_HORSE	RNA-directed DNA polymerase (EC 2.7.7.49)		Equus caballus (Horse)				EDLIPILFKLFQK	0.91042	0.31848	0	0	0	0	0	0	0	0	0	0	2053	2042.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	746.62	0	0	0	0	0	0	0	0	0	0	0	0	1214	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	633.28	0	1049.1	0	0
A0A9L0TH02	A0A9L0TH02_HORSE	Methylenetetrahydrofolate reductase (EC 1.5.1.53)	MTHFR	Equus caballus (Horse)			methylenetetrahydrofolate reductase (NAD(P)H) activity [GO:0004489]	SKSPKEELLK	0.97346	-0.19968	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	263.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TH65	A0A9L0TH65_HORSE	"SGT1 homolog, MIS12 kinetochore complex assembly cochaperone"	SUGT1	Equus caballus (Horse)				SFEMSSLVGAK	0.9852	-0.24312	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	505.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TH80	A0A9L0TH80_HORSE	separase (EC 3.4.22.49)	ESPL1	Equus caballus (Horse)	nuclear chromosome segregation [GO:0098813]; nuclear division [GO:0000280]		hydrolase activity [GO:0016787]	NVAAQGIPEATLR	0.9648	-0.12233	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	751.58	736.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TH82	A0A9L0TH82_HORSE	Regulation of nuclear pre-mRNA domain-containing protein	RPRD1A	Equus caballus (Horse)	mRNA 3'-end processing [GO:0031124]	nucleus [GO:0005634]	RNA polymerase II complex binding [GO:0000993]; RNA polymerase II CTD heptapeptide repeat phosphatase activity [GO:0008420]	ITDKESGER	0.9639	-0.13207	0	0	0	0	0	0	0	0	598.08	718.61	0	728.97	493.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1127.1	361	0	535.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	752.84	0	750.99	0	0	0	0	0
A0A9L0THC7	A0A9L0THC7_HORSE	procollagen-lysine 5-dioxygenase (EC 1.14.11.4)	PLOD2	Equus caballus (Horse)		endoplasmic reticulum membrane [GO:0005789]	dioxygenase activity [GO:0051213]; L-ascorbic acid binding [GO:0031418]; metal ion binding [GO:0046872]	LDPDMALCRNAR	0.99114	-1.2351	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	700.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	496.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0THK4	A0A9L0THK4_HORSE	Neurotrophin-3 (NT-3)	NTF3	Equus caballus (Horse)		extracellular region [GO:0005576]	growth factor activity [GO:0008083]	TGNSPVK	0.98676	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	343.27	588.7	0	0	0	0	0	0	0	0	0	753.94	0	588.1	0	0	0	0	648.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0THL2	A0A9L0THL2_HORSE	Ninein	NIN	Equus caballus (Horse)				DLYVENAQLLK	0.98587	-2.8142	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	810.12	0	0	0	0	0	0	0	0	1195.4	0	0	0	0	0	0	652.66	555.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0THL5	A0A9L0THL5_HORSE	"Ribonucleoprotein, PTB binding 1"	RAVER1	Equus caballus (Horse)			RNA binding [GO:0003723]	GWGGAGR	0.96111	0.21611	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	381.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0THP5	A0A9L0THP5_HORSE	ADAM metallopeptidase with thrombospondin type 1 motif 6	ADAMTS6 CENPK	Equus caballus (Horse)		"chromosome, centromeric region [GO:0000775]; nucleus [GO:0005634]"		EDLEREQQWLK	0.98714	-1.0623	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	591.25	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0THS4	A0A9L0THS4_HORSE	RNA binding motif protein 15B	RBM15B	Equus caballus (Horse)		nucleus [GO:0005634]	RNA binding [GO:0003723]	DSSPSGR	0.98666	-1.3978	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	692.58	0	0	0	0	0	0	0	330.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0THT1	A0A9L0THT1_HORSE	Phenylethanolamine N-methyltransferase (EC 2.1.1.28) (Noradrenaline N-methyltransferase)	PNMT	Equus caballus (Horse)			transferase activity [GO:0016740]	GLGRRGAR	0.94796	0.23734	0	0	0	0	0	0	0	0	1132.6	0	0	0	0	0	0	0	0	0	0	0	38953	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	70940	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0THZ5	A0A9L0THZ5_HORSE	Ig-like domain-containing protein		Equus caballus (Horse)				LNCTVNSK	0.96617	0.0046012	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	387.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TI06	A0A9L0TI06_HORSE	Elongator complex protein 1	ELP1	Equus caballus (Horse)	tRNA processing [GO:0008033]	cytoplasm [GO:0005737]; nucleus [GO:0005634]		AIGHLSK	0.98629	-1.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1701.4	1552.3	1254.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TI50	A0A9L0TI50_HORSE	Serpin family E member 3	SERPINE3	Equus caballus (Horse)				QLAEALGYTVRDQR	0.90817	0.29868	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	466.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TI76	A0A9L0TI76_HORSE	Fibrosin	FBRS	Equus caballus (Horse)				VSPATPK	0.94269	0.24581	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	309.23	0	0	0	0	0	0	0	0	0	0	0	594.23	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TI81	A0A9L0TI81_HORSE	isoleucine--tRNA ligase (EC 6.1.1.5) (Isoleucyl-tRNA synthetase)	IARS1	Equus caballus (Horse)	translation [GO:0006412]		aminoacyl-tRNA ligase activity [GO:0004812]; ATP binding [GO:0005524]	ESIDHLTIPSR	0.20325	1.0491	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	759.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TI98	A0A9L0TI98_HORSE	Glucocorticoid induced 1	GLCCI1	Equus caballus (Horse)				LLGPLLPASDLMLK	0.89403	0.334	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11971	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TIA9	A0A9L0TIA9_HORSE	Caspase recruitment domain family member 19	CARD19	Equus caballus (Horse)				FLLTFLTDDLGGL	0.9899	-1.1176	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	410.64	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TIB5	A0A9L0TIB5_HORSE	Coiled-coil domain containing 9B	CCDC9B	Equus caballus (Horse)				MGGGSGR	0.96673	0.21339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	377.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TIF5	A0A9L0TIF5_HORSE	HAUS augmin like complex subunit 7	HAUS7	Equus caballus (Horse)				FSSLKATPAEVK	0.98973	-1.6259	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	779.93	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	547.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TIJ8	A0A9L0TIJ8_HORSE	Rho GTPase-activating protein 35	ARHGAP35	Equus caballus (Horse)				GCKEREPTGK	0.97952	-0.30532	0	1330.6	0	0	0	0	0	0	0	2540.7	3993.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	902.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1371.9	0	1709	0	0	0	0	0	1586.1	0	0	0	0	0	0
A0A9L0TIP7	A0A9L0TIP7_HORSE	Cysteine and glycine-rich protein 1 (Cysteine-rich protein 1)	CSRP1	Equus caballus (Horse)			metal ion binding [GO:0046872]	GCYAKNFGPK	0.98633	-1.448	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	238.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TJ09	A0A9L0TJ09_HORSE	"Calcium-activated potassium channel subunit beta (BKbeta) (BK channel subunit beta) (Calcium-activated potassium channel, subfamily M subunit beta) (Charybdotoxin receptor subunit beta) (K(VCA)beta) (Maxi K channel subunit beta) (Slo-beta)"	KCNMB4	Equus caballus (Horse)	detection of calcium ion [GO:0005513]	voltage-gated potassium channel complex [GO:0008076]	calcium-activated potassium channel activity [GO:0015269]; potassium channel regulator activity [GO:0015459]	VNAAAVK	0.93671	0.24772	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39479	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TJ12	A0A9L0TJ12_HORSE	Carnitine O-octanoyltransferase	CROT	Equus caballus (Horse)	fatty acid metabolic process [GO:0006631]		acyltransferase activity [GO:0016746]	LSPATGR	0.93155	0.25645	0	0	0	0	0	0	0	0	0	0	679.57	577.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	374.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	514.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	728.08	0	0	0	424.86
A0A9L0TJ71	A0A9L0TJ71_HORSE	Pre-mRNA-splicing factor SYF2	LOC100071373	Equus caballus (Horse)		nucleus [GO:0005634]		KARLEWELQEEEK	0.97981	-0.27039	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1322.8	0	0	0	0	0	0	0	0	0	3365.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TJH6	A0A9L0TJH6_HORSE	Melanotransferrin	MELTF	Equus caballus (Horse)				CLAEGAGDVAFVK	0	4.3795	530.1	727.98	499.94	0	0	389.78	2684	3103.2	3123	0	1382.7	1329.1	1964.8	2043	2064.1	0	4827.8	4085.4	0	2461.2	1985	481.43	496.81	448.79	550.43	428.95	518.86	1920.4	1687	1790.9	2044.6	2497.2	2383.2	3516.6	4112.1	2971.8	1422.1	3025.6	3118.9	3048.6	2702.3	2934.8	1638.8	1734.1	1760.2	3606.8	3980.3	3893.6	4802.1	4524.4	4386.7	562.27	1424.6	1436.6	707.24	768.99	757.42	3240.3	3536.9	3197.8	961.86	3657.6	3771.9	1177.9	1168.9	1276.9	4247.7	4734.3	4225.3	840.83	1744	1595.2	1040.9	1036.2	789.41
A0A9L0TJJ4	A0A9L0TJJ4_HORSE	exo-alpha-sialidase (EC 3.2.1.18)	NEU2	Equus caballus (Horse)	lipid catabolic process [GO:0016042]		exo-alpha-sialidase activity [GO:0004308]	TLLAFAEK	0.96956	0.011072	550.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TJL9	A0A9L0TJL9_HORSE	BRCA1-A complex subunit RAP80 (Receptor-associated protein 80) (Ubiquitin interaction motif-containing protein 1)	UIMC1	Equus caballus (Horse)	chromatin organization [GO:0006325]; DNA repair [GO:0006281]	nucleus [GO:0005634]	metal ion binding [GO:0046872]	SLKMAQR	0.98773	-1.7801	0	0	0	0	0	0	0	0	778.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	940.79	0	0	0	1328.5	1449.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TJM7	A0A9L0TJM7_HORSE	Zinc finger protein 606	ZNF606	Equus caballus (Horse)			metal ion binding [GO:0046872]	SQLHMLSK	0.96728	0.023715	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1095	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TJN8	A0A9L0TJN8_HORSE	Family with sequence similarity 186 member A	FAM186A	Equus caballus (Horse)				EQREQRMQK	0.98139	-0.23392	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1609.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	329.87	0	0
A0A9L0TJR0	A0A9L0TJR0_HORSE	SH3 and PX domains 2B	SH3PXD2B	Equus caballus (Horse)		cell projection [GO:0042995]; cytoplasm [GO:0005737]		IGENREK	0.99129	-1.247	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2547.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2083.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TJZ2	A0A9L0TJZ2_HORSE	Piwi like RNA-mediated silencing 4	PIWIL4	Equus caballus (Horse)	regulation of translation [GO:0006417]; regulatory ncRNA-mediated gene silencing [GO:0031047]		RNA binding [GO:0003723]	ARARGIAR	0.96865	0.02488	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	72859	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TK15	A0A9L0TK15_HORSE	Uncharacterized protein		Equus caballus (Horse)				ATGSEGVMVR	0.96358	-0.13583	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1124.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TK20	A0A9L0TK20_HORSE	Thrombospondin 3	THBS3	Equus caballus (Horse)	cell adhesion [GO:0007155]		calcium ion binding [GO:0005509]	YQREDGK	0.98859	-1.7928	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	792.05	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TK53	A0A9L0TK53_HORSE	PHD finger protein 19	PHF19	Equus caballus (Horse)		nucleus [GO:0005634]	metal ion binding [GO:0046872]	AAELGGR	0.98886	-1.048	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	686.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TK63	A0A9L0TK63_HORSE	ADAM metallopeptidase domain 12	ADAM12	Equus caballus (Horse)		membrane [GO:0016020]	metal ion binding [GO:0046872]	GVNLGSK	0.87831	0.38278	0	0	0	0	0	0	0	0	0	0	0	1413.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2599.2	0	0	1482	1426.1	1380.6	0	0	0	0	0	0	0	1422.2	1292.3	0	0	0	0	0	0	0	959.85	0	0	0	0	1229.7	0	0	0	0	0	0	0	0
A0A9L0TKD0	A0A9L0TKD0_HORSE	RAD50 double strand break repair protein	RAD50	Equus caballus (Horse)	organelle organization [GO:0006996]	nucleus [GO:0005634]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]	EKINTDMR	0.98589	-2.9496	0	0	0	0	0	0	0	0	0	0	330.61	419.31	0	915.43	786.57	0	0	0	0	0	570.35	0	0	0	0	0	0	600.58	0	0	0	0	0	0	0	0	0	776.71	0	0	0	1155.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	773.26	0	0	493.38	0	0	0	0	0	0	439.04	0	1385.4	1234	0	0	0
A0A9L0TKF0	A0A9L0TKF0_HORSE	SKI3 subunit of superkiller complex	SKIC3	Equus caballus (Horse)				ALQDKKYEDAVR	0.98571	-2.0275	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	404.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TKG1	A0A9L0TKG1_HORSE	Chromosome 7 C11orf87 homolog	C7H11orf87	Equus caballus (Horse)		membrane [GO:0016020]		AGERMER	0.68539	0.59229	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	538.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TKS6	A0A9L0TKS6_HORSE	Activating signal cointegrator 1 complex subunit 3	ASCC3	Equus caballus (Horse)	gene expression [GO:0010467]; nucleic acid metabolic process [GO:0090304]		ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]	LWGWASPLR	0.98826	-1.8832	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1343.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TKW4	A0A9L0TKW4_HORSE	RNA polymerase III subunit GL	POLR3GL	Equus caballus (Horse)		nucleus [GO:0005634]		LTLSLPPSSR	0.97092	-0.06078	0	0	0	0	0	0	0	0	0	0	513.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	341.86	0	0	0	0	0
A0A9L0TL94	A0A9L0TL94_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				ENSKSSKR	0.97569	0.094099	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1555.7	1305.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TLC8	A0A9L0TLC8_HORSE	Protein tyrosine phosphatase non-receptor type 23	PTPN23	Equus caballus (Horse)				KLELLRQNAVR	0.98101	-0.21892	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	429.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TLF3	A0A9L0TLF3_HORSE	L1 transposable element RRM domain-containing protein		Equus caballus (Horse)				RPTARHIVVQMAK	0.92173	0.29502	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	625.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TLL3	A0A9L0TLL3_HORSE	Ribonuclease P protein subunit p29	POP4	Equus caballus (Horse)	tRNA processing [GO:0008033]	nucleolus [GO:0005730]; ribonuclease P complex [GO:0030677]		AFLKRSTPR	0.98591	-1.4511	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1501.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1040.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TLQ3	A0A9L0TLQ3_HORSE	Oxidative stress-responsive serine-rich protein 1 (Oxidative stress-responsive protein 1) (Peroxide-inducible transcript 1 protein)	OSER1	Equus caballus (Horse)				MRNQRIQGSTER	0.87901	0.3882	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1186.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	464.39	1159	0	0	0	0	0	562.71	0	0	1378.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TLQ7	A0A9L0TLQ7_HORSE	DLG associated protein 3	DLGAP3	Equus caballus (Horse)				SSIPGYTR	0.99041	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	796.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TLV7	A0A9L0TLV7_HORSE	"Afadin, adherens junction formation factor"	AFDN	Equus caballus (Horse)	cell adhesion [GO:0007155]			DAEEKVMAL	0.9885	-1.8727	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1077.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TLW4	A0A9L0TLW4_HORSE	Pyrroline-5-carboxylate reductase 3 (EC 1.5.1.2) (Pyrroline-5-carboxylate reductase-like protein)	PYCR3	Equus caballus (Horse)	proline biosynthetic process [GO:0006561]			IAAQTLLGTAK	0.96006	-0.019525	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1101.3	0	0	0	0	0	0
A0A9L0TLX8	A0A9L0TLX8_HORSE	Nuclear pore complex protein	NUP107	Equus caballus (Horse)	mRNA export from nucleus [GO:0006406]; protein import into nucleus [GO:0006606]	nuclear membrane [GO:0031965]; nuclear pore outer ring [GO:0031080]	structural constituent of nuclear pore [GO:0017056]	AEALKQGNAIMRK	0.91079	0.30067	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	696.81	0	1651.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	924.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TM42	A0A9L0TM42_HORSE	Gamma-tubulin complex component	TUBGCP3	Equus caballus (Horse)		centrosome [GO:0005813]; cytosol [GO:0005829]; microtubule [GO:0005874]		KYSLLDHMQAMR	0.86728	0.40272	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2708.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TM60	A0A9L0TM60_HORSE	BAI1 associated protein 3	BAIAP3	Equus caballus (Horse)	exocytosis [GO:0006887]			GGPLPAK	0.93382	0.24837	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1220.8	1167.2	1216	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TM97	A0A9L0TM97_HORSE	Basic leucine zipper and W2 domains 1	BZW1	Equus caballus (Horse)				VGGSGGR	0.95465	0.2332	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	298.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TMA0	A0A9L0TMA0_HORSE	"SPG11 vesicle trafficking associated, spatacsin"	SPG11	Equus caballus (Horse)				VVHINEQEEPIK	0.96466	-0.11856	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	513.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TMD6	A0A9L0TMD6_HORSE	Post-GPI attachment to proteins 2	PGAP2	Equus caballus (Horse)		membrane [GO:0016020]		CTRSQCR	0.98686	-0.86442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	313.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	369.01	0	0	341.9	0	0	0	0
A0A9L0TMD7	A0A9L0TMD7_HORSE	Cytochrome P450 1A (EC 1.14.14.1)	CYP1A1	Equus caballus (Horse)	lipid metabolic process [GO:0006629]	endoplasmic reticulum membrane [GO:0005789]	aromatase activity [GO:0070330]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; lyase activity [GO:0016829]	MIKEHNK	0.98885	-1.7923	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1973.7	0	0	0	0
A0A9L0TML2	A0A9L0TML2_HORSE	Leucine-rich repeat-containing protein 14	LRRC14	Equus caballus (Horse)				ASYAFLR	0.97036	-0.028749	0	0	0	0	0	0	0	0	763.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TMP3	A0A9L0TMP3_HORSE	RELT TNF receptor	RELT	Equus caballus (Horse)		membrane [GO:0016020]		LGTPRGLR	0.98635	-2.0121	0	8138.6	7203.4	0	0	0	0	0	0	7315.4	0	0	0	0	0	0	0	0	0	0	0	6535.9	6860.3	6522.6	6034.2	6549.9	6727.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	241.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TMQ9	A0A9L0TMQ9_HORSE	Phosphoinositide phospholipase C (EC 3.1.4.11)	PLCE1	Equus caballus (Horse)	lipid catabolic process [GO:0016042]; signal transduction [GO:0007165]		guanyl-nucleotide exchange factor activity [GO:0005085]; hydrolase activity [GO:0016787]	VGQNGLKNSEK	0.98772	-1.8788	0	0	0	0	0	0	0	0	0	0	0	0	522.5	0	0	643.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TMW7	A0A9L0TMW7_HORSE	Complement factor I	CFI	Equus caballus (Horse)	proteolysis [GO:0006508]		serine-type peptidase activity [GO:0008236]	KWWTLKDR	0.97333	0.044922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	573.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TN15	A0A9L0TN15_HORSE	Nucleotide binding oligomerization domain containing 2	NOD2	Equus caballus (Horse)	innate immune response [GO:0045087]	cytoplasm [GO:0005737]		LSHRDARLLL	0.77282	0.5097	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	707.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TN29	A0A9L0TN29_HORSE	Immunoglobulin V-set domain-containing protein	CD300LF	Equus caballus (Horse)		membrane [GO:0016020]		YQHWGLRDR	0.9727	-0.1822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	456.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TN82	A0A9L0TN82_HORSE	Myosin binding protein H	MYBPH	Equus caballus (Horse)				ALSEQGVCTLEIR	0.93971	0.25287	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1002.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TNA5	A0A9L0TNA5_HORSE	Oncostatin M	OSM	Equus caballus (Horse)				GPRGVQLFR	0.99017	-1.6723	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2874.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TNL9	A0A9L0TNL9_HORSE	Cytochrome b-245 beta chain	CYBB	Equus caballus (Horse)		membrane [GO:0016020]		QLDRNLTFHK	0.98658	-3.1409	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	505.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	593.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TNQ4	A0A9L0TNQ4_HORSE	TSC complex subunit 2	TSC2	Equus caballus (Horse)			GTPase activator activity [GO:0005096]	CPRTEAYSR	0.98756	-1.8126	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47559	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	435.12	0	0	0	0	0
A0A9L0TNS4	A0A9L0TNS4_HORSE	SPARC (Osteonectin) (Secreted protein acidic and rich in cysteine)	SPARC	Equus caballus (Horse)		basement membrane [GO:0005604]; extracellular region [GO:0005576]; membrane [GO:0016020]	metal ion binding [GO:0046872]	APLIPMEHCTTR	0.89581	0.33896	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	792.96	660.48	711.65	0	0	0	0	0	0	0	0	0	518.03	604.99	642.78	658.22	704.93	0	550.57	512.01	0	0	427.53	0	0	958.56	1192.8	0	0	0	0	524.96	0	0	0	0	0	0	0	0	0	0	1090	1143.3	1190.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TNW7	A0A9L0TNW7_HORSE	Jupiter microtubule associated homolog 1	JPT1 NT5C	Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]		GVDPNSR	0.94941	0.23726	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	347.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	338.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TNW8	A0A9L0TNW8_HORSE	StAR related lipid transfer domain containing 10	STARD10	Equus caballus (Horse)				DVPAETLYDVLHDIEYRK	0.75	0.54862	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	739.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TNX5	A0A9L0TNX5_HORSE	Uncharacterized protein		Equus caballus (Horse)				EIKGIQTGK	0.98762	-1.1996	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	791.48	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TP77	A0A9L0TP77_HORSE	Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12)	USP5	Equus caballus (Horse)	proteolysis [GO:0006508]		cysteine-type deubiquitinase activity [GO:0004843]; zinc ion binding [GO:0008270]	AGDRVHK	0.68451	0.59253	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	729.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TPJ8	A0A9L0TPJ8_HORSE	Endonuclease/exonuclease/phosphatase family domain-containing protein 1	EEPD1	Equus caballus (Horse)				GSTLGCHRSIPR	0.96764	-0.16452	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1851	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TPL0	A0A9L0TPL0_HORSE	RNA helicase (EC 3.6.4.13)	DDX56	Equus caballus (Horse)			ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]	ATGPAVEQAVR	0.98004	-0.36045	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	553.97	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TPL6	A0A9L0TPL6_HORSE	Rho related BTB domain containing 3	RHOBTB3	Equus caballus (Horse)				EVVEAHK	0.9678	-0.070859	0	0	0	0	0	0	0	0	0	506.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	948.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1224	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TPV1	A0A9L0TPV1_HORSE	Protein tyrosine phosphatase non-receptor type 13	PTPN13	Equus caballus (Horse)	regulatory ncRNA-mediated gene silencing [GO:0031047]			TLVSEREECTLR	0.92542	0.28661	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2708.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TQ30	A0A9L0TQ30_HORSE	Annexin	ANXA3	Equus caballus (Horse)			calcium-dependent phospholipid binding [GO:0005544]	EYQAAYGK	0.98415	-1.2933	0	0	0	0	1951	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	923.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1818.9	0	0
A0A9L0TQ59	A0A9L0TQ59_HORSE	DNA helicase (EC 3.6.4.12)	IGHMBP2	Equus caballus (Horse)			metal ion binding [GO:0046872]; nucleic acid binding [GO:0003676]	ARAHARQR	0.97344	0.14423	0	0	0	0	0	657.7	0	0	0	0	0	1214.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	707.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TQ82	A0A9L0TQ82_HORSE	NAD(+) diphosphatase (EC 3.6.1.22)	NUDT13	Equus caballus (Horse)			hydrolase activity [GO:0016787]	SLYCGIACRRK	0.96478	-0.12197	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2075.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TQ93	A0A9L0TQ93_HORSE	Heme oxygenase 1 (EC 1.14.14.18)	HMOX1	Equus caballus (Horse)		membrane [GO:0016020]	metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]	AASREVHSQVTR	0.98591	-3.0355	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	587.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TQE0	A0A9L0TQE0_HORSE	Guided entry of tail-anchored proteins factor 4	GET4	Equus caballus (Horse)				VPTDRPTIK	0.96983	-0.02928	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	342.06	435.3	0	0	0	454.61
A0A9L0TQF4	A0A9L0TQF4_HORSE	Zinc finger protein 16	ZNF16	Equus caballus (Horse)				AFSQRSKLVK	0.98094	-0.26577	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1548.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TQN9	A0A9L0TQN9_HORSE	Bax inhibitor 1 (Testis-enhanced gene transcript protein) (Transmembrane BAX inhibitor motif-containing protein 6)	TMBIM6	Equus caballus (Horse)	autophagy [GO:0006914]; response to unfolded protein [GO:0006986]	membrane [GO:0016020]		KINFDALLK	0.98285	-0.76566	0	0	0	0	0	0	0	462.5	0	0	889.25	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1274.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1040.8	0	0	774.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TQU4	A0A9L0TQU4_HORSE	Ubiquitin protein ligase E3A	UBE3A	Equus caballus (Horse)				KEGHGARDDFK	0.96866	0.19623	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1186.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1067.1	0	0	1256.4	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TQU5	A0A9L0TQU5_HORSE	Xin actin binding repeat containing 2	XIRP2	Equus caballus (Horse)			actin binding [GO:0003779]	EIKGNVKR	0.96645	-0.1022	0	0	0	0	0	0	0	0	0	783.76	1170.2	952.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1322.8	1213.7	0	1634.8	0	0	0	0	0	2424.6	0	0	0	0	0	0	0	0	803.04	807.76	772.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1283.5	1167.9	0	0	0	862.62
A0A9L0TQW9	A0A9L0TQW9_HORSE	Keratin 83	KRT83	Equus caballus (Horse)		intermediate filament [GO:0005882]		AEAESWYR	0.97448	0.055183	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	639.43	547.16	558.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TQZ0	A0A9L0TQZ0_HORSE	F-box and leucine rich repeat protein 14	FBXL14	Equus caballus (Horse)				TLNIGQCVR	0.9733	0.10197	0	0	0	0	0	0	0	0	3574.9	0	0	0	6134.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10385	0	0	0	0	0	0	0	0	0	10204	0	5908	0	0	0	0	0	6809	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5855.8	0	0	0
A0A9L0TQZ7	A0A9L0TQZ7_HORSE	Rho guanine nucleotide exchange factor 3	ARHGEF3	Equus caballus (Horse)		cytoplasm [GO:0005737]		ALLDHKK	0.9868	-1.9164	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31912	20039	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18342	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TR04	A0A9L0TR04_HORSE	Transcriptional repressor GATA binding 1	TRPS1	Equus caballus (Horse)		nucleus [GO:0005634]		YHLGLHNR	0.96442	-0.0053777	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1427	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TR27	A0A9L0TR27_HORSE	Transcobalamin-2 (Transcobalamin II)	TCN2	Equus caballus (Horse)	cobalt ion transport [GO:0006824]	extracellular region [GO:0005576]		EVLQILGR	0.97353	0.092191	0	0	0	0	0	0	0	0	0	0	0	3155.4	5477.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3782.7	0	0	0	0	0	0	0	0	0	0	0	0	0	950.85	0	0	0	3810.9	0	4245.1	0	0	2767.2	0	0	651.92	3609.9	0	0	0	0	0	0	0	1286.6	0	0	0	0	0	0	0	0	0
A0A9L0TR33	A0A9L0TR33_HORSE	Mannosidase alpha class 2A member 2	MAN2A2	Equus caballus (Horse)				GLGQGLK	0.98798	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13233	0	0
A0A9L0TR41	A0A9L0TR41_HORSE	RNA helicase (EC 3.6.4.13)	DDX39A	Equus caballus (Horse)			ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]	AGSATAR	0.988	-1.5532	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1042.8	0	0	0	0	0	0	0	0	0	0	0	0	611.55	0	0	462.54	538.04	0	0	0	0	0	0	0	0	478.99	0	0	0	0	0	569.72	0	0	407.89	0	0	0	0	0	0	0	0	0	0	314.63	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TR55	A0A9L0TR55_HORSE	Inosine-5'-monophosphate dehydrogenase (IMP dehydrogenase) (IMPD) (IMPDH) (EC 1.1.1.205)	IMPDH1 IMPDH	Equus caballus (Horse)	GMP biosynthetic process [GO:0006177]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	IMP dehydrogenase activity [GO:0003938]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]	NLIDAGVDGLR	0.9683	-0.053504	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	520.43	523.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TR72	A0A9L0TR72_HORSE	Suprabasin	SBSN	Equus caballus (Horse)				GVNQAGK	0.98779	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	785.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	458.64	0	0	0	0	0	0	0	0	0	754.19	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TRA7	A0A9L0TRA7_HORSE	Vimentin	VIM	Equus caballus (Horse)		intermediate filament [GO:0005882]		CLIALYEK	0.95727	0.22743	0	0	0	0	0	0	0	0	0	0	0	0	12562	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TRC0	A0A9L0TRC0_HORSE	Charged multivesicular body protein 3 (Chromatin-modifying protein 3) (Vacuolar protein sorting-associated protein 24)	CHMP3	Equus caballus (Horse)				VDIQREEEK	0.98682	-1.8421	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	540.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TRG2	A0A9L0TRG2_HORSE	Telomeric repeat-binding factor	TERF1	Equus caballus (Horse)	cell cycle [GO:0007049]; telomere maintenance [GO:0000723]	"chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]"	double-stranded telomeric DNA binding [GO:0003691]; protein homodimerization activity [GO:0042803]	IRVVNSEPVTPEK	0.97952	-0.48198	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	667.23	0	0	1330.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TSE3	A0A9L0TSE3_HORSE	Cadherin 26	CDH26	Equus caballus (Horse)		plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]	IERYSGEIR	0.98826	-1.7752	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	849.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TSS2	A0A9L0TSS2_HORSE	Beta-hexosaminidase subunit beta (EC 3.2.1.52) (Beta-N-acetylhexosaminidase subunit beta) (N-acetyl-beta-glucosaminidase subunit beta)	HEXB	Equus caballus (Horse)	carbohydrate derivative metabolic process [GO:1901135]	lysosome [GO:0005764]	beta-N-acetylhexosaminidase activity [GO:0004563]	IVIEYAR	0.85714	0.48533	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	100100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2411.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TSV4	A0A9L0TSV4_HORSE	HtrA serine peptidase 3	HTRA3	Equus caballus (Horse)				MATSSSR	0.96881	-0.031135	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1310.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TT71	A0A9L0TT71_HORSE	Rho guanine nucleotide exchange factor 25	ARHGEF25	Equus caballus (Horse)				YQLLLKGKLTAQGK	0.69872	0.61881	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	478.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TTF4	A0A9L0TTF4_HORSE	Calcium load-activated calcium channel (GEL complex subunit TMCO1) (Transmembrane and coiled-coil domain-containing protein 1)	TMCO1	Equus caballus (Horse)	monoatomic ion transmembrane transport [GO:0034220]	endoplasmic reticulum membrane [GO:0005789]		KLSHLVYK	0.98299	-0.74411	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1472.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TTP9	A0A9L0TTP9_HORSE	Zinc finger and BTB domain containing 4	ZBTB4	Equus caballus (Horse)				LLPMRAAK	0.98773	-1.5593	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1586.1	1644.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TTS2	A0A9L0TTS2_HORSE	TBC1 domain family member 2B	TBC1D2B	Equus caballus (Horse)				TLLGSQVDQR	0.98016	-0.32582	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1422.4	0	0	0	0	0	0	0	0	0
A0A9L0TU71	A0A9L0TU71_HORSE	Kinetochore protein NDC80	NDC80	Equus caballus (Horse)	attachment of mitotic spindle microtubules to kinetochore [GO:0051315]; cell division [GO:0051301]	Ndc80 complex [GO:0031262]; nucleus [GO:0005634]		LESLAAKNK	0.98693	-1.8374	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	878.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TUD1	A0A9L0TUD1_HORSE	Leucine rich alpha-2-glycoprotein 1	LRG1	Equus caballus (Horse)				GTWMGGK	0.98896	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	347.48	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TUD9	A0A9L0TUD9_HORSE	Potassium channel tetramerization domain containing 8	KCTD8	Equus caballus (Horse)				KVCEKLSVEEEMK	0.88731	0.3588	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	899.42	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TUM9	A0A9L0TUM9_HORSE	Pyroglutamyl-peptidase I (EC 3.4.19.3)	PGPEP1	Equus caballus (Horse)	proteolysis [GO:0006508]	cytoplasm [GO:0005737]	cysteine-type peptidase activity [GO:0008234]	LGAFTHPGPPPGQVVELEK	0.68079	0.59292	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1723	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	853.52	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	826.59	781.84	699.32	0	0	0	0	0	0
A0A9L0TUN1	A0A9L0TUN1_HORSE	Joining chain of multimeric IgA and IgM	JCHAIN	Equus caballus (Horse)				IIIPVNSR	0.98673	-1.1925	0	0	0	0	0	0	514.63	575.65	703.83	0	0	428.8	581.13	0	630.62	900.75	822.61	883.31	0	563.85	0	0	0	0	0	0	0	0	779.28	814.16	872.35	865.04	1045.7	0	830.12	687.17	0	650.92	775.57	0	0	478.99	0	0	0	0	0	596.57	613.95	584.7	710.63	0	368.31	326	0	0	0	0	1022.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TUY7	A0A9L0TUY7_HORSE	Chromosome 1 C10orf90 homolog	C1H10orf90	Equus caballus (Horse)		centrosome [GO:0005813]; cytoplasm [GO:0005737]		EPSIHGK	0.98529	-0.24018	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3471.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	831.37	0	637.79	0	0	0	0	0	0
A0A9L0TV02	A0A9L0TV02_HORSE	Phospholipase A2 (EC 3.1.1.4)	PLA2G4E	Equus caballus (Horse)	lipid catabolic process [GO:0016042]	cytosol [GO:0005829]	carboxylic ester hydrolase activity [GO:0052689]; metal ion binding [GO:0046872]; phospholipase activity [GO:0004620]	QVSCLEVHAESR	0.1413	1.2588	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12121	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9L0TV26	A0A9L0TV26_HORSE	NEDD8-activating enzyme E1 regulatory subunit	NAE1	Equus caballus (Horse)	protein neddylation [GO:0045116]		NEDD8 activating enzyme activity [GO:0019781]	LDKPFPELR	0.9636	-0.12408	0	0	0	0	0	0	0	0	429.76	0	0	381.29	419.24	473.09	0	415.97	0	356.88	0	503.85	0	0	0	0	0	0	0	0	0	0	0	565.86	601.3	0	0	0	0	474.66	473.22	438.73	0	0	0	0	0	0	0	0	502.11	0	576.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9R1SBT7	A0A9R1SBT7_HORSE	Coiled-coil domain-containing protein 93	CCDC93	Equus caballus (Horse)				APGGDEK	0.98604	-3.0544	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	211.87	0	0	376.37	1047.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A9R8NHH3	A0A9R8NHH3_HORSE	aromatase (EC 1.14.14.14) (Cytochrome P-450AROM) (Estrogen synthase)	CYP19A1	Equus caballus (Horse)				DLKNDDMQKLK	0.96343	-0.12636	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	631.87	0	5074.2	552.81	490.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	987.92	0	0	1130.8	0	3373.7	0	0	0	0	0	0	0	0	0	0	0	1946.4	0	0	0	0	563.38	0	548.83	947.78	2070.2	0	0	0	0	0	1540.9	0	0	0	0	0	1012.7	0
A4ZZ55	A4ZZ55_HORSE	C-C chemokine receptor type 5	CCR5	Equus caballus (Horse)	chemotaxis [GO:0006935]; immune response [GO:0006955]; inflammatory response [GO:0006954]	plasma membrane [GO:0005886]	C-C chemokine receptor activity [GO:0016493]	SQKEGTR	0.98832	-1.7953	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1266.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A5YBL8	A5YBL8_HORSE	Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8)	PPIB	Equus caballus (Horse)	chaperone-mediated protein folding [GO:0061077]; protein peptidyl-prolyl isomerization [GO:0000413]	protein-containing complex [GO:0032991]	metal ion binding [GO:0046872]; peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	VLEGMEVVR	0.96255	-0.0064577	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1180.7	0	0	0	0
A6P3D1	A6P3D1_HORSE	"Protein phosphatase 1, regulatory (Inhibitor) subunit 3C"	PPP1R3C	Equus caballus (Horse)				RVVFADSK	0.98347	-0.72633	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	598.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A8BQB4	GDE_HORSE	"Glycogen debranching enzyme (Glycogen debrancher) [Includes: 4-alpha-glucanotransferase (EC 2.4.1.25) (Oligo-1,4-1,4-glucantransferase); Amylo-alpha-1,6-glucosidase (Amylo-1,6-glucosidase) (EC 3.2.1.33) (Dextrin 6-alpha-D-glucosidase)]"	AGL	Equus caballus (Horse)	glycogen biosynthetic process [GO:0005978]; glycogen catabolic process [GO:0005980]	cytoplasm [GO:0005737]	"4-alpha-glucanotransferase activity [GO:0004134]; amylo-alpha-1,6-glucosidase activity [GO:0004135]; beta-maltose 4-alpha-glucanotransferase activity [GO:0102500]"	TLLLNEMEKLEK	0.98743	-1.1005	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	618.66	418.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A8CWP2	A8CWP2_HORSE	"Core2 beta-1,6-N-acetylglucosaminyltransferase"		Equus caballus (Horse)		Golgi membrane [GO:0000139]	glycosyltransferase activity [GO:0016757]	KHYAVVNGK	0.9842	-0.78831	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	664.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
B0I1H1	B0I1H1_HORSE	Beta1 integrin	itgb1	Equus caballus (Horse)	integrin-mediated signaling pathway [GO:0007229]			AFNKGEKK	0.96503	-0.091495	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1799.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
B2X057	B2X057_HORSE	MHC class I antigen 4.h	Eqca-N	Equus caballus (Horse)	antigen processing and presentation [GO:0019882]; immune response [GO:0006955]	lumenal side of endoplasmic reticulum membrane [GO:0098553]; phagocytic vesicle membrane [GO:0030670]		AKDHAQTFR	0.98695	-1.8417	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2641.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
B8K205	B8K205_HORSE	Cadherin 11	CDH11	Equus caballus (Horse)	corticospinal tract morphogenesis [GO:0021957]; focal adhesion assembly [GO:0048041]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; modulation of chemical synaptic transmission [GO:0050804]; negative regulation of cell migration [GO:0030336]	cytoplasm [GO:0005737]; glutamatergic synapse [GO:0098978]; plasma membrane [GO:0005886]; Schaffer collateral - CA1 synapse [GO:0098685]	calcium ion binding [GO:0005509]	LADLYGSK	0.929	0.27026	0	0	0	0	0	0	0	965.84	0	0	0	0	0	0	0	0	1973.4	0	0	0	0	0	0	0	0	0	0	0	0	1928.4	1095.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	666.65	0	0	0	0	0	0	0	0	773.83	0	0	0	0	0	0	0	0	0	0	0	0	0
C1L371	C1L371_HORSE	Parvalbumin	pvalb1	Equus caballus (Horse)			calcium ion binding [GO:0005509]	TLLAAGDKDGDGK	0.98972	-1.6115	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	605.48	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
C4P956	C4P956_HORSE	PTPN13-like Y-linked protein	PRY	Equus caballus (Horse)				ALGDICG	0.95865	0.23143	0	0	0	0	0	0	0	0	0	285.37	0	521.7	0	0	0	0	0	0	0	0	0	0	207.29	0	0	0	0	0	0	615.24	1244.1	0	1198.7	571.87	616.26	0	366.38	0	0	0	0	0	509.47	601.89	0	562.76	0	0	0	0	0	0	535.89	462.37	0	0	0	583.84	0	0	0	478.13	496.59	0	0	0	0	0	0	0	0	0	0	0	0
D9ZFG6	D9ZFG6_HORSE	NMES1		Equus caballus (Horse)		membrane [GO:0016020]		NFFQLLRKK	0.97376	-0.19031	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	559.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PH71	F6PH71_HORSE	Ankyrin repeat domain 52	ANKRD52	Equus caballus (Horse)				GADLGCK	0.98924	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	389.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PH92	F6PH92_HORSE	Xylosyltransferase 2 (EC 2.4.2.26) (Xylosyltransferase II)	XYLT2	Equus caballus (Horse)	chondroitin sulfate biosynthetic process [GO:0030206]; heparan sulfate proteoglycan biosynthetic process [GO:0015012]	Golgi membrane [GO:0000139]	metal ion binding [GO:0046872]; protein xylosyltransferase activity [GO:0030158]	LQQVSRPTFFARK	0.40945	0.67566	0	689.56	0	0	0	0	0	590.81	0	0	0	0	493.27	0	436.95	0	0	0	0	861.25	0	0	0	0	0	0	0	0	0	0	0	0	1054.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1133.2	0	1057	0	0	0	0	0	0	0	1121.1	805.82	0	0	0	0	0	660.24	0	415.17	0
F6PHP6	F6PHP6_HORSE	Hexosyltransferase (EC 2.4.1.-)	CSGALNACT1	Equus caballus (Horse)	"cartilage development [GO:0051216]; chondroitin sulfate biosynthetic process [GO:0030206]; chondroitin sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process [GO:0050653]; endochondral ossification [GO:0001958]; extracellular matrix organization [GO:0030198]; UDP-glucuronate metabolic process [GO:0046398]; UDP-N-acetylgalactosamine metabolic process [GO:0019276]"	Golgi cisterna membrane [GO:0032580]	glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity [GO:0047238]; glucuronosyltransferase activity [GO:0015020]; glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase activity [GO:0047237]; peptidoglycan glycosyltransferase activity [GO:0008955]	ANGPTGK	0.98867	-1.0435	0	0	0	0	0	0	437.57	0	0	0	0	0	0	0	0	0	0	0	0	0	511.71	0	0	0	0	0	0	0	0	0	855.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	674.72	0	0	718.05	0	0	0	0	0	961.01	0	0	0	0	0	0	0	329.33	0	0	0	0	0	0	0
F6PI03	F6PI03_HORSE	tRNA (guanine(10)-N2)-methyltransferase homolog (tRNA guanosine-2'-O-methyltransferase TRM11 homolog)	TRMT11	Equus caballus (Horse)	ncRNA processing [GO:0034470]; RNA methylation [GO:0001510]		nucleic acid binding [GO:0003676]; S-adenosylmethionine-dependent methyltransferase activity [GO:0008757]	GPDENIR	0.9676	0.018253	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1129.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PI64	F6PI64_HORSE	Proline rich basic protein 1	PROB1	Equus caballus (Horse)		nucleoplasm [GO:0005654]		AAPARPRTVPK	0.98384	-1.2909	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PJ91	F6PJ91_HORSE	Zinc ribbon domain containing 2	ZNRD2 FAM89B	Equus caballus (Horse)	establishment of cell polarity [GO:0030010]; negative regulation of SMAD protein signal transduction [GO:0060392]; negative regulation of transforming growth factor beta receptor signaling pathway [GO:0030512]; positive regulation of cell migration [GO:0030335]	cytoplasm [GO:0005737]; lamellipodium [GO:0030027]	transcription corepressor binding [GO:0001222]	ELERVYSQR	0.98956	-1.1187	0	0	0	0	0	0	0	0	0	0	0	1461.5	2291.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6578.5	6347.1	6299.7	0	2049.2	1732.7	0	0	0	0	0	0	0	0	0	0	0	2531.1	0	0	0	0	0	1967.6	0	0	0	0	0	2820	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PJG9	F6PJG9_HORSE	Myb/SANT DNA binding domain containing 2	MSANTD2	Equus caballus (Horse)				EHGVGKR	0.93324	0.25591	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	740.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PJR8	F6PJR8_HORSE	Zinc finger MYM-type containing 2	ZMYM2	Equus caballus (Horse)			zinc ion binding [GO:0008270]	ATYCKPHMQTK	0.99174	-1.2325	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	600.98	653.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PKR2	F6PKR2_HORSE	Schlafen family member 5	SLFN5	Equus caballus (Horse)			ATP binding [GO:0005524]	LVNTGGYTGK	0.97159	-0.061956	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1367	0	0	0	0	0	0	0	0	0	0	0	0	1288.7	0	0	0	0	0	0	0	0
F6PL97	F6PL97_HORSE	"Troponin I, cardiac muscle (Cardiac troponin I)"	TNNI3	Equus caballus (Horse)		troponin complex [GO:0005861]	actin binding [GO:0003779]	RRSSANYR	0.96655	0.0085761	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2232.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PLE1	F6PLE1_HORSE	Chromosome 3 C16orf86 homolog	C3H16orf86	Equus caballus (Horse)				ASAGAEK	0.88769	0.44652	0	0	0	0	455.37	520.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	375.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PN36	F6PN36_HORSE	"Ring finger protein, transmembrane 2"	RNFT2	Equus caballus (Horse)	positive regulation of ERAD pathway [GO:1904294]	membrane [GO:0016020]	metal ion binding [GO:0046872]; ubiquitin protein ligase activity [GO:0061630]	SLVPIQLWYK	0.9622	-0.14669	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	403.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PNM7	F6PNM7_HORSE	X-ray repair cross complementing 6	XRCC6	Equus caballus (Horse)	DNA recombination [GO:0006310]; double-strand break repair via nonhomologous end joining [GO:0006303]; telomere maintenance [GO:0000723]	Ku70:Ku80 complex [GO:0043564]	ATP binding [GO:0005524]; damaged DNA binding [GO:0003684]; DNA helicase activity [GO:0003678]; hydrolase activity [GO:0016787]; telomeric DNA binding [GO:0042162]	RVLELDRLK	0.96053	-0.018323	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	302.55	0	0	0	0	0	0	0	0	438.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	382.49	0	0	0	0	417.08	0	0	0	0	0	0	0	0	0	0	0	0
F6PP00	F6PP00_HORSE	Sulfotransferase (EC 2.8.2.-)	HS3ST5	Equus caballus (Horse)	"heparan sulfate proteoglycan biosynthetic process, enzymatic modification [GO:0015015]; negative regulation of coagulation [GO:0050819]; regulation of viral entry into host cell [GO:0046596]"		[heparan sulfate]-glucosamine 3-sulfotransferase 1 activity [GO:0008467]	AISDYTQVLEGK	0.36318	0.75764	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	815.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PQ46	F6PQ46_HORSE	Ceruloplasmin	CP	Equus caballus (Horse)	copper ion transport [GO:0006825]; iron ion transport [GO:0006826]	extracellular space [GO:0005615]; plasma membrane [GO:0005886]	copper ion binding [GO:0005507]; oxidoreductase activity [GO:0016491]; protein-folding chaperone binding [GO:0051087]	DIASGLIGPLIVCK	0	11.214	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	513.11	0	0	0	0	0	449.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PRU6	F6PRU6_HORSE	Myosin IF	MYO1F	Equus caballus (Horse)	actin filament organization [GO:0007015]; vesicle transport along actin filament [GO:0030050]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; microvillus [GO:0005902]; myosin complex [GO:0016459]; plasma membrane [GO:0005886]; vesicle [GO:0031982]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; microfilament motor activity [GO:0000146]	TIQKAWRR	0.96632	-0.039381	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1765	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PSS0	F6PSS0_HORSE	Ribosome biogenesis regulatory protein	RRS1	Equus caballus (Horse)	"endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000447]; mitotic metaphase chromosome alignment [GO:0007080]; protein localization to nucleolus [GO:1902570]; regulation of signal transduction by p53 class mediator [GO:1901796]; ribosomal large subunit assembly [GO:0000027]; ribosomal large subunit biogenesis [GO:0042273]"	"condensed nuclear chromosome [GO:0000794]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; preribosome, large subunit precursor [GO:0030687]"	5S rRNA binding [GO:0008097]	VSTASVGRFQER	0.98743	-1.8132	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1144.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PW44	F6PW44_HORSE	MAGE domain-containing protein		Equus caballus (Horse)	negative regulation of transcription by RNA polymerase II [GO:0000122]	nucleus [GO:0005634]		AQTKVMR	0.98799	-1.777	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1930.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PWP1	F6PWP1_HORSE	Transcription factor E2F7	E2F7	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]	LQEQLSPGSR	0.31551	0.8067	0	0	297.78	0	0	0	0	0	0	0	0	0	0	0	0	0	656.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PXV9	F6PXV9_HORSE	Nitric oxide synthase (EC 1.14.13.39)	NOS2	Equus caballus (Horse)	arginine catabolic process [GO:0006527]; cellular response to lipopolysaccharide [GO:0071222]; cellular response to type II interferon [GO:0071346]; cellular response to xenobiotic stimulus [GO:0071466]; circadian rhythm [GO:0007623]; defense response to bacterium [GO:0042742]; inflammatory response [GO:0006954]; negative regulation of blood pressure [GO:0045776]; negative regulation of gene expression [GO:0010629]; negative regulation of protein catabolic process [GO:0042177]; nitric oxide biosynthetic process [GO:0006809]; nitric oxide mediated signal transduction [GO:0007263]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of killing of cells of another organism [GO:0051712]; prostaglandin secretion [GO:0032310]; regulation of cell population proliferation [GO:0042127]; regulation of cytokine production involved in inflammatory response [GO:1900015]; regulation of insulin secretion [GO:0050796]; response to hormone [GO:0009725]; response to hypoxia [GO:0001666]; response to lipopolysaccharide [GO:0032496]; superoxide metabolic process [GO:0006801]	cortical cytoskeleton [GO:0030863]; cytosol [GO:0005829]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; peroxisome [GO:0005777]; plasma membrane [GO:0005886]	arginine binding [GO:0034618]; calmodulin binding [GO:0005516]; flavin adenine dinucleotide binding [GO:0050660]; FMN binding [GO:0010181]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; NADP binding [GO:0050661]; nitric-oxide synthase activity [GO:0004517]; protein homodimerization activity [GO:0042803]; tetrahydrobiopterin binding [GO:0034617]	AQSAPGK	0.96104	-0.0078273	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	495.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PYT5	F6PYT5_HORSE	Transmembrane channel-like protein	TMC8	Equus caballus (Horse)		plasma membrane [GO:0005886]	mechanosensitive monoatomic ion channel activity [GO:0008381]	ALPYAMVDK	0.97356	-0.19798	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	707.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6PZC1	F6PZC1_HORSE	histone acetyltransferase (EC 2.3.1.48)	CREBBP	Equus caballus (Horse)	positive regulation of transcription by RNA polymerase II [GO:0045944]; response to stimulus [GO:0050896]; rhythmic process [GO:0048511]	cytoplasm [GO:0005737]; histone acetyltransferase complex [GO:0000123]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	chromatin DNA binding [GO:0031490]; DNA-binding transcription factor binding [GO:0140297]; histone acetyltransferase activity [GO:0004402]; transcription coactivator activity [GO:0003713]; zinc ion binding [GO:0008270]	FSAKRLQTTR	0.96738	-0.17061	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3089.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Q0L7	F6Q0L7_HORSE	Transporter	SLC6A20	Equus caballus (Horse)	glycine import across plasma membrane [GO:1903804]; L-proline import across plasma membrane [GO:1904271]; sodium ion transmembrane transport [GO:0035725]	apical plasma membrane [GO:0016324]	L-proline transmembrane transporter activity [GO:0015193]; proline:sodium symporter activity [GO:0005298]	GAWRPRSK	0.9854	-1.1643	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	461.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Q431	F6Q431_HORSE	KIAA0100	KIAA0100	Equus caballus (Horse)		membrane [GO:0016020]		GLQVEASDTCAQCLSR	0.96553	-0.090921	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1875.6	1627.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2907.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Q5B2	F6Q5B2_HORSE	Cordon-bleu WH2 repeat protein like 1	COBLL1	Equus caballus (Horse)			actin monomer binding [GO:0003785]	VILKPKILDKK	0.97644	0.11441	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1110.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Q5G9	F6Q5G9_HORSE	ETS variant transcription factor 2	ETV2	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; sequence-specific DNA binding [GO:0043565]"	ATSARYPK	0.98851	-1.0494	0	0	0	0	0	0	0	0	0	0	0	657.01	0	0	0	560.62	722.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	420.5	0	0	0	0	0	0	0	0	0	0	319.89	0	0	552.72	0	0	0	0	0	0	0
F6Q8R0	F6Q8R0_HORSE	Oncoprotein induced transcript 3	OIT3	Equus caballus (Horse)			calcium ion binding [GO:0005509]	EALPTLK	0.9672	0.1822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	637.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QBA4	F6QBA4_HORSE	Euchromatic histone lysine methyltransferase 2	EHMT2	Equus caballus (Horse)	DNA methylation [GO:0006306]; negative regulation of transcription by RNA polymerase II [GO:0000122]	chromatin [GO:0000785]; nucleus [GO:0005634]	histone H3K9 methyltransferase activity [GO:0046974]; p53 binding [GO:0002039]; zinc ion binding [GO:0008270]	GLMRARGR	0.98349	-0.2288	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	637.15	0	0	0	0	0	0	0	1364.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QC51	F6QC51_HORSE	CUGBP Elav-like family member 5	CELF5	Equus caballus (Horse)	"mRNA splice site recognition [GO:0006376]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]"	cytoplasm [GO:0005737]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]	mRNA binding [GO:0003729]	AQTALHEQK	0.99001	-1.6406	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	983.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QCD9	F6QCD9_HORSE	ethanolamine-phosphate cytidylyltransferase (EC 2.7.7.14) (CTP:phosphoethanolamine cytidylyltransferase)	PCYT2	Equus caballus (Horse)	phosphatidylethanolamine biosynthetic process [GO:0006646]		ethanolamine-phosphate cytidylyltransferase activity [GO:0004306]	TEVMPDK	0.96145	0.23068	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	280.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QD97	F6QD97_HORSE	RNA polymerase III subunit D	POLR3D	Equus caballus (Horse)	tRNA transcription by RNA polymerase III [GO:0042797]	RNA polymerase III complex [GO:0005666]	DNA binding [GO:0003677]	KTPGLPK	0.55396	0.64803	1625.2	2184.9	1973.6	1813.8	1824.4	1860.7	2704.2	2708.4	0	3357.3	5172.1	4175.2	2142.8	2133.7	2108.3	0	0	0	1860.2	0	2454.2	2136	2160.6	1983.7	1748.2	1729.9	1562	0	0	0	0	0	0	0	0	0	2188.9	0	0	0	0	0	1729.4	1737.6	1849.9	0	0	0	0	2488.6	0	1880.8	0	0	0	0	1422.4	0	0	0	1547.6	2680.4	2316.9	0	0	1829.7	2353.6	3246.3	1909.3	4460.5	4590.7	7014.5	2711.4	0	3330.3
F6QDY1	F6QDY1_HORSE	phosphoinositide 5-phosphatase (EC 3.1.3.36)	SYNJ2	Equus caballus (Horse)	phosphatidylinositol dephosphorylation [GO:0046856]		"phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity [GO:0004439]; RNA binding [GO:0003723]"	DFGHWVTVSDKDKR	0.98513	-1.4857	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1899.4	0	0	0	0	0	0	0	0	0	0	0	0	4232.7	687.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QEG1	F6QEG1_HORSE	Neural retina leucine zipper	NRL	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]; retinal rod cell development [GO:0046548]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	QLRGCGR	0.67964	0.60618	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6186.3	6424.1	3660.1	0	4824.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1044	977.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QEN8	F6QEN8_HORSE	Chromosome 1 C15orf39 homolog	C1H15orf39	Equus caballus (Horse)		cytosol [GO:0005829]		GVPAGGSGK	0.8907	0.33314	0	0	0	0	0	0	0	1330.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1694.8	1687	2035.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	352.95	0	0	0	0	350.21	0	0	0	0	0
F6QIR9	F6QIR9_HORSE	PAX-interacting protein 1 (PAX transactivation activation domain-interacting protein)	PAXIP1	Equus caballus (Horse)	positive regulation of transcription initiation by RNA polymerase II [GO:0060261]	nucleus [GO:0005634]		MSSWRPR	0.97001	-0.032923	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	381.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QJ96	F6QJ96_HORSE	Dystonin	DST	Equus caballus (Horse)	intermediate filament cytoskeleton organization [GO:0045104]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	calcium ion binding [GO:0005509]; microtubule binding [GO:0008017]	EKADQLVERWQNVHVQIDNR	0.98558	-2.0336	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	510.71	594.91	0	0	0	0	0	0	0	0	0	0	0	0	1349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QKD5	F6QKD5_HORSE	Coiled-coil domain containing 136	CCDC136	Equus caballus (Horse)	acrosome assembly [GO:0001675]; single fertilization [GO:0007338]	acrosomal membrane [GO:0002080]		DMVASFQESCEK	0.96574	-0.084154	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2581.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QLP1	F6QLP1_HORSE	Vasopressin V1a receptor	AVPR1A	Equus caballus (Horse)	cellular response to hormone stimulus [GO:0032870]; G protein-coupled receptor signaling pathway [GO:0007186]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of vasoconstriction [GO:0045907]; regulation of systemic arterial blood pressure by vasopressin [GO:0001992]	endocytic vesicle [GO:0030139]; endosome [GO:0005768]; plasma membrane [GO:0005886]	peptide binding [GO:0042277]; vasopressin receptor activity [GO:0005000]	TASRQDK	0.98861	-1.8004	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	864.11	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QLX7	F6QLX7_HORSE	Integrin subunit alpha 5	ITGA5	Equus caballus (Horse)	cell adhesion [GO:0007155]; integrin-mediated signaling pathway [GO:0007229]	integrin complex [GO:0008305]		LLVCDLGNPMK	0.355	0.76239	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	489.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QMX1	F6QMX1_HORSE	choline-phosphate cytidylyltransferase (EC 2.7.7.15)	PCYT1A	Equus caballus (Horse)		endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; glycogen granule [GO:0042587]; nucleus [GO:0005634]	choline-phosphate cytidylyltransferase activity [GO:0004105]; identical protein binding [GO:0042802]; phosphatidylcholine binding [GO:0031210]	AAAYDIRYSYLEQSK	0.95655	0.23238	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	906.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QNW9	F6QNW9_HORSE	Chromosome 8 C18orf63 homolog	C8H18orf63	Equus caballus (Horse)				TVHRSKR	0.9651	-0.093207	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	713.83	0	0	0	0
F6QPF5	F6QPF5_HORSE	Leucine rich repeat transmembrane neuronal 1	LRRTM1	Equus caballus (Horse)		extracellular matrix [GO:0031012]; extracellular space [GO:0005615]; membrane [GO:0016020]		SLARNSFAGLFK	0.9879	-1.7217	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	637.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QQT6	F6QQT6_HORSE	Fibrinogen C-terminal domain-containing protein	LOC100069029	Equus caballus (Horse)				GDTGATGGR	0.94598	0.24227	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	380.67	325.57	0	0	0	0	0	0	1449	0	0	0	0	0	1235.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1266.3	1215.4	1306.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QS02	F6QS02_HORSE	Secreted frizzled related protein 5	SFRP5	Equus caballus (Horse)	canonical Wnt signaling pathway [GO:0060070]; cell differentiation [GO:0030154]; digestive tract morphogenesis [GO:0048546]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of non-canonical Wnt signaling pathway [GO:2000051]; negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [GO:0051898]; non-canonical Wnt signaling pathway [GO:0035567]; regulation of transcription by RNA polymerase II [GO:0006357]	extracellular space [GO:0005615]	Wnt-protein binding [GO:0017147]	IENGERK	0.98272	-0.94753	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2547.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QT81	F6QT81_HORSE	RNA-directed DNA polymerase (EC 2.7.7.49)		Equus caballus (Horse)				EDLIPILFKLFQK	0.84363	0.48859	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5683.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1161.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QTM4	F6QTM4_HORSE	Chromosome 13 C16orf90 homolog	C13H16orf90	Equus caballus (Horse)				SWGASEESTCPLCKR	0.98399	-0.77893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	624.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QU99	F6QU99_HORSE	Solute carrier family 17 member 6	SLC17A6	Equus caballus (Horse)	"monoatomic anion transport [GO:0006820]; neurotransmitter loading into synaptic vesicle [GO:0098700]; phosphate ion homeostasis [GO:0055062]; regulation of synapse structure or activity [GO:0050803]; synaptic transmission, glutamatergic [GO:0035249]"	excitatory synapse [GO:0060076]; synaptic vesicle membrane [GO:0030672]	L-glutamate transmembrane transporter activity [GO:0005313]; L-glutamate uniporter activity [GO:0140788]; neurotransmitter transmembrane transporter activity [GO:0005326]	QRILTPGKEGLK	0.98485	-0.23845	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1789.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QV50	F6QV50_HORSE	Secretogranin-2 (Secretogranin II)	SCG2	Equus caballus (Horse)		extracellular region [GO:0005576]; secretory granule [GO:0030141]		LTGPNNQKR	0.98037	-0.52776	0	0	0	0	0	0	854.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1518	1459.8	0	0	0	0	0	0	0	0	0	0	0	0	0	684.92	0	0	0	0	0	0	0	0	0	680.8	532.55	0	0	0	0	0	0	873.76	0	0	0	0
F6QVG5	F6QVG5_HORSE	Homeobox B5	HOXB5	Equus caballus (Horse)	anterior/posterior pattern specification [GO:0009952]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	LSGWDNIIGK	0.86213	0.47013	1106.7	418.45	825.84	688.54	655.75	699.99	0	1068	1010.2	1066.8	557.57	517.4	854.21	766.06	0	0	0	0	531.29	749.92	538.2	459.73	461.19	0	317.67	343.37	488.48	0	0	0	0	0	0	0	0	0	707.61	0	777.48	0	0	0	0	0	0	0	0	0	0	734.03	650.04	464.23	518.94	504.57	0	506.95	0	0	0	0	382.58	0	636.07	478.97	370.9	739.79	453.99	534.3	447.65	668.72	526.79	473.9	290.73	0	0
F6QWB9	F6QWB9_HORSE	Nuclear receptor interacting protein 1	NRIP1	Equus caballus (Horse)	cellular response to estradiol stimulus [GO:0071392]; circadian regulation of gene expression [GO:0032922]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of transcription by RNA polymerase II [GO:0045944]	nucleus [GO:0005634]	nuclear estrogen receptor binding [GO:0030331]; nuclear glucocorticoid receptor binding [GO:0035259]; nuclear retinoid X receptor binding [GO:0046965]; signaling receptor binding [GO:0005102]; transcription coactivator activity [GO:0003713]; transcription corepressor activity [GO:0003714]	DVGSFQLSK	0.98278	-0.81052	0	0	0	0	612.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QXG5	F6QXG5_HORSE	3-oxoacid CoA-transferase 2	OXCT2	Equus caballus (Horse)		extracellular space [GO:0005615]	cytokine activity [GO:0005125]; growth factor activity [GO:0008083]	RPGHELR	0.95976	0.21518	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	484.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QXI1	F6QXI1_HORSE	Attractin like 1	ATRNL1	Equus caballus (Horse)		membrane [GO:0016020]	Notch binding [GO:0005112]	GIKGDQCQLCDSENR	0.90556	0.32112	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	720.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QXY2	F6QXY2_HORSE	Alpha-centractin	ACTR1A	Equus caballus (Horse)		centrosome [GO:0005813]; cytoplasm [GO:0005737]		GWEVLVLK	0.96657	0.0085679	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2198	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3958.1	0	0	2538.4	0	3060
F6QY61	F6QY61_HORSE	Tyrosine-protein kinase (EC 2.7.10.2)	TEC	Equus caballus (Horse)	adaptive immune response [GO:0002250]; intracellular signal transduction [GO:0035556]; phosphorylation [GO:0016310]	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; non-membrane spanning protein tyrosine kinase activity [GO:0004715]	ALPPAPETKKR	0.97397	-0.19018	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1078.2	0	0	0	0	0	0	0
F6QYR2	F6QYR2_HORSE	Protein disulfide isomerase family A member 2	PDIA2	Equus caballus (Horse)	protein folding [GO:0006457]; response to endoplasmic reticulum stress [GO:0034976]	endoplasmic reticulum [GO:0005783]	protein disulfide isomerase activity [GO:0003756]; protein-disulfide reductase activity [GO:0015035]	RQEFRAGGF	0.96198	-0.14694	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2227.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6QZJ3	F6QZJ3_HORSE	Zinc finger protein 513	ZNF513	Equus caballus (Horse)	positive regulation of transcription by RNA polymerase II [GO:0045944]; retina development in camera-type eye [GO:0060041]	nucleus [GO:0005634]	transcription cis-regulatory region binding [GO:0000976]	VGLEPVTMPR	0.96228	-0.14492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	636.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6R449	F6R449_HORSE	"Proteasome 26S subunit, ATPase 3"	PSMC3	Equus caballus (Horse)	modulation by host of viral transcription [GO:0043921]; positive regulation of transcription by RNA polymerase II [GO:0045944]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]	"nucleus [GO:0005634]; proteasome regulatory particle, base subcomplex [GO:0008540]"	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; identical protein binding [GO:0042802]; proteasome-activating activity [GO:0036402]	ATVWDEAEVRAGR	0.92563	0.28255	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1109.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17994	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6R4Q2	F6R4Q2_HORSE	MICOS complex subunit MIC13	MICOS13 C7H19orf70	Equus caballus (Horse)	cristae formation [GO:0042407]	MICOS complex [GO:0061617]; mitochondrial crista junction [GO:0044284]; nucleoplasm [GO:0005654]		AGPEPPR	0.97001	0.035024	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	744.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2435.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6R6X2	F6R6X2_HORSE	Condensin complex subunit 2	NCAPH	Equus caballus (Horse)	cell division [GO:0051301]; mitotic chromosome condensation [GO:0007076]	condensin complex [GO:0000796]; cytoplasm [GO:0005737]	chromatin binding [GO:0003682]	LTKDLQK	0.98577	-2.9806	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	388.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6R7C5	F6R7C5_HORSE	Coiled-coil domain-containing protein 39	CCDC39	Equus caballus (Horse)	cilium movement [GO:0003341]; inner dynein arm assembly [GO:0036159]	axoneme [GO:0005930]		LTLECNQR	0.13725	1.1765	1234.4	0	1022.3	1463.9	0	0	1642.6	0	0	1226.9	0	0	3639.1	3612.6	3838.4	10036	0	0	776.22	0	0	1007.1	952.25	990.33	0	1079.3	0	0	0	0	0	5523.2	5484.5	0	0	0	0	4915.9	0	0	0	0	0	0	0	4870.6	0	0	0	0	0	998.09	0	0	1166.2	0	1258.5	0	0	7638.3	874.94	1970	1840.5	0	1608.6	1706.2	0	0	2404.2	0	0	5168.1	0	1399.1	0
F6R7D5	F6R7D5_HORSE	"Complex I intermediate-associated protein 30, mitochondrial (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 1)"	NDUFAF1	Equus caballus (Horse)	"mitochondrial electron transport, NADH to ubiquinone [GO:0006120]; mitochondrial respiratory chain complex I assembly [GO:0032981]"	mitochondrion [GO:0005739]	unfolded protein binding [GO:0051082]	QTPYDFTHMWKINK	0.98737	-1.8485	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	657.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6R7I4	F6R7I4_HORSE	Leishmanolysin-like peptidase (EC 3.4.24.-)	LMLN	Equus caballus (Horse)	cell adhesion [GO:0007155]; proteolysis [GO:0006508]	cytoplasm [GO:0005737]; membrane [GO:0016020]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]; peptidase activity [GO:0008233]	IVPHTVYLLVTPR	0.98511	-1.4711	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3344.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6R8W6	F6R8W6_HORSE	SFI1 centrin binding protein	SFI1	Equus caballus (Horse)				GCLRTWFQRWR	0.98842	-1.0806	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2007	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6R9D2	F6R9D2_HORSE	Tyrosine-protein kinase receptor (EC 2.7.10.1)	INSR	Equus caballus (Horse)	phosphorylation [GO:0016310]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	membrane [GO:0016020]	ATP binding [GO:0005524]; insulin receptor substrate binding [GO:0043560]; phosphatidylinositol 3-kinase binding [GO:0043548]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	CSVAAYVSARTMPEAK	0.91091	0.3172	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	553.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6R9E6	F6R9E6_HORSE	Sperm antigen with calponin homology and coiled-coil domains 1	SPECC1	Equus caballus (Horse)	associative learning [GO:0008306]; blastocyst development [GO:0001824]	apical part of cell [GO:0045177]; cytosol [GO:0005829]; fibrillar center [GO:0001650]; nucleoplasm [GO:0005654]		SSTSLAFESR	0.98565	-1.946	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1651.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RAH0	F6RAH0_HORSE	MARVEL domain containing 2	MARVELD2	Equus caballus (Horse)		bicellular tight junction [GO:0005923]; plasma membrane [GO:0005886]		AENQQEHER	0.96738	-0.073194	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1323.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RAH7	F6RAH7_HORSE	Eyes shut homolog	EYS	Equus caballus (Horse)	detection of light stimulus involved in visual perception [GO:0050908]; establishment or maintenance of epithelial cell apical/basal polarity [GO:0045197]; heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules [GO:0007157]; skeletal muscle tissue regeneration [GO:0043403]	plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]	calcium ion binding [GO:0005509]	FFFLDRGER	0.97197	-0.1822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	648.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RBT1	F6RBT1_HORSE	Eosinophil peroxidase	EPX	Equus caballus (Horse)	defense response to bacterium [GO:0042742]; defense response to nematode [GO:0002215]; eosinophil migration [GO:0072677]; negative regulation of interleukin-10 production [GO:0032693]; negative regulation of interleukin-5 production [GO:0032714]; negative regulation of macrophage cytokine production [GO:0010936]; organic substance metabolic process [GO:0071704]; positive regulation of interleukin-4 production [GO:0032753]; response to oxidative stress [GO:0006979]	extracellular space [GO:0005615]	heme binding [GO:0020037]; metal ion binding [GO:0046872]; peroxidase activity [GO:0004601]	ALRRVSLSR	0.98565	-1.9398	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1203.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RDV9	F6RDV9_HORSE	SAGA complex associated factor 29	SGF29	Equus caballus (Horse)			catalytic activity [GO:0003824]	ERHTLSRR	0.9856	-2.0744	0	431.79	0	0	557.67	476.24	0	0	1006.4	0	511.78	0	879.95	0	0	0	0	0	0	982.84	0	0	0	0	0	470.6	420.37	0	4153.9	3730.2	0	0	0	4301.2	0	0	0	0	1832.4	0	0	0	0	0	717.09	0	0	0	0	0	935.8	0	0	0	0	0	751.71	0	3028.8	0	529.85	0	0	532.55	0	0	0	0	0	0	873.76	0	0	647.21	0
F6RFH9	F6RFH9_HORSE	Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (U11/U12 small nuclear ribonucleoprotein 31 kDa protein)	ZCRB1	Equus caballus (Horse)	"mRNA splicing, via spliceosome [GO:0000398]"	U12-type spliceosomal complex [GO:0005689]	RNA binding [GO:0003723]; zinc ion binding [GO:0008270]	GVAFILFLDK	0.96468	-0.15083	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	452.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RG72	F6RG72_HORSE	NADPH oxidase 3	NOX3	Equus caballus (Horse)	defense response [GO:0006952]; detection of gravity [GO:0009590]; otolith development [GO:0048840]; superoxide anion generation [GO:0042554]; temperature homeostasis [GO:0001659]	cytoplasm [GO:0005737]; NADPH oxidase complex [GO:0043020]; plasma membrane [GO:0005886]	heme binding [GO:0020037]; superoxide-generating NAD(P)H oxidase activity [GO:0016175]	AAGDWTEALCKAFGAEGQALK	0.95763	0.22912	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2660.4	0	0	0	1582.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	602.43	0
F6RGJ5	F6RGJ5_HORSE	Y-box binding protein 1		Equus caballus (Horse)				QNMYRGYRPR	0.95664	0.22356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	556.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RHE9	F6RHE9_HORSE	Spectrin repeat containing nuclear envelope protein 1	SYNE1	Equus caballus (Horse)		membrane [GO:0016020]; nuclear envelope [GO:0005635]		AIHEYLQK	0.9838	-0.77896	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	518.89	0	0	0	0	0	0	0	0	0	0	0	0	0	0	428.51	0	0	0	0	0	0	0	640.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	929.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RI47	F6RI47_HORSE	Alpha-2-macroglobulin	A2M	Equus caballus (Horse)	"negative regulation of complement activation, lectin pathway [GO:0001869]"	extracellular space [GO:0005615]	calcium-dependent protein binding [GO:0048306]; interleukin-1 binding [GO:0019966]; interleukin-8 binding [GO:0019959]; protease binding [GO:0002020]; serine-type endopeptidase inhibitor activity [GO:0004867]; signaling receptor binding [GO:0005102]; tumor necrosis factor binding [GO:0043120]	AEHPFIVEEFVLPK	0	323.31	16256	20219	15583	12467	10427	9417.9	36594	33483	33427	10144	39290	44982	44627	45772	43791	150710	151560	154800	11763	60736	52212	16012	17963	15325	8584.7	9494.3	10615	96378	89302	87860	97109	93440	84684	110830	108360	71285	42737	71472	68772	183180	149910	142010	42814	38491	31773	93253	96964	86036	73082	70680	66901	49121	132270	119780	56734	52807	50267	87898	80612	85804	31995	81531	84023	34913	28689	25317	80287	73760	69890	27321	49515	41508	16138	15363	16045
F6RIJ7	F6RIJ7_HORSE	Zinc finger protein 544	ZNF544	Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]		metal ion binding [GO:0046872]	DVAVTFTR	0.96121	-0.013779	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	614.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RJK1	F6RJK1_HORSE	E3 ubiquitin-protein ligase CBL (EC 2.3.2.27)	CBL	Equus caballus (Horse)	cell surface receptor signaling pathway [GO:0007166]; protein ubiquitination [GO:0016567]; proteolysis [GO:0006508]; regulation of signaling [GO:0023051]; signal transduction [GO:0007165]	membrane raft [GO:0045121]; plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]; phosphotyrosine residue binding [GO:0001784]; receptor tyrosine kinase binding [GO:0030971]; SH3 domain binding [GO:0017124]; ubiquitin protein ligase activity [GO:0061630]	GTEPIVVDPFDPR	0.96641	-0.10164	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1124.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RKR3	F6RKR3_HORSE	Rho guanine nucleotide exchange factor 26	ARHGEF26	Equus caballus (Horse)	endothelial cell morphogenesis [GO:0001886]; ruffle assembly [GO:0097178]		guanyl-nucleotide exchange factor activity [GO:0005085]	LCNEGARKMER	0.36792	0.74116	15381	20019	19512	16446	18263	17754	26129	0	28740	30240	48702	39529	22758	24788	0	0	0	511.94	16522	22521	21382	20566	20796	19427	16302	17404	15858	0	723.35	0	0	1341.5	1336.1	2956.7	2943.5	1164.4	20277	0	24641	0	486.01	0	14146	14083	14113	594.24	0	0	33170	29031	0	22759	27468	27998	0	15458	19314	0	787.47	0	16194	0	20071	16789	9824.8	8989.6	14687	16367	15966	46569	37720	0	34303	0	33490
F6RLT1	F6RLT1_HORSE	"Small ribosomal subunit protein bS6m (28S ribosomal protein S6, mitochondrial)"	MRPS6	Equus caballus (Horse)	translation [GO:0006412]	mitochondrial small ribosomal subunit [GO:0005763]	small ribosomal subunit rRNA binding [GO:0070181]; structural constituent of ribosome [GO:0003735]	GAAALRRGR	0.96654	-0.15413	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	594.1	5966.7	0	0	0	0	0	0	4960.2	0	802.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RLV7	F6RLV7_HORSE	Cytohesin 4	CYTH4	Equus caballus (Horse)	regulation of ARF protein signal transduction [GO:0032012]	centriolar satellite [GO:0034451]; cytosol [GO:0005829]; intercellular bridge [GO:0045171]; plasma membrane [GO:0005886]	guanyl-nucleotide exchange factor activity [GO:0005085]	VEGPVRVK	0.9857	-1.497	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	571.68	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1510.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RLZ3	F6RLZ3_HORSE	Regulatory factor X5	RFX5	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]		"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	APRSLIPPIR	0.9884	-1.2742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	819.4	708.34	652.71	0	0	0	0	0	0	1313	0	1295	0	0	0	0	0	0
F6RM45	F6RM45_HORSE	"Ras homolog family member F, filopodia associated"	RHOF	Equus caballus (Horse)	actin filament organization [GO:0007015]; cell migration [GO:0016477]; signal transduction [GO:0007165]; small GTPase mediated signal transduction [GO:0007264]	cytosol [GO:0005829]; plasma membrane [GO:0005886]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]; protein kinase binding [GO:0019901]	VTPLAPAR	0.97401	0.12166	0	8258.3	5389.6	6013.9	0	6754.1	30627	32633	33587	5782.1	20898	17660	31812	32007	32701	20039	0	17192	7525	29066	24789	0	0	0	1659.8	4918.2	4970.2	44714	0	47319	0	426.12	626.08	46349	622.89	33582	8504	0	31949	0	0	43548	19348	1074.5	1207.7	830.27	27722	28826	32816	32444	32847	4577.3	20362	19877	831.67	0	0	0	0	35308	10417	23492	706.92	8583.5	8153.7	8228.1	20412	753.95	20497	9158.3	28069	26900	11835	8653.1	9108.1
F6RMT8	F6RMT8_HORSE	Adhesion G protein-coupled receptor E2	LOC100064454	Equus caballus (Horse)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; cell surface receptor signaling pathway [GO:0007166]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	AVSDASK	0.98734	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	641.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RNL5	F6RNL5_HORSE	Bystin like	BYSL	Equus caballus (Horse)	"maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000462]; rRNA processing [GO:0006364]; stem cell proliferation [GO:0072089]; trophectodermal cell differentiation [GO:0001829]"	"apical part of cell [GO:0045177]; chromosome [GO:0005694]; cytoplasm [GO:0005737]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; preribosome, small subunit precursor [GO:0030688]"	snoRNA binding [GO:0030515]	RELQSAVPR	0.98269	-0.93612	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	682.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RP34	F6RP34_HORSE	Chloride channel protein	CLCN1	Equus caballus (Horse)	chloride transport [GO:0006821]; muscle contraction [GO:0006936]; neuronal action potential propagation [GO:0019227]	sarcolemma [GO:0042383]	protein homodimerization activity [GO:0042803]; voltage-gated chloride channel activity [GO:0005247]	LSELPYDGK	0.98757	-1.8195	0	0	0	0	0	0	0	0	0	0	0	0	0	1758.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RR40	F6RR40_HORSE	Membrane frizzled-related protein	MFRP	Equus caballus (Horse)		cell projection [GO:0042995]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]		TARASTMR	0.98874	-1.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	608.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RT52	F6RT52_HORSE	KDEL endoplasmic reticulum protein retention receptor 1	KDELR1	Equus caballus (Horse)	endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; protein retention in ER lumen [GO:0006621]; protein transport [GO:0015031]	cis-Golgi network [GO:0005801]; COPI-coated vesicle membrane [GO:0030663]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]	ER retention sequence binding [GO:0046923]	IWKSRSCAGISGK	0.92129	0.29381	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	457.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RU57	F6RU57_HORSE	Dedicator of cytokinesis 8	DOCK8	Equus caballus (Horse)	small GTPase mediated signal transduction [GO:0007264]	cellular anatomical entity [GO:0110165]	guanyl-nucleotide exchange factor activity [GO:0005085]	ILVKLLTLK	0.91137	0.29669	550.04	388.34	372.65	316.64	355.29	355.95	0	0	0	0	0	0	0	0	0	0	0	0	490.54	377.07	380.55	455.19	503.07	463.49	474.11	397.17	339.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	321.74	0	319.31	0	0	0	0	0	0	0	849.48	847.18	920.54	930.6	944.62	963.28	0	0	0	421.13	403.57	659.67	508.41	501.58	515.56	452	832.21	474.85	300.23	318.8	337.32	0	0	0
F6RW42	F6RW42_HORSE	Neuromedin S	NMS	Equus caballus (Horse)		membrane [GO:0016020]		SIEDNAG	0.98999	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1834.3	1936.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	641.61	0	0	0	0	0	0	0	0	697.84	1402.9	1389.1	0	0	0	0	0	0	0	0	0	597.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RXF0	F6RXF0_HORSE	Glutamate receptor interacting protein 1	GRIP1	Equus caballus (Horse)	"neurotransmitter receptor transport, endosome to postsynaptic membrane [GO:0098887]"			CQILRRLTK	0.99167	-1.2225	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	594.62	0	0	0	0	0	0	0	0	0	0	967.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RY17	F6RY17_HORSE	SEC14 like lipid binding 5	SEC14L5	Equus caballus (Horse)		cytoplasm [GO:0005737]		MVQKYQSPIR	0.98976	-1.2653	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	980.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6RYC9	F6RYC9_HORSE	Protein FMC1 homolog	FMC1	Equus caballus (Horse)		mitochondrion [GO:0005739]		KGPAVSGK	0.20168	1.0685	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19404	0	0	0	0	0	0	0	0
F6RYP5	F6RYP5_HORSE	Aminomethyltransferase	AMT	Equus caballus (Horse)	glycine catabolic process [GO:0006546]	mitochondrion [GO:0005739]	aminomethyltransferase activity [GO:0004047]	AVSMVARLGLR	0.98856	-1.8939	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	321.05	0	0	0	421.87	0	0	0	0	0	0	0	0	0	0	348.47	0	378.6	0	0	0	0	0	0
F6S098	F6S098_HORSE	Interleukin 4 induced 1	IL4I1	Equus caballus (Horse)	amino acid catabolic process [GO:0009063]		L-amino-acid oxidase activity [GO:0001716]; polyamine oxidase activity [GO:0046592]	ISFSPPLSR	0.14	1.1906	0	0	0	0	0	0	310.76	0	0	0	0	0	0	363.9	0	0	0	0	0	0	0	0	0	0	0	0	0	1254.6	0	0	0	0	0	1668.7	0	1587.8	0	0	404.65	0	1368.2	0	0	0	0	895.49	0	0	0	0	0	0	0	0	0	0	0	1067.3	1379.9	1313.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S0D9	F6S0D9_HORSE	Catenin delta 1	CTNND1	Equus caballus (Horse)	cell-cell adhesion [GO:0098609]			KSDFQVNLNNASR	0.98519	-2.3761	0	0	0	0	0	0	0	0	4765.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2476.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S0R4	F6S0R4_HORSE	KIAA0586	KIAA0586	Equus caballus (Horse)	smoothened signaling pathway [GO:0007224]			IGWNPERR	0.98155	-0.65679	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	554.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S2S2	F6S2S2_HORSE	Ribonuclease P protein subunit p20 (RNaseP protein p20)	POP7	Equus caballus (Horse)	rRNA processing [GO:0006364]; tRNA 5'-leader removal [GO:0001682]; tRNA processing [GO:0008033]	cytoplasm [GO:0005737]; nucleolar ribonuclease P complex [GO:0005655]; nucleus [GO:0005634]; ribonuclease MRP complex [GO:0000172]	nucleic acid binding [GO:0003676]; ribonuclease P activity [GO:0004526]	LLDGGAR	0.9687	-0.042663	0	0	0	0	0	0	0	0	0	0	851.89	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S2Y2	F6S2Y2_HORSE	NOP2 nucleolar protein	NOP2	Equus caballus (Horse)	maturation of LSU-rRNA [GO:0000470]; positive regulation of cell population proliferation [GO:0008284]; regulation of signal transduction by p53 class mediator [GO:1901796]; ribosomal large subunit assembly [GO:0000027]; rRNA base methylation [GO:0070475]	nucleolus [GO:0005730]	RNA binding [GO:0003723]; rRNA (cytosine-C5-)-methyltransferase activity [GO:0009383]	QQLHPKKATFR	0.97323	-0.21048	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	502.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S4Y2	F6S4Y2_HORSE	Apoptotic chromatin condensation inducer 1	ACIN1	Equus caballus (Horse)			nucleic acid binding [GO:0003676]	LSTFEGR	0.98613	-1.4182	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	483.99	522.14	0	0	0	0	0	0	0	0	0	0	0	0	0	769.62	562.72	671.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S525	F6S525_HORSE	BUD13 homolog	BUD13	Equus caballus (Horse)	"mRNA splicing, via spliceosome [GO:0000398]"	RES complex [GO:0070274]; U2-type spliceosomal complex [GO:0005684]		GVPSIHCVR	0.96778	-0.097568	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	435.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S589	F6S589_HORSE	Ubiquitin-like modifier-activating enzyme 5 (UFM1-activating enzyme)	UBA5	Equus caballus (Horse)		endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]	metal ion binding [GO:0046872]; ubiquitin-like modifier activating enzyme activity [GO:0008641]	ISNGGLEEGK	0.97404	0.1201	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	461.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S6D8	F6S6D8_HORSE	Sodium voltage-gated channel beta subunit 4	SCN4B	Equus caballus (Horse)	cardiac muscle cell action potential involved in contraction [GO:0086002]; regulation of ventricular cardiac muscle cell membrane repolarization [GO:0060307]	plasma membrane [GO:0005886]; voltage-gated sodium channel complex [GO:0001518]	sodium channel regulator activity [GO:0017080]; transmembrane transporter binding [GO:0044325]	NFRDSVLWDPGTDGSGVAPFSGR	0.93271	0.26153	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	801.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S7Z8	F6S7Z8_HORSE	HCLS1 associated protein X-1	HAX1	Equus caballus (Horse)	granulocyte colony-stimulating factor signaling pathway [GO:0038158]; negative regulation of apoptotic process [GO:0043066]; positive regulation of granulocyte differentiation [GO:0030854]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [GO:0051897]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of actin filament polymerization [GO:0030833]	actin cytoskeleton [GO:0015629]; apical plasma membrane [GO:0016324]; clathrin-coated vesicle [GO:0030136]; lamellipodium [GO:0030027]; mitochondrial intermembrane space [GO:0005758]; mitochondrial matrix [GO:0005759]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; sarcoplasmic reticulum [GO:0016529]; transcription regulator complex [GO:0005667]	interleukin-1 binding [GO:0019966]; signaling adaptor activity [GO:0035591]	LLSFRQRR	0.96459	-0.093211	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3425.7	3631.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S8Y7	F6S8Y7_HORSE	Cone-rod homeobox	CRX	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; leucine zipper domain binding [GO:0043522]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	QQRQQQK	0.98803	-1.7901	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3103.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S9D5	F6S9D5_HORSE	Aldehyde oxidase 4	AOX4	Equus caballus (Horse)			"2 iron, 2 sulfur cluster binding [GO:0051537]; FAD binding [GO:0071949]; iron ion binding [GO:0005506]; oxidoreductase activity [GO:0016491]"	LAAEEFNKK	0.98046	-0.58637	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	978.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6S9H9	F6S9H9_HORSE	Tektin	TEKT1	Equus caballus (Horse)	cilium assembly [GO:0060271]; cilium movement involved in cell motility [GO:0060294]; flagellated sperm motility [GO:0030317]	axonemal microtubule [GO:0005879]; microtubule cytoskeleton [GO:0015630]; motile cilium [GO:0031514]		EAPLLSLCSSSLWRR	0.98354	-0.70103	0	0	0	0	636.15	0	772.16	670.47	0	0	1425.6	0	0	0	649.04	0	1228.9	1331.9	0	0	0	0	0	0	0	0	0	868.65	0	1021.2	1958.2	0	0	2072.7	0	2148.9	0	925.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	607.12	710.02	0	0	0	0	0	0	629.23	0	0	1554.7	0	1210.8	0	0	993.35
F6SB11	F6SB11_HORSE	Cytochrome P450 family 27 subfamily C member 1	CYP27C1	Equus caballus (Horse)		membrane [GO:0016020]; mitochondrion [GO:0005739]	"all-trans retinal 3,4-desaturase activity [GO:0061897]; all-trans retinoic acid 3,4-desaturase activity [GO:0061898]; all-trans retinol 3,4-desaturase activity [GO:0061896]; all-trans-retinol binding [GO:1904768]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; retinoic acid binding [GO:0001972]"	SLAAMPGPR	0.96858	0.010164	0	0	0	0	0	0	0	1289.7	0	1332.9	0	0	0	0	0	0	2578.4	0	0	0	0	0	0	0	0	0	0	0	0	1728.9	0	1702.7	0	0	2938.5	2676.4	0	0	0	0	951.79	940.25	0	0	0	0	0	0	983.4	906.23	1058.7	0	0	0	0	0	0	0	0	596.45	0	0	0	0	0	0	0	0	0	0	1973.7	2139.5	0	0	0
F6SCB6	F6SCB6_HORSE	Nipsnap homolog 2	NIPSNAP2	Equus caballus (Horse)	mitochondrion organization [GO:0007005]; oxidative phosphorylation [GO:0006119]	mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]		ALLWPQR	0.96239	0.21734	0	0	0	0	0	0	0	0	0	0	0	0	0	0	489.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	980.13	0	0	0	0	0	0	0	0	0	0	1545.8	0	0	0	0	1630.6	1413.4	1483.6	0	0	779.44	0	0	0
F6SD16	F6SD16_HORSE	Hydroxymethylglutaryl-CoA synthase (HMG-CoA synthase) (EC 2.3.3.10) (3-hydroxy-3-methylglutaryl coenzyme A synthase)	HMGCS1	Equus caballus (Horse)	"acetyl-CoA metabolic process [GO:0006084]; cholesterol biosynthetic process [GO:0006695]; farnesyl diphosphate biosynthetic process, mevalonate pathway [GO:0010142]"		hydroxymethylglutaryl-CoA synthase activity [GO:0004421]	LVQKSLAR	0.89413	0.33389	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	365.05	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	616.28	0	814.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SD86	F6SD86_HORSE	Vascular endothelial growth factor C	VEGFC	Equus caballus (Horse)	positive regulation of cell division [GO:0051781]	extracellular region [GO:0005576]; membrane [GO:0016020]	growth factor activity [GO:0008083]; vascular endothelial growth factor receptor binding [GO:0005172]	EVCIDVGK	0.96475	-0.0053777	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	381.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SDB6	F6SDB6_HORSE	Chromosome 8 C18orf54 homolog	C8H18orf54	Equus caballus (Horse)				ALHHLSR	0.97529	0.079375	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1930.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SDE6	F6SDE6_HORSE	Ankyrin repeat and LEM domain containing 2	ANKLE2	Equus caballus (Horse)	negative regulation of phosphorylation [GO:0042326]; positive regulation of protein dephosphorylation [GO:0035307]	endoplasmic reticulum [GO:0005783]; membrane [GO:0016020]	protein phosphatase 2A binding [GO:0051721]	GSRFKAFSSR	0.76233	0.52081	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	907.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SEA5	F6SEA5_HORSE	POU domain protein	POU3F1	Equus caballus (Horse)	forebrain development [GO:0030900]; keratinocyte differentiation [GO:0030216]; myelination in peripheral nervous system [GO:0022011]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of gene expression [GO:0010628]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleoplasm [GO:0005654]; transcription regulator complex [GO:0005667]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	AGGGGTGR	0.98543	-0.87104	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	326.47	0	0	0
F6SEI8	F6SEI8_HORSE	Dynein axonemal heavy chain 7	DNAH7	Equus caballus (Horse)	cilium movement involved in cell motility [GO:0060294]	9+2 motile cilium [GO:0097729]; inner dynein arm [GO:0036156]; microtubule [GO:0005874]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; calcium ion binding [GO:0005509]; dynein intermediate chain binding [GO:0045505]; dynein light intermediate chain binding [GO:0051959]; minus-end-directed microtubule motor activity [GO:0008569]	GLNEYLEK	0.98601	-2.8899	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1781.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SFZ8	F6SFZ8_HORSE	Palmitoyltransferase (EC 2.3.1.225)	ZDHHC22	Equus caballus (Horse)	protein localization to plasma membrane [GO:0072659]; protein targeting to membrane [GO:0006612]	endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; plasma membrane [GO:0005886]	protein-cysteine S-palmitoyltransferase activity [GO:0019706]	GVAVRARPWRK	0.97343	-0.21048	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	678.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SGH0	F6SGH0_HORSE	glucose-6-phosphatase (EC 3.1.3.9)	G6PC2	Equus caballus (Horse)				SSTTLHRHACGR	0.9698	0.20325	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	416.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SHG5	F6SHG5_HORSE	Transmembrane protein 26	TMEM26	Equus caballus (Horse)		membrane [GO:0016020]		LSSLEKR	0.19298	1.0929	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	424.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SHI5	F6SHI5_HORSE	Ig-like domain-containing protein		Equus caballus (Horse)		external side of plasma membrane [GO:0009897]		TYEGTGK	0.98939	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	287.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SI27	F6SI27_HORSE	Transferrin receptor 2	TFR2	Equus caballus (Horse)	cellular response to iron ion [GO:0071281]; endocytic iron import into cell [GO:0140298]; multicellular organismal-level iron ion homeostasis [GO:0060586]; positive regulation of endocytosis [GO:0045807]; positive regulation of peptide hormone secretion [GO:0090277]; positive regulation of protein maturation [GO:1903319]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of postsynaptic membrane neurotransmitter receptor levels [GO:0099072]; transferrin transport [GO:0033572]	cytoplasmic vesicle [GO:0031410]; external side of plasma membrane [GO:0009897]; HFE-transferrin receptor complex [GO:1990712]; postsynapse [GO:0098794]	co-receptor binding [GO:0039706]; transferrin receptor activity [GO:0004998]	GGVEAGEGRGIR	0.98891	-1.7617	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2395.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SJC9	F6SJC9_HORSE	Ig-like domain-containing protein		Equus caballus (Horse)	"antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent [GO:0002486]; antigen processing and presentation of endogenous peptide antigen via MHC class Ib [GO:0002476]; immune response [GO:0006955]; positive regulation of T cell mediated cytotoxicity [GO:0001916]"	external side of plasma membrane [GO:0009897]; extracellular space [GO:0005615]		NLVGRIILRCR	0.973	-0.21048	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	631.71	800.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SLR7	F6SLR7_HORSE	Opticin	OPTC	Equus caballus (Horse)	articular cartilage development [GO:0061975]; bone development [GO:0060348]; collagen fibril organization [GO:0030199]	extracellular matrix [GO:0031012]		SLHLQVSGLRK	0.98429	-0.81877	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	588.58	0	0	568.72	0	583.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	565.42	0	0	0	0	0	0
F6SLX9	F6SLX9_HORSE	DNA polymerase delta subunit 3	POLD3	Equus caballus (Horse)	"DNA strand elongation involved in DNA replication [GO:0006271]; DNA synthesis involved in UV-damage excision repair [GO:1904161]; nucleotide-excision repair, DNA gap filling [GO:0006297]"	delta DNA polymerase complex [GO:0043625]		APGKGNAMSNFFGK	0.98885	-1.5776	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	658.22	0	0	550.57	0	0	0	0	2499.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1143.3	0	0	0	0	1366.9	0	0	0	0	0	0	0	0	0	3044.3	0
F6SMI0	F6SMI0_HORSE	CIDE-N domain-containing protein	CIDEB	Equus caballus (Horse)	apoptotic process [GO:0006915]; regulation of apoptotic process [GO:0042981]			VLSYGLGR	0.99024	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1907.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SNF6	F6SNF6_HORSE	Plexin A4	PLXNA4	Equus caballus (Horse)	phosphorylation [GO:0016310]	plasma membrane [GO:0005886]	ATP binding [GO:0005524]; kinase activity [GO:0016301]; semaphorin receptor activity [GO:0017154]	FWVNMIK	0.97864	0.068083	776.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SPB2	F6SPB2_HORSE	Guanylate binding protein 5	GBP5	Equus caballus (Horse)	cellular response to type II interferon [GO:0071346]; defense response to virus [GO:0051607]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of NLRP3 inflammasome complex assembly [GO:1900227]; protein homotetramerization [GO:0051289]; protein localization to Golgi apparatus [GO:0034067]	Golgi membrane [GO:0000139]; perinuclear region of cytoplasm [GO:0048471]	endopeptidase inhibitor activity [GO:0004866]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; protein homodimerization activity [GO:0042803]	SLQNFNLPR	0.97552	0.11584	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	425.16	0	0	0	0	0	0	767.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SPW5	F6SPW5_HORSE	Lysophosphatidic acid receptor 6 (Oleoyl-L-alpha-lysophosphatidic acid recepto-like protein)	LPAR6	Equus caballus (Horse)	blastocyst hatching [GO:0001835]; phospholipase C-activating G protein-coupled receptor signaling pathway [GO:0007200]; positive regulation of Rho protein signal transduction [GO:0035025]	plasma membrane [GO:0005886]	lysophosphatidic acid receptor activity [GO:0070915]	INKTKVLK	0.96387	-0.12449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	905.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SQP2	F6SQP2_HORSE	Ankyrin 2	ANK2	Equus caballus (Horse)	atrial cardiac muscle cell action potential [GO:0086014]; atrial septum development [GO:0003283]; positive regulation of gene expression [GO:0010628]; protein localization to endoplasmic reticulum [GO:0070972]; protein localization to plasma membrane [GO:0072659]; regulation of atrial cardiac muscle cell action potential [GO:0098910]; regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion [GO:0010881]; regulation of heart rate by cardiac conduction [GO:0086091]; regulation of SA node cell action potential [GO:0098907]; regulation of ventricular cardiac muscle cell membrane repolarization [GO:0060307]; SA node cell to atrial cardiac muscle cell communication [GO:0086070]; ventricular cardiac muscle cell action potential [GO:0086005]	basolateral plasma membrane [GO:0016323]; cytoskeleton [GO:0005856]	phosphorylation-dependent protein binding [GO:0140031]; protein kinase binding [GO:0019901]; spectrin binding [GO:0030507]; transmembrane transporter binding [GO:0044325]	HPPVSPSSKTEK	0.987	-1.4346	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	598.89	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SR78	F6SR78_HORSE	Kinesin family member 14	KIF14	Equus caballus (Horse)	microtubule-based movement [GO:0007018]	kinesin complex [GO:0005871]; microtubule [GO:0005874]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777]	GPRPSGRDALTSEGPKDFEFAK	0.98842	-1.0799	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1006.5	1284.3	1109.5	0	0	0	0	1700.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SRZ6	F6SRZ6_HORSE	Coatomer subunit alpha	COPA	Equus caballus (Horse)	endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; intracellular protein transport [GO:0006886]	COPI vesicle coat [GO:0030126]; Golgi membrane [GO:0000139]	structural molecule activity [GO:0005198]	LTKFETK	0.97968	-0.46278	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	629.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SSE5	F6SSE5_HORSE	AT-rich interaction domain 4B	ARID4B	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	ATVVNNK	0.93737	0.25424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	685.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SSS0	F6SSS0_HORSE	Coronin	CORO2A	Equus caballus (Horse)			actin filament binding [GO:0051015]	AGTVLQEASYKGHR	0.98731	-1.8239	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	968.2	0	0	0	0	0	0	0	0	0	0	0	0
F6SSW7	F6SSW7_HORSE	Gluconokinase (EC 2.7.1.12)	IDNK	Equus caballus (Horse)	D-gluconate catabolic process [GO:0046177]; phosphorylation [GO:0016310]		ATP binding [GO:0005524]; gluconokinase activity [GO:0046316]	EGAPLKRDESGK	0.96372	-0.12755	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	673.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ST15	F6ST15_HORSE	IF rod domain-containing protein	KRT88	Equus caballus (Horse)	intermediate filament organization [GO:0045109]; keratinization [GO:0031424]	keratin filament [GO:0045095]	structural constituent of skin epidermis [GO:0030280]	AEAESWYR	0.98676	-1.3685	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	967.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SVB4	F6SVB4_HORSE	Tubulin gamma complex associated protein 6	TUBGCP6	Equus caballus (Horse)	cytoplasmic microtubule organization [GO:0031122]; meiotic cell cycle [GO:0051321]; microtubule nucleation [GO:0007020]; mitotic cell cycle [GO:0000278]; spindle assembly [GO:0051225]	centrosome [GO:0005813]; cytosol [GO:0005829]; equatorial microtubule organizing center [GO:0000923]; gamma-tubulin complex [GO:0000930]; microtubule [GO:0005874]; spindle pole [GO:0000922]	gamma-tubulin binding [GO:0043015]	EQAYLASLAAQYR	0.98655	-1.921	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	479.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SW59	F6SW59_HORSE	NHS like 1		Equus caballus (Horse)				LVLMVPPPQR	0.96921	-0.055741	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1396	0	0	0	0	0	0	0	0	0	0	0	547.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	549.46	0	0	0	0	0	0	0	0
F6SXM0	F6SXM0_HORSE	BTB domain-containing protein	LOC100065102	Equus caballus (Horse)				MKLIFTEK	0.98891	-1.7635	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	651.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SXR8	F6SXR8_HORSE	Tuftelin-interacting protein 11		Equus caballus (Horse)	biomineral tissue development [GO:0031214]; spliceosomal complex disassembly [GO:0000390]	U2-type post-mRNA release spliceosomal complex [GO:0071008]	nucleic acid binding [GO:0003676]	GFAGGTK	0.95754	0.22369	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3618.6	0	431.4	373	0	0	0	0	0	0	0	0	0	2956.3	0	0	0	0	0	3129.3	0	0	0	0	3445.8	0	0	0	0	0	0	0	0	0	457.21	0	516.31	0	0	0	949.43	994.7	508.47	0	5142.9	459.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SYA0	F6SYA0_HORSE	protein-serine/threonine phosphatase (EC 3.1.3.16)	ILKAP	Equus caballus (Horse)			metal ion binding [GO:0046872]; protein serine/threonine phosphatase activity [GO:0004722]	SPRPAAGSLDTSISQMVK	0.95814	0.22931	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	788.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SYH3	F6SYH3_HORSE	Phosphatidylinositol glycan anchor biosynthesis class F	PIGF	Equus caballus (Horse)		endoplasmic reticulum membrane [GO:0005789]	mannose-ethanolamine phosphotransferase activity [GO:0051377]	QLTYKNN	0.98829	-1.7874	0	0	0	0	0	0	0	0	0	0	0	0	0	766.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SYP9	F6SYP9_HORSE	pre-rRNA processing protein FTSJ3 (EC 2.1.1.-) (2'-O-ribose RNA methyltransferase SPB1 homolog) (Protein ftsJ homolog 3) (Putative rRNA methyltransferase 3)	FTSJ3	Equus caballus (Horse)	"maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000466]; maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463]; rRNA methylation [GO:0031167]"	"nucleolus [GO:0005730]; preribosome, large subunit precursor [GO:0030687]; preribosome, small subunit precursor [GO:0030688]"	rRNA (guanine) methyltransferase activity [GO:0016435]; rRNA (uridine-2'-O-)-methyltransferase activity [GO:0008650]	QVTYVVAK	0.97601	0.083083	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	844.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6SZS0	F6SZS0_HORSE	G protein-coupled receptor 62	GPR62	Equus caballus (Horse)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; G protein-coupled receptor signaling in absence of ligand [GO:0038035]; G protein-coupled receptor signaling pathway [GO:0007186]; positive regulation of calcium-mediated signaling [GO:0050850]; positive regulation of cAMP-mediated signaling [GO:0043950]	endosome [GO:0005768]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]	arrestin family protein binding [GO:1990763]; G protein-coupled receptor activity [GO:0004930]; identical protein binding [GO:0042802]	LGPAPCR	0.95522	0.23332	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	348.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6T0D2	F6T0D2_HORSE	Contactin associated protein 2	CNTNAP2	Equus caballus (Horse)		membrane [GO:0016020]; paranodal junction [GO:0033010]		LPQQIRK	0.98412	-0.82296	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1140.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6T3K2	F6T3K2_HORSE	"Failed axon connections homolog, metaxin like GST domain containing"	FAXC	Equus caballus (Horse)		cytoplasm [GO:0005737]		SLAGLLGELINLAMYCERIR	0.67173	0.60965	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1475.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6T3Y8	F6T3Y8_HORSE	Actin beta	ACTB	Equus caballus (Horse)	adherens junction assembly [GO:0034333]; apical protein localization [GO:0045176]; axonogenesis [GO:0007409]; cell motility [GO:0048870]; cellular response to cytochalasin B [GO:0072749]; establishment or maintenance of cell polarity [GO:0007163]; morphogenesis of a polarized epithelium [GO:0001738]; positive regulation of double-strand break repair via homologous recombination [GO:1905168]; protein localization to adherens junction [GO:0071896]; regulation of cell cycle [GO:0051726]; regulation of norepinephrine uptake [GO:0051621]; regulation of protein localization to plasma membrane [GO:1903076]; regulation of synaptic vesicle endocytosis [GO:1900242]; regulation of transepithelial transport [GO:0150111]	actin filament [GO:0005884]; adherens junction [GO:0005912]; apical junction complex [GO:0043296]; axon [GO:0030424]; brush border [GO:0005903]; calyx of Held [GO:0044305]; cortical cytoskeleton [GO:0030863]; cytoplasm [GO:0005737]; cytoplasmic ribonucleoprotein granule [GO:0036464]; cytosol [GO:0005829]; glutamatergic synapse [GO:0098978]; lamellipodium [GO:0030027]; membrane [GO:0016020]; NuA4 histone acetyltransferase complex [GO:0035267]; nucleosome [GO:0000786]; nucleus [GO:0005634]; postsynaptic actin cytoskeleton [GO:0098871]; ribonucleoprotein complex [GO:1990904]; Schaffer collateral - CA1 synapse [GO:0098685]; synapse [GO:0045202]; tight junction [GO:0070160]	identical protein binding [GO:0042802]; kinesin binding [GO:0019894]; nitric-oxide synthase binding [GO:0050998]; protein kinase binding [GO:0019901]; structural constituent of postsynaptic actin cytoskeleton [GO:0098973]; Tat protein binding [GO:0030957]	AGFAGDDAPR	0	114.52	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11926	11013	11746	0	0	0	0	0	0	0	0	0	0	0	0	7679.8	7716.1	8409.1
F6T462	F6T462_HORSE	Vacuolar protein sorting-associated protein 54	VPS54	Equus caballus (Horse)	"protein transport [GO:0015031]; retrograde transport, endosome to Golgi [GO:0042147]"	cytosol [GO:0005829]; GARP complex [GO:0000938]		VNLPAALNDPRLAKR	0.89093	0.35979	0	0	0	0	469.09	0	0	0	0	0	0	1379.6	0	0	0	0	1914.1	1987.8	0	0	349.95	918.37	940.32	952.55	0	0	0	0	0	0	0	0	0	2057.4	1791.3	0	0	0	0	0	499.56	0	0	0	0	0	0	0	0	0	0	0	527.77	520.65	1020.6	1130.6	0	0	0	0	1104	1466.5	0	0	0	0	0	523.89	0	0	0	0	758.2	782.61	0
F6T4W7	F6T4W7_HORSE	Disintegrin and metalloproteinase domain-containing protein 5-like	LOC100057011	Equus caballus (Horse)	proteolysis [GO:0006508]	membrane [GO:0016020]	metalloendopeptidase activity [GO:0004222]	LVCAWPHK	0.97339	0.12642	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	436.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	376.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6T6R0	F6T6R0_HORSE	Telomerase RNA component interacting RNase	TRIR	Equus caballus (Horse)	rRNA catabolic process [GO:0016075]		3'-5' exonuclease activity [GO:0008408]; 5'-3' exonuclease activity [GO:0008409]	GGPGPTLSFVGK	0.96955	-0.068051	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12262	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6T7C9	F6T7C9_HORSE	Mitogen-activated protein kinase kinase kinase 6	MAP3K6	Equus caballus (Horse)	phosphorylation [GO:0016310]		ATP binding [GO:0005524]; MAP kinase kinase kinase activity [GO:0004709]; metal ion binding [GO:0046872]	LEQEQSPRLSR	0.97154	0.20748	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	422.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6T7P5	F6T7P5_HORSE	Inka box actin regulator 1	INKA1	Equus caballus (Horse)		nucleus [GO:0005634]	protein kinase binding [GO:0019901]; protein serine/threonine kinase inhibitor activity [GO:0030291]	LDSFLGQLR	0.95848	-0.017248	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1124.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6T7X3	F6T7X3_HORSE	Amine oxidase (EC 1.4.3.-)	AOC3	Equus caballus (Horse)	amine metabolic process [GO:0009308]		copper ion binding [GO:0005507]; primary amine oxidase activity [GO:0008131]; quinone binding [GO:0048038]	VDGRPGHR	0.96376	-0.0054609	0	0	0	0	0	0	0	0	0	0	616.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6T9Q0	F6T9Q0_HORSE	Sperm associated antigen 9	SPAG9	Equus caballus (Horse)		cytoplasm [GO:0005737]	MAP-kinase scaffold activity [GO:0005078]	QRSASQSSLDK	0.98786	-1.8815	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1234.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TAI5	F6TAI5_HORSE	Borealin (Cell division cycle-associated protein 8)	CDCA8	Equus caballus (Horse)	cell division [GO:0051301]; mitotic metaphase chromosome alignment [GO:0007080]; mitotic sister chromatid segregation [GO:0000070]	"chromocenter [GO:0010369]; chromosome passenger complex [GO:0032133]; chromosome, centromeric region [GO:0000775]; intercellular bridge [GO:0045171]; midbody [GO:0030496]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; spindle midzone [GO:0051233]"		RTQSMQGK	0.9836	-0.83129	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	446	0	0	0	0	0	0
F6TBN2	F6TBN2_HORSE	Thrombospondin type laminin G domain and EAR repeats	TSPEAR CFAP410	Equus caballus (Horse)				KNRIPSLAELFYLK	0.91638	0.30405	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	544.98
F6TC16	F6TC16_HORSE	Folate hydrolase 1	FOLH1	Equus caballus (Horse)		plasma membrane [GO:0005886]		LQDLDKNK	0.98664	-1.3856	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10493	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TDZ1	F6TDZ1_HORSE	Ryanodine receptor 3	RYR3	Equus caballus (Horse)	intracellular calcium ion homeostasis [GO:0006874]	sarcoplasmic reticulum membrane [GO:0033017]	calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516]; ryanodine-sensitive calcium-release channel activity [GO:0005219]	FLMGGRHGEFK	0.98534	-2.0651	0	0	0	0	0	0	0	0	0	0	0	783.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	493.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TEP5	F6TEP5_HORSE	Transmembrane channel-like protein	TMC3	Equus caballus (Horse)		plasma membrane [GO:0005886]	mechanosensitive monoatomic ion channel activity [GO:0008381]	TAPEEGK	0.9891	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	478.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TFS7	F6TFS7_HORSE	"MYCL proto-onco, bHLH transcription factor"	MYCL	Equus caballus (Horse)	regulation of inner ear auditory receptor cell differentiation [GO:0045607]; regulation of transcription by RNA polymerase II [GO:0006357]	chromosome [GO:0005694]; nucleoplasm [GO:0005654]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; protein dimerization activity [GO:0046983]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	VAVREQGRER	0.77234	0.5097	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	543.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TFU8	F6TFU8_HORSE	Bombesin receptor subtype-3	BRS3	Equus caballus (Horse)	G protein-coupled receptor signaling pathway [GO:0007186]	plasma membrane [GO:0005886]	bombesin receptor activity [GO:0004946]; neuropeptide receptor activity [GO:0008188]	NRTFEACASYPVSER	0.98769	-1.8109	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	861.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TGV2	F6TGV2_HORSE	Protein yippee-like	YPEL1 YPEL	Equus caballus (Horse)			metal ion binding [GO:0046872]	MVKMTKAK	0.97676	0.073894	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1165.4	1006.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TH38	F6TH38_HORSE	Zinc finger protein 584	ZNF584	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	LGPRRGQR	0.97954	-0.31278	0	0	0	0	0	0	0	0	0	0	0	0	448.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6THA1	F6THA1_HORSE	Bromodomain testis-specific protein	BRDT	Equus caballus (Horse)	chromatin remodeling [GO:0006338]; regulation of DNA-templated transcription [GO:0006355]	chromatin [GO:0000785]; nucleus [GO:0005634]	lysine-acetylated histone binding [GO:0070577]	AVGGGSR	0.98575	-2.8744	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	291.93	0	0	0	0	0	0	0	0	0	0	0	0	0	510.51	0	0	0	0	0	0	0	0	0	0	0	0	0	311.9	173.53	0	0	0	0	0	0	0	0	0	0	0	272.67	0	0	321.57	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TJ94	F6TJ94_HORSE	SHH signaling and ciliosis regulator SDCCAG8	SDCCAG8	Equus caballus (Horse)	centrosome cycle [GO:0007098]	centrosome [GO:0005813]		LHEIMKQRLK	0.97501	-0.20448	0	0	0	0	721.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	846.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TJV8	F6TJV8_HORSE	Catenin alpha 3	CTNNA3	Equus caballus (Horse)	bundle of His cell-Purkinje myocyte adhesion involved in cell communication [GO:0086073]; cell migration [GO:0016477]; cell-cell adhesion [GO:0098609]; regulation of heart rate by cardiac conduction [GO:0086091]; regulation of ventricular cardiac muscle cell action potential [GO:0098911]	adherens junction [GO:0005912]; cytoplasm [GO:0005737]; fascia adherens [GO:0005916]; lamellipodium [GO:0030027]	actin filament binding [GO:0051015]; beta-catenin binding [GO:0008013]; cadherin binding [GO:0045296]	VLVRLFAYR	0.97293	-0.1822	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	298.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TMJ0	F6TMJ0_HORSE	G-protein coupled receptors family 1 profile domain-containing protein		Equus caballus (Horse)	detection of chemical stimulus involved in sensory perception of smell [GO:0050911]; G protein-coupled receptor signaling pathway [GO:0007186]	membrane [GO:0016020]	odorant binding [GO:0005549]; olfactory receptor activity [GO:0004984]	VFSFLKH	0.98351	-0.73476	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	556.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TPB5	F6TPB5_HORSE	Sad1 and UNC84 domain containing 2	SUN2	Equus caballus (Horse)		membrane [GO:0016020]		MTQESFR	0.96814	0.19721	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	296.32	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TPM3	F6TPM3_HORSE	Transforming growth factor beta 1 induced transcript 1	TGFB1I1	Equus caballus (Horse)	cell fate commitment [GO:0045165]; epithelial cell differentiation [GO:0030855]; fat cell differentiation [GO:0045444]; morphogenesis of embryonic epithelium [GO:0016331]; negative regulation of fat cell differentiation [GO:0045599]; positive regulation of epithelial to mesenchymal transition [GO:0010718]; positive regulation of transforming growth factor beta receptor signaling pathway [GO:0030511]; positive regulation of ubiquitin-dependent protein catabolic process [GO:2000060]	cytoskeleton [GO:0005856]; cytosol [GO:0005829]; focal adhesion [GO:0005925]; intracellular membrane-bounded organelle [GO:0043231]	I-SMAD binding [GO:0070411]; metal ion binding [GO:0046872]; nuclear androgen receptor binding [GO:0050681]; Roundabout binding [GO:0048495]; transcription coactivator activity [GO:0003713]	EPFPRAAR	0.98828	-1.2742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	991.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TRM7	F6TRM7_HORSE	Coiled-coil domain containing 105	CCDC105	Equus caballus (Horse)				KDLTWSLNCKK	0.97903	-0.43241	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	816.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TVR0	F6TVR0_HORSE	RCC1 and BTB domain containing protein 2	RCBTB2	Equus caballus (Horse)				NSASGFA	0.95769	0.22133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	356.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TYT8	F6TYT8_HORSE	C-type lectin domain containing 16A	CLEC16A	Equus caballus (Horse)				ATMYLYHVLTK	0.8855	0.44412	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3170.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6TZC0	F6TZC0_HORSE	Phosphatidylinositol 4-kinase type 2 (EC 2.7.1.67)	PI4K2B	Equus caballus (Horse)	endosome organization [GO:0007032]; Golgi organization [GO:0007030]; phosphatidylinositol phosphate biosynthetic process [GO:0046854]; phosphorylation [GO:0016310]	endosome [GO:0005768]; plasma membrane [GO:0005886]; trans-Golgi network [GO:0005802]	1-phosphatidylinositol 4-kinase activity [GO:0004430]; ATP binding [GO:0005524]	EPLLQRIAWAQPR	0.98699	-1.4294	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	675.25	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1173.1	0	0	0	1428.2	0	4311.6	0	0	0	0	0	0	0	0	0	0	0	0	0	1751.4	0	0	0	0	0	0	0
F6U429	F6U429_HORSE	Programmed cell death 11	PDCD11	Equus caballus (Horse)	rRNA processing [GO:0006364]	cytosol [GO:0005829]; nucleolus [GO:0005730]; small-subunit processome [GO:0032040]	NF-kappaB binding [GO:0051059]; RNA binding [GO:0003723]	EPQKPQAK	0.96105	-0.14744	0	0	0	0	0	0	0	0	0	2540.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2309.2
F6U6H7	F6U6H7_HORSE	glycogenin glucosyltransferase (EC 2.4.1.186)	GYG1	Equus caballus (Horse)	glycogen biosynthetic process [GO:0005978]	cytoplasm [GO:0005737]	glycosyltransferase activity [GO:0016757]; UDP-glycosyltransferase activity [GO:0008194]	GGSRVAGPSR	0.98818	-1.8994	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3166	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6U755	F6U755_HORSE	RasGEF domain family member 1C	RASGEF1C	Equus caballus (Horse)	Ras protein signal transduction [GO:0007265]	plasma membrane [GO:0005886]	guanyl-nucleotide exchange factor activity [GO:0005085]	SLRSSILGKT	0.98126	-0.25774	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	546.45	1018.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	478.73
F6U938	F6U938_HORSE	Transcription elongation factor A protein-like 4	TCEAL4	Equus caballus (Horse)				EKLENEGK	0.98782	-1.2742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	665.78	0	0	0	0	0	0	0	0
F6U9J2	F6U9J2_HORSE	Proteasome assembly chaperone 2	LOC100058979	Equus caballus (Horse)				SIFIKYK	0.9888	-1.1852	0	0	0	0	0	0	1319.1	1080.3	1111.4	0	0	0	0	962.51	1090.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	789.55	0	0	0	276.82	264.27	0	1275.7	0	0	601.21	0	0	0	718.86	0	0	0	0	0	0	0	0	785.72	893.3	0	0	0	564.82	0	519.71	0	621.97	0	0	0	0
F6UAG7	F6UAG7_HORSE	Leucine rich repeat protein 1	LRR1	Equus caballus (Horse)	signal transduction [GO:0007165]			GTRYELK	0.98437	-2.2672	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	752.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UF15	F6UF15_HORSE	ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)	CLPP	Equus caballus (Horse)	membrane protein proteolysis [GO:0033619]; protein quality control for misfolded or incompletely synthesized proteins [GO:0006515]	endopeptidase Clp complex [GO:0009368]; mitochondrial matrix [GO:0005759]	ATP-dependent peptidase activity [GO:0004176]; ATPase binding [GO:0051117]; serine-type endopeptidase activity [GO:0004252]	DFHTVRKPK	0.98012	-0.31163	0	0	0	0	0	0	0	0	0	0	0	0	0	1495.6	1484.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1162.7	0	0	0	0	0	0	2255.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1385	0	0	0
F6UF24	F6UF24_HORSE	Olfactory receptor	OR4B1J	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	IAMRRLWVK	0.96613	-0.15581	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	402.66	0	0	0	0	0	0	0	0	328.82	0	0	0	0	0	0	0	0	0	0	0	0
F6UG83	F6UG83_HORSE	Myomesin 3	MYOM3	Equus caballus (Horse)				KETCFQWFFQK	0.98555	-0.86023	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	644.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UGR3	F6UGR3_HORSE	Olfactory receptor		Equus caballus (Horse)	signal transduction [GO:0007165]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	VPSGGGR	0.95855	0.22133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	453.49	0	0	0	0	0	0	0	0	0	0	0	0	668.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UGU4	F6UGU4_HORSE	Caspase 8 associated protein 2	CASP8AP2	Equus caballus (Horse)	apoptotic signaling pathway [GO:0097190]			DIRHSQYSR	0.99103	-1.2379	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	597.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UHA2	F6UHA2_HORSE	tRNA-dihydrouridine(47) synthase [NAD(P)(+)] (EC 1.3.1.-) (tRNA-dihydrouridine synthase 3)		Equus caballus (Horse)			flavin adenine dinucleotide binding [GO:0050660]; metal ion binding [GO:0046872]; tRNA dihydrouridine synthase activity [GO:0017150]	LRPCEKRR	0.97852	0.072147	0	0	0	0	0	0	404.8	0	0	0	0	381.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UI19	F6UI19_HORSE	Growth factor independent 1 transcriptional repressor	GFI1	Equus caballus (Horse)	cellular response to lipopolysaccharide [GO:0071222]; negative regulation of neuron projection development [GO:0010977]; positive regulation of interleukin-6-mediated signaling pathway [GO:0070105]; regulation of toll-like receptor signaling pathway [GO:0034121]	nuclear body [GO:0016604]; nuclear matrix [GO:0016363]; transcription repressor complex [GO:0017053]	"DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; transcription cis-regulatory region binding [GO:0000976]"	GAGVKVESELLCTR	0.92146	0.28987	0	0	0	0	0	0	0	0	0	0	0	0	0	0	834.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	870.93	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UIT8	F6UIT8_HORSE	Transmembrane protein 225	TMEM225	Equus caballus (Horse)		membrane [GO:0016020]		VTSLPAR	0.98969	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31196	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UKM2	F6UKM2_HORSE	Zinc finger protein 518A	ZNF518A	Equus caballus (Horse)	positive regulation of transcription by RNA polymerase II [GO:0045944]	nucleus [GO:0005634]		MPSEQKQLLFDEKQTTLQK	0.33854	0.78579	0	0	0	0	0	0	0	0	0	0	0	0	719.83	0	0	1800.3	1683.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3032.6	0	0	0	0	0	0	0	0	0	0	0	0	0	1279.6	0	0	0	0	0	0	0	0	0	0	0	0	2191.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UL42	F6UL42_HORSE	Carboxymethylenebutenolidase homolog	CMBL	Equus caballus (Horse)		cytosol [GO:0005829]	hydrolase activity [GO:0016787]	NLIEWLNKYV	0.98499	-0.99038	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	928.03	0	0	0	0	0	0	0	0	0	0	0	0	382.6	442.92	466.8
F6UMK2	F6UMK2_HORSE	C-type lectin domain-containing protein	MBL1	Equus caballus (Horse)	positive regulation of phagocytosis [GO:0050766]; surfactant homeostasis [GO:0043129]	collagen trimer [GO:0005581]; extracellular space [GO:0005615]; multivesicular body [GO:0005771]	carbohydrate binding [GO:0030246]	LANLEQELR	0.91193	0.31899	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	930.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	384.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UN00	F6UN00_HORSE	RNA binding motif protein 28	RBM28	Equus caballus (Horse)		nucleolus [GO:0005730]	RNA binding [GO:0003723]	AVQIQKR	0.9807	-0.4952	0	0	0	0	0	10078	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UN67	F6UN67_HORSE	protein-serine/threonine phosphatase (EC 3.1.3.16)	DUSP8	Equus caballus (Horse)	dephosphorylation [GO:0016311]		MAP kinase tyrosine/serine/threonine phosphatase activity [GO:0017017]; myosin phosphatase activity [GO:0017018]	AGAQAVGGGDLRRR	0.97453	-0.19904	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1030.1	0	0
F6UNM1	F6UNM1_HORSE	DOP1 leucine zipper like protein B	DOP1B DOPEY2	Equus caballus (Horse)	Golgi to endosome transport [GO:0006895]	cytosol [GO:0005829]; endosome [GO:0005768]; trans-Golgi network [GO:0005802]		DLLVEGLAEILHQK	0.96528	-0.091344	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1428.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UQG7	F6UQG7_HORSE	Putative WW-binding domain-containing protein	LOC100056167	Equus caballus (Horse)				LRRERPGPAR	0.9755	-0.20514	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1021	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1092.1	0	0	0	0	0	0	0	0	702.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UQK0	F6UQK0_HORSE	[histone H3]-lysine(4) N-methyltransferase (EC 2.1.1.364)	KMT2C	Equus caballus (Horse)	methylation [GO:0032259]; regulation of DNA-templated transcription [GO:0006355]	MLL3/4 complex [GO:0044666]	DNA binding [GO:0003677]; histone H3K4 trimethyltransferase activity [GO:0140999]; metal ion binding [GO:0046872]	GAGLSGR	0.96805	0.0077155	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	332.29	0	0	414.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UQM3	F6UQM3_HORSE	Glycine receptor alpha 1	GLRA1	Equus caballus (Horse)	"acrosome reaction [GO:0007340]; adult walking behavior [GO:0007628]; cellular response to amino acid stimulus [GO:0071230]; cellular response to ethanol [GO:0071361]; cellular response to zinc ion [GO:0071294]; chloride transmembrane transport [GO:1902476]; inhibitory postsynaptic potential [GO:0060080]; muscle contraction [GO:0006936]; negative regulation of transmission of nerve impulse [GO:0051970]; neuromuscular process controlling posture [GO:0050884]; neuronal action potential [GO:0019228]; neuropeptide signaling pathway [GO:0007218]; positive regulation of acrosome reaction [GO:2000344]; regulation of respiratory gaseous exchange by nervous system process [GO:0002087]; response to amino acid [GO:0043200]; righting reflex [GO:0060013]; startle response [GO:0001964]; synaptic transmission, glycinergic [GO:0060012]; visual perception [GO:0007601]"	chloride channel complex [GO:0034707]; dendrite [GO:0030425]; external side of plasma membrane [GO:0009897]; glycinergic synapse [GO:0098690]; inhibitory synapse [GO:0060077]; intracellular membrane-bounded organelle [GO:0043231]; neuron projection [GO:0043005]; perikaryon [GO:0043204]; postsynaptic membrane [GO:0045211]; synapse [GO:0045202]	extracellularly glycine-gated chloride channel activity [GO:0016934]; glycine binding [GO:0016594]; ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential [GO:0099507]; taurine binding [GO:0030977]; transmembrane signaling receptor activity [GO:0004888]; transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential [GO:1904315]; zinc ion binding [GO:0008270]	ELLRFRR	0.97066	-0.028737	0	0	0	0	0	0	0	0	0	0	0	0	0	0	837.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2217.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	992.56	0	540.55	0	0
F6UQW2	F6UQW2_HORSE	Pre-mRNA-splicing factor 38A	PRPF38A	Equus caballus (Horse)	"mRNA splicing, via spliceosome [GO:0000398]"	precatalytic spliceosome [GO:0071011]		DAHSIHGTNPQYLVEK	0.90708	0.31976	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	643.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6USA2	F6USA2_HORSE	PDZ domain containing 8	PDZD8	Equus caballus (Horse)	lipid transport [GO:0006869]; mitochondrial calcium ion homeostasis [GO:0051560]; mitochondrion-endoplasmic reticulum membrane tethering [GO:1990456]	endoplasmic reticulum membrane [GO:0005789]; mitochondria-associated endoplasmic reticulum membrane [GO:0044233]; mitochondrion [GO:0005739]	lipid binding [GO:0008289]; metal ion binding [GO:0046872]	TALRNLSMQK	0.96718	-0.17512	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1706.7	0	1765.1	0	0	0	0	0	0	0	0	0	0	0	0	716.19	705.95	830.72
F6USJ2	F6USJ2_HORSE	Phospholipid-transporting ATPase (EC 7.6.2.1)	ATP8A1	Equus caballus (Horse)	phospholipid transport [GO:0015914]	membrane [GO:0016020]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATPase-coupled intramembrane lipid transporter activity [GO:0140326]; magnesium ion binding [GO:0000287]	QYFLDLALSCK	0.96965	0.16574	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	509.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6USP9	F6USP9_HORSE	Plasminogen (EC 3.4.21.7)	PLG	Equus caballus (Horse)	blood coagulation [GO:0007596]; fibrinolysis [GO:0042730]; proteolysis [GO:0006508]; tissue remodeling [GO:0048771]	extracellular region [GO:0005576]	serine-type endopeptidase activity [GO:0004252]	LAAGAQQIDVSK	0	2.7246	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	537.06	607.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6UT55	F6UT55_HORSE	Kinesin family member 20B	KIF20B	Equus caballus (Horse)	microtubule-based movement [GO:0007018]	kinesin complex [GO:0005871]; microtubule [GO:0005874]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777]	EAYRLLK	0.9868	-1.3939	0	1247.1	0	0	236.01	339.9	1396.6	0	0	1667.8	0	0	0	0	0	0	0	0	0	0	0	0	1076	0	0	0	861.61	0	0	0	0	0	0	0	0	0	1418.5	0	0	0	0	0	0	324.63	0	0	0	0	1698.7	0	0	0	0	0	0	0	0	0	0	0	1267.3	0	0	0	0	0	0	0	0	2469.9	0	2360.5	1515.8	1567.4	1671.7
F6UUV8	F6UUV8_HORSE	Protein kinase AMP-activated non-catalytic subunit beta 2	PRKAB2	Equus caballus (Horse)	signal transduction [GO:0007165]	cytoplasm [GO:0005737]; nucleotide-activated protein kinase complex [GO:0031588]; nucleus [GO:0005634]	protein kinase binding [GO:0019901]	LERSEGPR	0.98777	-1.723	828.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	843.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6V0D6	F6V0D6_HORSE	Ankyrin repeat and sterile alpha motif domain containing 6	ANKS6	Equus caballus (Horse)	determination of left/right symmetry [GO:0007368]; heart development [GO:0007507]; in utero embryonic development [GO:0001701]; kidney development [GO:0001822]	ciliary inversin compartment [GO:0097543]		TQAGPLK	0.96717	0.0052401	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1235.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6V2Z7	F6V2Z7_HORSE	"Palladin, cytoskeletal associated protein"	PALLD	Equus caballus (Horse)	actin cytoskeleton organization [GO:0030036]; cell migration [GO:0016477]			IEKNIRSK	0.98529	-0.23999	0	0	0	0	0	0	2452.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1716.1	0	0	0	0	0	0	3695.1	0	0	0	0	0	0	0	0	0	1818	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6V3T0	F6V3T0_HORSE	Zinc finger protein 597	ZNF597	Equus caballus (Horse)	negative regulation of transcription by RNA polymerase II [GO:0000122]		"DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; metal ion binding [GO:0046872]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	ISGGTSACKKR	0.96688	-0.081443	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1146.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	761.47	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6V4N1	F6V4N1_HORSE	EGF like domain multiple 7	EGFL7	Equus caballus (Horse)		membrane [GO:0016020]	calcium ion binding [GO:0005509]	SRVDVLEQK	0.98558	-2.0332	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1117.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6V647	F6V647_HORSE	Extracellular leucine rich repeat and fibronectin type III domain containing 2	ELFN2	Equus caballus (Horse)		extracellular matrix [GO:0031012]; extracellular space [GO:0005615]; membrane [GO:0016020]		LNENKLKAVLYSSLNR	0.96193	-0.14642	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	679.58	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VA37	F6VA37_HORSE	Protein phosphatase 1 regulatory subunit 3A	PPP1R3A	Equus caballus (Horse)	regulation of glycogen biosynthetic process [GO:0005979]	membrane [GO:0016020]; protein phosphatase type 1 complex [GO:0000164]	glycogen binding [GO:2001069]; protein phosphatase 1 binding [GO:0008157]	HPHPGSIPEEVSR	0.8601	0.46786	0	0	0	0	0	0	0	686.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VCW1	F6VCW1_HORSE	Family with sequence similarity 53 member C	FAM53C	Equus caballus (Horse)	protein import into nucleus [GO:0006606]	nucleus [GO:0005634]		GLRNLPR	0.98882	-1.6947	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2197.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VDK7	F6VDK7_HORSE	Keratin 33B	KRT33B	Equus caballus (Horse)	epithelial cell differentiation [GO:0030855]; intermediate filament organization [GO:0045109]	cytoskeleton [GO:0005856]; intermediate filament [GO:0005882]	structural molecule activity [GO:0005198]	ETMQFLNDR	0	26.982	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1119	1165.2	931.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VES4	F6VES4_HORSE	von Willebrand factor A domain containing 5B2	VWA5B2	Equus caballus (Horse)				AGALSAEVLGR	0.36842	0.74409	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	686.36	0	0
F6VG96	F6VG96_HORSE	Gap junction protein	GJA8 CXNL	Equus caballus (Horse)	cell-cell signaling [GO:0007267]; gap junction-mediated intercellular transport [GO:1990349]; lens development in camera-type eye [GO:0002088]	connexin complex [GO:0005922]	gap junction channel activity [GO:0005243]	VGKEAEKEELQAEK	0.96606	-0.15443	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1541.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VGC7	F6VGC7_HORSE	Ras association domain family member 9	RASSF9	Equus caballus (Horse)	intracellular transport [GO:0046907]; signal transduction [GO:0007165]	cytosol [GO:0005829]; recycling endosome [GO:0055037]; trans-Golgi network transport vesicle membrane [GO:0012510]		DMDSEEK	0.96883	0.028699	0	0	0	0	0	0	1535.9	0	0	0	0	0	0	0	0	0	0	0	791.05	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1038.7	0	0	0	0	0	0	0	0
F6VGH5	F6VGH5_HORSE	1-acylglycerol-3-phosphate O-acyltransferase 5	AGPAT5	Equus caballus (Horse)	phosphatidylinositol acyl-chain remodeling [GO:0036149]	endomembrane system [GO:0012505]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; mitochondrion [GO:0005739]; nuclear envelope [GO:0005635]; nucleolus [GO:0005730]	1-acylglycerol-3-phosphate O-acyltransferase activity [GO:0003841]; acyltransferase activity [GO:0016746]	RSAKFNEK	0.97013	0.039275	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	575.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VGK4	F6VGK4_HORSE	Butyrophilin-like protein 10	LOC100061639	Equus caballus (Horse)		membrane [GO:0016020]		YQLSDPTSR	0.96848	-0.097568	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1137.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VHL4	F6VHL4_HORSE	BTB domain containing 2	BTBD2	Equus caballus (Horse)	neurogenesis [GO:0022008]	cytosol [GO:0005829]; P-body [GO:0000932]		AAGGSGGR	0.98496	-0.84969	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	485.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	294.76	0	0	0	0	423.2	0	0	482.52	0	0	0	0	0
F6VI89	F6VI89_HORSE	RNA binding motif protein X-linked 2	RBMX2	Equus caballus (Horse)	"mRNA splicing, via spliceosome [GO:0000398]"	endoplasmic reticulum [GO:0005783]; nuclear membrane [GO:0031965]; nucleolus [GO:0005730]; U2-type precatalytic spliceosome [GO:0071005]	RNA binding [GO:0003723]	ARHSWDQESSNPSDR	0.89489	0.33419	0	0	0	0	0	0	0	0	0	0	0	0	0	1552	0	0	1754.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1758.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VLI3	F6VLI3_HORSE	Methylcytosine dioxygenase TET (EC 1.14.11.80)	TET1	Equus caballus (Horse)	5-methylcytosine catabolic process [GO:0006211]; DNA demethylation [GO:0080111]; positive regulation of transcription by RNA polymerase II [GO:0045944]	chromosome [GO:0005694]; nucleus [GO:0005634]	DNA binding [GO:0003677]; methylcytosine dioxygenase activity [GO:0070579]; zinc ion binding [GO:0008270]	KFNIEEFGK	0.98409	-0.92074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	528.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VPD7	F6VPD7_HORSE	Chromosome 7 C19orf67 homolog	C7H19orf67	Equus caballus (Horse)				AAGPAAWAAQGP	0.96671	-0.16515	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3031.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VQ75	F6VQ75_HORSE	protein-serine/threonine phosphatase (EC 3.1.3.16)	SSH3	Equus caballus (Horse)	dephosphorylation [GO:0016311]; negative regulation of actin filament polymerization [GO:0030837]		actin binding [GO:0003779]; myosin phosphatase activity [GO:0017018]; protein tyrosine/serine/threonine phosphatase activity [GO:0008138]	GAVGGPR	0.95592	0.23586	643.86	0	748.01	0	758.6	796.43	988.33	1162.1	0	1163.5	1421.7	1383.3	761.37	0	754.79	0	0	0	721.07	500.56	1489.9	839.95	0	0	712.15	694.25	597.03	0	0	0	0	0	0	715.97	0	888.22	1002.8	0	0	0	0	0	689.57	0	0	444.2	0	0	0	0	0	0	0	0	0	0	669.92	0	33415	40685	842.66	0	0	485.49	0	16912	26418	0	0	0	1552.2	1172.2	966.64	992.5	945.73
F6VTD3	F6VTD3_HORSE	SMB domain-containing protein	PRG4	Equus caballus (Horse)	immune response [GO:0006955]	collagen-containing extracellular matrix [GO:0062023]; extracellular space [GO:0005615]	polysaccharide binding [GO:0030247]; scavenger receptor activity [GO:0005044]	NGTLVAFR	0.9751	0.050128	0	0	0	0	0	0	0	681.93	655.04	0	1035.6	0	0	0	0	0	0	0	0	566	0	0	0	0	0	0	0	0	0	0	1247.4	1319.7	1194.9	0	0	0	0	673.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	599.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1075.8	0	0	0	0
F6VTU8	F6VTU8_HORSE	Mitofusin 1	MFN1	Equus caballus (Horse)	mitochondrial fusion [GO:0008053]; mitochondrion localization [GO:0051646]	mitochondrial outer membrane [GO:0005741]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]	LLSVSHTLQLKSS	0.98678	-1.826	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	330.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VU75	F6VU75_HORSE	"Large ribosomal subunit protein bL28m (39S ribosomal protein L28, mitochondrial)"	MRPL28	Equus caballus (Horse)		cytosol [GO:0005829]; mitochondrial large ribosomal subunit [GO:0005762]	structural constituent of ribosome [GO:0003735]	SLCSRSTWSH	0.98776	-1.033	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	271.96	585.64	380.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VUT1	F6VUT1_HORSE	Nebulin	NEB	Equus caballus (Horse)		cytoplasm [GO:0005737]	actin binding [GO:0003779]	AVHDDPK	0.98716	-3.9939	0	0	0	0	0	0	0	0	0	0	0	0	543.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	476.39	0	0	0	1080.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	544.96	0	816.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VVT2	F6VVT2_HORSE	Sodium voltage-gated channel beta subunit 2	SCN2B	Equus caballus (Horse)		membrane [GO:0016020]		LVSVPPGR	0.97555	0.11337	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4986.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VVY0	F6VVY0_HORSE	Pepsin A	LOC100059273	Equus caballus (Horse)	proteolysis [GO:0006508]		aspartic-type endopeptidase activity [GO:0004190]	TAGEGDR	0.93328	0.27772	0	0	0	0	0	0	0	0	0	0	0	0	564.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VW17	F6VW17_HORSE	ALX homeobox protein 1 (Cartilage homeoprotein 1)	ALX1	Equus caballus (Horse)	embryonic skeletal system morphogenesis [GO:0048704]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of epithelial to mesenchymal transition [GO:0010718]; positive regulation of transcription by RNA polymerase II [GO:0045944]	Golgi apparatus [GO:0005794]; nuclear body [GO:0016604]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	AEHHVRLER	0.98772	-1.8777	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1174.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VW27	F6VW27_HORSE	Nuclear cap-binding protein subunit 3	NCBP3	Equus caballus (Horse)		nucleus [GO:0005634]	mRNA binding [GO:0003729]; RNA 7-methylguanosine cap binding [GO:0000340]; RNA cap binding [GO:0000339]	AWGALIK	0.96529	-0.091464	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	912.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VWI6	F6VWI6_HORSE	SUMO specific peptidase 6	SENP6	Equus caballus (Horse)	proteolysis [GO:0006508]		cysteine-type peptidase activity [GO:0008234]	GSCVQKENK	0.98574	-2.8332	0	0	0	0	557.67	0	854.41	0	0	0	0	0	0	0	0	3633	0	0	0	0	0	0	0	0	0	0	0	3035.8	0	3730.2	0	2227.3	3352.3	4301.2	4431.6	0	0	1518	0	0	3685	0	743.61	0	0	0	3711.9	0	0	0	0	0	0	0	0	0	0	0	0	2998.3	0	0	0	0	0	0	0	0	0	0	0	855.58	0	0	0
F6VY65	F6VY65_HORSE	Shisa family member 7	SHISA7	Equus caballus (Horse)				SPALPPDPASR	0.96468	-0.11879	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1956.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	393.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VZ66	F6VZ66_HORSE	Protein phosphatase 4 regulatory subunit 3C	PPP4R3C	Equus caballus (Horse)	DNA damage response [GO:0006974]	nucleoplasm [GO:0005654]; protein phosphatase 4 complex [GO:0030289]	protein phosphatase activator activity [GO:0072542]	INTNEPYQK	0.97805	0.059934	0	0	0	0	0	0	0	0	0	0	340.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6VZ90	F6VZ90_HORSE	C2H2-type domain-containing protein	ZNF517	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	LPQRLTERVPER	0.98391	-0.92141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	548.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6W019	F6W019_HORSE	Splicing factor SWAP	SFSWAP	Equus caballus (Horse)	mRNA 5'-splice site recognition [GO:0000395]		RNA binding [GO:0003723]	LAAAAREKLAQASK	0.89668	0.32832	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1727	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6W079	F6W079_HORSE	CDGSH iron-sulfur domain-containing protein 2	CISD2	Equus caballus (Horse)	autophagy of mitochondrion [GO:0000422]; regulation of autophagy [GO:0010506]	endoplasmic reticulum membrane [GO:0005789]; mitochondrial outer membrane [GO:0005741]	"2 iron, 2 sulfur cluster binding [GO:0051537]; metal ion binding [GO:0046872]"	AAYCRCWRSK	0.88122	0.45217	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	684.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6W0Y9	F6W0Y9_HORSE	Cilia and flagella associated protein 74	CFAP74	Equus caballus (Horse)				DILARTMEQLR	0.98647	-1.3612	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	465.48	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6W1S9	F6W1S9_HORSE	AP complex subunit sigma	AP2S1	Equus caballus (Horse)	clathrin-dependent endocytosis [GO:0072583]; intracellular protein transport [GO:0006886]; synaptic vesicle endocytosis [GO:0048488]	AP-2 adaptor complex [GO:0030122]; presynapse [GO:0098793]	clathrin adaptor activity [GO:0035615]	MIRFILIQNRAGK	0.32222	0.81483	0	0	0	0	0	0	0	0	0	0	0	2746.7	0	0	0	0	0	0	0	368.53	751.93	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1861.3	0	1782.7	0	0	0	0	0	0	0	0	0	0	0	0	0	1618.6	0	0	0	0	0	0	0	0	0	0	0	0	0
F6W246	F6W246_HORSE	Cilia- and flagella-associated protein 43	CFAP43	Equus caballus (Horse)				DYEKKVK	0.98585	-2.0475	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	740.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6W325	F6W325_HORSE	Growth differentiation factor 7	GDF7	Equus caballus (Horse)	activin receptor signaling pathway [GO:0032924]; axon guidance [GO:0007411]; BMP signaling pathway [GO:0030509]; branching morphogenesis of an epithelial tube [GO:0048754]; cell fate commitment [GO:0045165]; epithelial cell differentiation [GO:0030855]; forebrain morphogenesis [GO:0048853]; gland morphogenesis [GO:0022612]; midbrain development [GO:0030901]; morphogenesis of an epithelial fold [GO:0060571]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of gene expression [GO:0010628]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of SMAD protein signal transduction [GO:0060391]; positive regulation of tendon cell differentiation [GO:2001051]; reproductive structure development [GO:0048608]; roof plate formation [GO:0021509]; spinal cord association neuron differentiation [GO:0021527]	extracellular space [GO:0005615]	cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; identical protein binding [GO:0042802]	AAAGPAR	0.9479	0.23881	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41275	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50897	0	0	0
F6W389	F6W389_HORSE	Cyclin dependent kinase 3	CDK3	Equus caballus (Horse)	DNA damage response [GO:0006974]; G0 to G1 transition [GO:0045023]; G1/S transition of mitotic cell cycle [GO:0000082]; negative regulation of Notch signaling pathway [GO:0045746]; regulation of G2/M transition of mitotic cell cycle [GO:0010389]; regulation of gene expression [GO:0010468]; response to organic substance [GO:0010033]; signal transduction [GO:0007165]	cyclin-dependent protein kinase holoenzyme complex [GO:0000307]; cytoplasm [GO:0005737]; nucleus [GO:0005634]	ATP binding [GO:0005524]; cyclin binding [GO:0030332]; cyclin-dependent protein serine/threonine kinase activity [GO:0004693]	ELKHPNIVR	0.99012	-1.2518	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	718.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	575.18	0	0
F6W416	F6W416_HORSE	Pro-FMRFamide-related neuropeptide VF	NPVF	Equus caballus (Horse)	negative regulation of gonadotropin secretion [GO:0032277]; neuropeptide signaling pathway [GO:0007218]	extracellular region [GO:0005576]	signaling receptor binding [GO:0005102]	FGRTMEEER	0.98824	-1.8759	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	520.54	0	0	0	0	0	0	0	0
F6W4C5	F6W4C5_HORSE	"UDP-D-xylose:beta-D-glucoside alpha-1,3-D-xylosyltransferase (EC 2.4.2.42)"	GXYLT2	Equus caballus (Horse)			UDP-glycosyltransferase activity [GO:0008194]	RRPPRPRPRAGR	0.92578	0.28541	0	0	0	0	0	0	0	0	0	2387.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6W4K5	F6W4K5_HORSE	G protein regulated inducer of neurite outgrowth 1	GPRIN1	Equus caballus (Horse)	neuron projection development [GO:0031175]	plasma membrane [GO:0005886]		AEAAPEGKADVEQGDPVNSK	0.95522	0.22436	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	777.54	829.52	0	0	0	0	0	0	0	0	0	577.13	649.13	0	0	0	0	0	0	0	0	0	0	723.75	0	0	0	0	0	0	0	0	0	0	0	0	1197.5	1091.6	601.38	593.32	0	2450.8	1662.4	0	0	0	0	537.35	496.02	0	634.21	538.19	572.63	0	0	0	0	0	0
F6W4T6	F6W4T6_HORSE	ASXL transcriptional regulator 3	ASXL3	Equus caballus (Horse)	animal organ morphogenesis [GO:0009887]; positive regulation of transcription by RNA polymerase II [GO:0045944]	PR-DUB complex [GO:0035517]	chromatin binding [GO:0003682]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; peroxisome proliferator activated receptor binding [GO:0042975]	ASPSTSVSGGRNTGAR	0.96655	-0.090165	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	334.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6W5X0	F6W5X0_HORSE	Ras like without CAAX 1	RIT1	Equus caballus (Horse)	Ras protein signal transduction [GO:0007265]	plasma membrane [GO:0005886]	calmodulin binding [GO:0005516]; GDP binding [GO:0019003]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]	HGPESEK	0.98435	-0.24218	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	555.14	0	595.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6W6R2	F6W6R2_HORSE	TBC1 domain family member 5	TBC1D5	Equus caballus (Horse)				ELRSMIEQDVK	0.98329	-0.79703	603.07	1184.9	0	0	0	0	1258.4	0	0	0	0	0	0	0	0	0	0	0	552.81	2512.6	0	570.61	663.81	500.43	598.89	816.65	809.48	0	0	0	0	2504.6	2714.4	3032.9	0	1896.9	924.59	1136.6	1130.8	3117.1	2639.6	2612.2	911.4	759.21	0	0	2586.5	2125.4	1611.7	1365	1434.7	0	1946.4	0	0	1538.6	1480.8	2054.1	0	2078.6	947.78	0	2252.7	1100.2	1087	967.1	1628.5	1540.9	1665.3	807	0	0	768.98	1012.7	937.11
F6W795	F6W795_HORSE	Klotho beta	KLB	Equus caballus (Horse)	carbohydrate metabolic process [GO:0005975]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of MAPKKK cascade by fibroblast growth factor receptor signaling pathway [GO:0090080]	membrane [GO:0016020]	"fibroblast growth factor binding [GO:0017134]; fibroblast growth factor receptor binding [GO:0005104]; hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]"	STLPQFTEEERR	0.69536	0.62574	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2347.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6W907	F6W907_HORSE	Synaptonemal complex protein 2	SYCP2	Equus caballus (Horse)	female meiotic nuclear division [GO:0007143]; male meiotic nuclear division [GO:0007140]	lateral element [GO:0000800]		NTTVNIK	0.96525	0.0031099	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1615.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6W9Q0	F6W9Q0_HORSE	Zinc finger protein 883-like	LOC106781339	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	AFSQSSTLIK	0.93139	0.26898	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	444.69	0	0
F6W9Z5	F6W9Z5_HORSE	26S proteasome regulatory subunit 8 (26S proteasome AAA-ATPase subunit RPT6) (Proteasome 26S subunit ATPase 5) (Proteasome subunit p45) (p45/SUG)	PSMC5	Equus caballus (Horse)		proteasome complex [GO:0000502]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]	GVLLYGPPGTGK	0.91876	0.30441	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	384.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WAW1	F6WAW1_HORSE	Presenilin (EC 3.4.23.-)	PSEN2	Equus caballus (Horse)	amyloid-beta formation [GO:0034205]; intracellular signal transduction [GO:0035556]; membrane protein ectodomain proteolysis [GO:0006509]; mitochondrion-endoplasmic reticulum membrane tethering [GO:1990456]; Notch signaling pathway [GO:0007219]; protein processing [GO:0016485]; regulation of calcium import into the mitochondrion [GO:0110097]	centrosome [GO:0005813]; endoplasmic reticulum membrane [GO:0005789]; gamma-secretase complex [GO:0070765]; Golgi membrane [GO:0000139]; kinetochore [GO:0000776]; nuclear inner membrane [GO:0005637]	"aspartic endopeptidase activity, intramembrane cleaving [GO:0042500]"	GVGPAGR	0.95333	0.23188	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	558.61	0	0	0	0	925.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42818
F6WCQ8	F6WCQ8_HORSE	Zinc finger FYVE-type containing 1	ZFYVE1	Equus caballus (Horse)	lipid droplet formation [GO:0140042]	lipid droplet [GO:0005811]	"1-phosphatidylinositol binding [GO:0005545]; metal ion binding [GO:0046872]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547]; phosphatidylinositol-3,4-bisphosphate binding [GO:0043325]; phosphatidylinositol-3-phosphate binding [GO:0032266]"	EGVPHEAKSRCR	0.99079	-1.2587	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	711.65	0	0	0	0	0	0	0	0	0	0	0	642.78	658.22	704.93	0	0	0	0	0	0	0	1117.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WDY0	F6WDY0_HORSE	LIF receptor subunit alpha	LIFR	Equus caballus (Horse)	cytokine-mediated signaling pathway [GO:0019221]; positive regulation of cell population proliferation [GO:0008284]	external side of plasma membrane [GO:0009897]; receptor complex [GO:0043235]	ciliary neurotrophic factor receptor binding [GO:0005127]; cytokine binding [GO:0019955]; cytokine receptor activity [GO:0004896]; growth factor binding [GO:0019838]; leukemia inhibitory factor receptor activity [GO:0004923]; oncostatin-M receptor activity [GO:0004924]	AGAAPAR	0.99012	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24823	0	0	0	0	0	0	0
F6WFT5	F6WFT5_HORSE	Paired box 2	PAX2	Equus caballus (Horse)	branching involved in ureteric bud morphogenesis [GO:0001658]; metanephric epithelium development [GO:0072207]; negative regulation of apoptotic process [GO:0043066]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of reactive oxygen species metabolic process [GO:2000378]; positive regulation of epithelial cell proliferation [GO:0050679]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of metanephros size [GO:0035566]	centriolar satellite [GO:0034451]; nucleoplasm [GO:0005654]	cis-regulatory region sequence-specific DNA binding [GO:0000987]; DNA-binding transcription factor activity [GO:0003700]	KEEPGRNGR	0.96189	-0.14385	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	589.13	0	0	0	0	0	735.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WG10	F6WG10_HORSE	Transcription factor 23	TCF23	Equus caballus (Horse)	developmental process [GO:0032502]; regulation of transcription by RNA polymerase II [GO:0006357]		"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; protein dimerization activity [GO:0046983]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	LLAGTDR	0.96801	-0.041961	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	813.62	0	0
F6WHL3	F6WHL3_HORSE	Tripartite motif containing 38	TRIM38	Equus caballus (Horse)	innate immune response [GO:0045087]; positive regulation of autophagy [GO:0010508]; positive regulation of canonical NF-kappaB signal transduction [GO:0043123]; protein polyubiquitination [GO:0000209]; regulation of protein localization [GO:0032880]; regulation of viral entry into host cell [GO:0046596]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]	protein homodimerization activity [GO:0042803]; protein kinase binding [GO:0019901]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]	INIQRQK	0.99044	-1.6584	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2279.9	0	0	0	0	0	0	0	0	0	0	0	1806.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WIH8	F6WIH8_HORSE	Cleavage stimulation factor subunit 2	CSTF2	Equus caballus (Horse)	mRNA 3'-end processing [GO:0031124]		RNA binding [GO:0003723]	AVASLPPEQMFELMK	0.96966	-0.043252	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	981.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WIX9	F6WIX9_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	MAST2	Equus caballus (Horse)	phosphorylation [GO:0016310]	cytoplasm [GO:0005737]	ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]; protein serine/threonine kinase activity [GO:0004674]	APIIIHRAGK	0.98055	-0.52398	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1292.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WJW2	F6WJW2_HORSE	Chromosome 27 C8orf48 homolog	C27H8orf48	Equus caballus (Horse)				KRAELAQSAFLK	0.96781	0.025901	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	379.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WK88	F6WK88_HORSE	Vps72/YL1 N-terminal domain-containing protein		Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]	nucleus [GO:0005634]	ATP-dependent H2AZ histone chaperone activity [GO:0140849]	SLAGGQAPR	0.96681	-0.09575	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	374.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WKH5	F6WKH5_HORSE	Myelin regulatory factor	MYRF	Equus caballus (Horse)	central nervous system myelin maintenance [GO:0032286]; positive regulation of DNA-templated transcription [GO:0045893]; protein autoprocessing [GO:0016540]	endoplasmic reticulum membrane [GO:0005789]; nucleus [GO:0005634]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	EILPEAVK	0.97511	0.050128	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1116.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WLZ4	F6WLZ4_HORSE	Testis specific serine kinase substrate	TSKS	Equus caballus (Horse)		centriole [GO:0005814]	protein kinase binding [GO:0019901]	GGPAPEQ	0.98998	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	533.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WM33	F6WM33_HORSE	Testis expressed 13A	TEX13A	Equus caballus (Horse)			metal ion binding [GO:0046872]; mRNA binding [GO:0003729]	GIWLQNP	0.96954	0.034496	0	0	0	0	0	0	0	0	763.37	0	0	0	631.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2974.5	0	1247.1	1066.6	0	0	0	0	0	0	0	0	0	0	637.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WM48	F6WM48_HORSE	mitogen-activated protein kinase kinase kinase (EC 2.7.11.25)	MAP3K3	Equus caballus (Horse)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	DSAGNVK	0.9439	0.24431	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	341.22	0	0	0	0	0	0	0	0	0	0
F6WMB5	F6WMB5_HORSE	Pannexin	PANX2 PANX	Equus caballus (Horse)	cell-cell signaling [GO:0007267]; monoatomic cation transport [GO:0006812]; monoatomic ion transmembrane transport [GO:0034220]; positive regulation of interleukin-1 production [GO:0032732]; response to ischemia [GO:0002931]	cytoplasm [GO:0005737]; gap junction [GO:0005921]; plasma membrane [GO:0005886]	wide pore channel activity [GO:0022829]	GPGITER	0.98522	-2.0904	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	697.13	0	0	0	0	0	1687	0	0	0	772.79	661.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	603.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WMJ1	F6WMJ1_HORSE	BEN domain containing 3	BEND3	Equus caballus (Horse)	DNA methylation [GO:0006306]; negative regulation of transcription by RNA polymerase I [GO:0016479]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of ATP metabolic process [GO:1903580]; protein homooligomerization [GO:0051260]; rDNA heterochromatin formation [GO:0000183]	heterochromatin [GO:0000792]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	rDNA binding [GO:0000182]	RLIPEALLAGMR	0.98594	-1.9881	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	608.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WPG8	F6WPG8_HORSE	Olfactory receptor		Equus caballus (Horse)	detection of chemical stimulus involved in sensory perception of smell [GO:0050911]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	DSLGADK	0.93258	0.25591	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	376.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WQ22	F6WQ22_HORSE	BTB domain containing 1	BTBD1	Equus caballus (Horse)	neurogenesis [GO:0022008]	cytosol [GO:0005829]; P-body [GO:0000932]		IRSLNMRK	0.96516	-0.088107	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	466.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WQF0	F6WQF0_HORSE	Plectin	PLEC	Equus caballus (Horse)	intermediate filament cytoskeleton organization [GO:0045104]	cytoskeleton [GO:0005856]	actin binding [GO:0003779]	GLHHSIEEFRAK	0.98769	-5.1483	0	0	0	0	0	0	0	0	0	0	0	0	0	712.11	0	2310	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2635.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WRR6	F6WRR6_HORSE	Exosome component 5	EXOSC5	Equus caballus (Horse)	"nuclear mRNA surveillance [GO:0071028]; nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5' [GO:0034427]; polyadenylation-dependent snoRNA 3'-end processing [GO:0071051]; rRNA catabolic process [GO:0016075]; U4 snRNA 3'-end processing [GO:0034475]"	cytoplasmic exosome (RNase complex) [GO:0000177]; nuclear exosome (RNase complex) [GO:0000176]; nucleolus [GO:0005730]		IGLPGVAEK	0.97424	0.11237	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	711.92	0	718.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	628.27	616.47	0
F6WSM1	F6WSM1_HORSE	SH2B adaptor protein 2	SH2B2	Equus caballus (Horse)	signal transduction [GO:0007165]		signaling adaptor activity [GO:0035591]	AAEPPAEPR	0.88935	0.36684	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	458.52	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6WV18	F6WV18_HORSE	Olfactomedin 1	OLFM1	Equus caballus (Horse)		extracellular region [GO:0005576]; synapse [GO:0045202]		QHLARQFKAIK	0.98218	-0.21722	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	671.2	0	0	0	0	0	0	0	0
F6WW81	F6WW81_HORSE	Polybromo 1	PBRM1	Equus caballus (Horse)	chromatin remodeling [GO:0006338]; transcription elongation by RNA polymerase II [GO:0006368]	RSC-type complex [GO:0016586]; SWI/SNF complex [GO:0016514]	chromatin binding [GO:0003682]; DNA binding [GO:0003677]	AEYEERAAK	0.98431	-1.2955	0	0	0	0	0	0	0	0	0	0	0	0	0	347.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	272.32
F6WZA8	F6WZA8_HORSE	Carboxypeptidase N subunit 1	CPN1	Equus caballus (Horse)	peptide metabolic process [GO:0006518]; protein processing [GO:0016485]	extracellular space [GO:0005615]	metallocarboxypeptidase activity [GO:0004181]; zinc ion binding [GO:0008270]	LVAPVTFRHHR	0.98948	-1.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	521.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6X137	F6X137_HORSE	THAP domain containing 9	THAP9	Equus caballus (Horse)	DNA integration [GO:0015074]; DNA transposition [GO:0006313]		DNA binding [GO:0003677]; sequence-specific DNA binding [GO:0043565]; transposase activity [GO:0004803]	ALGILIDGDNMK	0.98586	-2.784	0	0	0	0	0	0	0	0	0	0	0	499	0	0	0	0	0	0	1919.3	0	0	0	0	0	0	0	0	0	0	0	789.7	0	0	0	4201	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	502.92	0	0	0	0	0	0	0
F6X1A3	F6X1A3_HORSE	H1.10 linker histone	H1-10	Equus caballus (Horse)	chromosome condensation [GO:0030261]; negative regulation of DNA recombination [GO:0045910]; nucleosome assembly [GO:0006334]	nucleosome [GO:0000786]; nucleus [GO:0005634]	double-stranded DNA binding [GO:0003690]; nucleosomal DNA binding [GO:0031492]; structural constituent of chromatin [GO:0030527]	AGGSAALSPSKK	0.98556	-0.86267	0	0	0	0	1276.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	701.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	680.54	586.98	514.85	0	0	0	0	596.95	568.46	585.13	559.5	509.39	0	594.73	542.16	577.94	0	0	0	0	0	0
F6X1C1	F6X1C1_HORSE	Transcription factor AP-2 epsilon	TFAP2E	Equus caballus (Horse)	anatomical structure development [GO:0048856]; regulation of cell population proliferation [GO:0042127]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; identical protein binding [GO:0042802]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	RARAPPPPR	0.96636	-0.1691	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	544.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6X1I8	F6X1I8_HORSE	Hemopexin	HPX	Equus caballus (Horse)	heme metabolic process [GO:0042168]; hemoglobin metabolic process [GO:0020027]; intracellular iron ion homeostasis [GO:0006879]; positive regulation of humoral immune response mediated by circulating immunoglobulin [GO:0002925]; positive regulation of immunoglobulin production [GO:0002639]; positive regulation of type II interferon-mediated signaling pathway [GO:0060335]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]; type II interferon-mediated signaling pathway [GO:0060333]	extracellular space [GO:0005615]	heme transmembrane transporter activity [GO:0015232]; metal ion binding [GO:0046872]	GECQDEGILFFK	0	32.489	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	472.43	0	0	0	0	0	0	461.72	1056.9	0	503.8	539.36	0	0	0	0	0	0	0	1164.6	804.7	0	0	0	0	0	0	0	0	0	0	0	1042.9	1122.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6X267	F6X267_HORSE	Myosin heavy chain 7B	MYH7B	Equus caballus (Horse)		cardiac myofibril [GO:0097512]; myosin complex [GO:0016459]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; cytoskeletal motor activity [GO:0003774]	DEEQRLVAELR	0.98635	-3.2339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	879.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	446.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6X2S3	F6X2S3_HORSE	PPFIA binding protein 1	PPFIBP1	Equus caballus (Horse)				GGTRATAGPR	0.98714	-1.9061	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1291.8	0	0	0	0	3103.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6X2Z9	F6X2Z9_HORSE	Proline-serine-threonine phosphatase interacting protein 1	PSTPIP1	Equus caballus (Horse)				KAMESQNK	0.98789	-1.0796	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	655.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6X4C8	F6X4C8_HORSE	Ankyrin repeat domain 49	ANKRD49	Equus caballus (Horse)	positive regulation of DNA-templated transcription [GO:0045893]			LATVQRLLSEK	0.35025	0.77121	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2030.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6X4Y8	F6X4Y8_HORSE	Density-regulated protein	DENR	Equus caballus (Horse)	formation of translation preinitiation complex [GO:0001731]; IRES-dependent viral translational initiation [GO:0075522]; ribosome disassembly [GO:0032790]; translation reinitiation [GO:0002188]		mRNA binding [GO:0003729]; translation initiation factor activity [GO:0003743]	LADGLSGGR	0.97686	0.057522	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1705.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6X5D4	F6X5D4_HORSE	Golgi associated RAB2 interactor family member 6	GARIN6	Equus caballus (Horse)				LSVYNYVK	0.9738	0.11169	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	655.57	0	605.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6X658	F6X658_HORSE	coproporphyrinogen oxidase (EC 1.3.3.3)	CPOX	Equus caballus (Horse)	protoporphyrinogen IX biosynthetic process [GO:0006782]	cytoplasm [GO:0005737]	coproporphyrinogen oxidase activity [GO:0004109]	FSVDRWER	0.98856	-1.698	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	776.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6X6B1	F6X6B1_HORSE	Transmembrane protein 120B	TMEM120B	Equus caballus (Horse)	fat cell differentiation [GO:0045444]	nuclear inner membrane [GO:0005637]		FVLHYRIK	0.98622	-2.0128	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1713.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6X9D3	F6X9D3_HORSE	Nucleophosmin	NPM1	Equus caballus (Horse)	chromatin remodeling [GO:0006338]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of centrosome duplication [GO:0010824]; ribosomal large subunit biogenesis [GO:0042273]; ribosomal large subunit export from nucleus [GO:0000055]; ribosomal small subunit biogenesis [GO:0042274]; ribosomal small subunit export from nucleus [GO:0000056]; rRNA export from nucleus [GO:0006407]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; ribonucleoprotein complex [GO:1990904]	chromatin binding [GO:0003682]; histone binding [GO:0042393]; RNA binding [GO:0003723]	LLSISGK	0.93072	0.27174	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	275.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	582.96	0	0
F6X9Q9	F6X9Q9_HORSE	BRCA1 interacting helicase 1	BRIP1	Equus caballus (Horse)	double-strand break repair involved in meiotic recombination [GO:1990918]; nucleotide-excision repair [GO:0006289]	nucleus [GO:0005634]	"ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [GO:0016818]"	QIAQITRELRR	0.89746	0.32674	0	0	0	0	630.35	597.26	511.83	0	0	1443.6	1587.6	1728.7	0	0	0	1348.6	1398.7	1692.8	0	755.67	667.59	1040.5	0	1188.8	0	0	573.72	0	0	0	1454.5	0	0	0	1663.9	1945	454.54	0	336.66	0	695.41	0	534.06	607.13	0	0	823.39	1028.6	0	0	0	0	616.44	738.52	0	0	634.43	0	0	0	685.62	0	854.16	0	0	0	599.4	625.41	0	480.54	387.44	418.83	916.21	1119.2	977.44
F6XAI5	F6XAI5_HORSE	DnaJ heat shock protein family (Hsp40) member C14	DNAJC14	Equus caballus (Horse)		membrane [GO:0016020]	dopamine receptor binding [GO:0050780]	GLCGAHHSGGASLR	0.92552	0.283	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	579.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XB14	F6XB14_HORSE	Interleukin 1 receptor like 1	IL1RL1	Equus caballus (Horse)	inflammatory response [GO:0006954]		interleukin-1 receptor activity [GO:0004908]; interleukin-33 binding [GO:0002113]	TASITCSACFGK	0.91667	0.30294	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	733.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XB71	F6XB71_HORSE	Serine/threonine-protein kinase RIO1 (EC 2.7.11.1)	RIOK1	Equus caballus (Horse)	maturation of SSU-rRNA [GO:0030490]; phosphorylation [GO:0016310]	"cytosol [GO:0005829]; preribosome, small subunit precursor [GO:0030688]"	ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	SSQDHVDEEVFKRAYIPR	0.90863	0.29743	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	773.22	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XBA1	F6XBA1_HORSE	HEAT repeat containing 4	HEATR4	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	MTKTQKGK	0.98384	-0.72584	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2366.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XCB2	F6XCB2_HORSE	Tetratricopeptide repeat domain 31	TTC31	Equus caballus (Horse)				LEQDGVEPK	0.9667	-0.082372	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	897.32	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XCF2	F6XCF2_HORSE	Tubulin beta chain	TUBB6	Equus caballus (Horse)	microtubule cytoskeleton organization [GO:0000226]; mitotic cell cycle [GO:0000278]	cytoplasm [GO:0005737]; intercellular bridge [GO:0045171]; microtubule [GO:0005874]; mitotic spindle [GO:0072686]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]; structural constituent of cytoskeleton [GO:0005200]	LAVNMVPFPR	0.96705	-0.1691	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2207.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XCW4	F6XCW4_HORSE	PHD finger protein 1	PHF1	Equus caballus (Horse)	DNA repair-dependent chromatin remodeling [GO:0140861]	centrosome [GO:0005813]; cytosol [GO:0005829]; ESC/E(Z) complex [GO:0035098]; site of double-strand break [GO:0035861]	histone methyltransferase binding [GO:1990226]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; methylated histone binding [GO:0035064]; transcription corepressor binding [GO:0001222]	GDPVRVLAR	0.99177	-1.2488	0	0	0	0	0	0	469.73	0	0	0	754.13	0	0	0	0	802.03	0	492.03	0	0	0	0	0	0	0	0	0	0	0	0	0	0	540.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	609.68	0	0	0	0	0
F6XCY2	F6XCY2_HORSE	Kremen protein (Kringle-containing protein marking the eye and the nose)	KREMEN2	Equus caballus (Horse)	Wnt signaling pathway [GO:0016055]	plasma membrane [GO:0005886]		LELRDAASGRLLR	0.98577	-1.0119	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	508.85	377.86	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	867.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XDN0	F6XDN0_HORSE	Heat shock protein family A (Hsp70) member 12A	HSPA12A	Equus caballus (Horse)				TPTTILLTPERK	0.74815	0.54842	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	676.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XDR8	F6XDR8_HORSE	Ubiquitin carboxyl-terminal hydrolase MINDY (EC 3.4.19.12)	MINDY4	Equus caballus (Horse)	proteolysis [GO:0006508]		cysteine-type deubiquitinase activity [GO:0004843]; K48-linked deubiquitinase activity [GO:1990380]	RMGEKVRPKPGLIVR	0.92901	0.2758	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	954.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XFB9	F6XFB9_HORSE	adenylate cyclase (EC 4.6.1.1)	ADCY9	Equus caballus (Horse)	adenylate cyclase-activating adrenergic receptor signaling pathway [GO:0071880]; adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; cAMP biosynthetic process [GO:0006171]; in utero embryonic development [GO:0001701]; intracellular signal transduction [GO:0035556]	cytosol [GO:0005829]; plasma membrane [GO:0005886]	adenylate cyclase activity [GO:0004016]	EFEVSYR	0.97123	0.033084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	548.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XHD0	F6XHD0_HORSE	HPS1 biosis of lysosomal organelles complex 3 subunit 1	HPS1	Equus caballus (Horse)	melanosome assembly [GO:1903232]; vesicle-mediated transport [GO:0016192]	BLOC-3 complex [GO:0031085]		APRWEGRR	0.93952	0.25162	0	0	0	0	0	0	0	0	1006.4	0	0	652.59	0	0	0	842.62	864.55	0	0	982.84	0	1170.1	0	1242.6	0	0	518.77	0	0	0	0	0	0	0	0	0	1105.7	0	0	0	0	0	743.61	0	0	0	0	0	0	0	0	602.34	0	0	0	0	751.71	0	0	0	0	0	0	0	0	518.21	679.27	0	667.01	0	0	0	0	0	637.61
F6XI22	F6XI22_HORSE	Chromosome 30 C1orf100 homolog	SPMIP3 C30H1orf100	Equus caballus (Horse)				YICFQRR	0.98376	-0.70864	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1540.3	0	0	0	0	0	0	0	0	0	0	0	0	0	1098.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XLJ7	F6XLJ7_HORSE	Cystathionine beta-synthase (EC 4.2.1.22)	LOC100146156	Equus caballus (Horse)	cysteine biosynthetic process from serine [GO:0006535]; cysteine biosynthetic process via cystathionine [GO:0019343]	cytoplasm [GO:0005737]	cystathionine beta-synthase activity [GO:0004122]	SGSALEP	0.96066	0.2189	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	381.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XNA2	F6XNA2_HORSE	Meiosis specific with coiled-coil domain	MEIOC	Equus caballus (Horse)	female meiosis I [GO:0007144]; male meiosis I [GO:0007141]; mRNA stabilization [GO:0048255]	cytoplasm [GO:0005737]; nucleus [GO:0005634]		DEIVNASNR	0.96669	0.021815	0	0	0	0	0	0	0	0	0	0	513.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1105.7	688.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XPF7	F6XPF7_HORSE	Pyridoxal phosphatase	PDXP	Equus caballus (Horse)	actin rod assembly [GO:0031247]; cellular response to ATP [GO:0071318]; dephosphorylation [GO:0016311]; positive regulation of actin filament depolymerization [GO:0030836]; pyridoxal phosphate catabolic process [GO:0032361]; regulation of cytokinesis [GO:0032465]; regulation of mitotic nuclear division [GO:0007088]	actin cytoskeleton [GO:0015629]; cell-cell junction [GO:0005911]; cleavage furrow [GO:0032154]; contractile ring [GO:0070938]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; lamellipodium [GO:0030027]; midbody [GO:0030496]; ruffle membrane [GO:0032587]	heat shock protein binding [GO:0031072]; magnesium ion binding [GO:0000287]; phosphoprotein phosphatase activity [GO:0004721]; protein homodimerization activity [GO:0042803]; pyridoxal phosphatase activity [GO:0033883]	AVPGAPELLQR	0.96351	-0.13893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	606.64	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XPR5	F6XPR5_HORSE	Gamma-glutamylaminecyclotransferase (EC 4.3.2.8)	GGACT	Equus caballus (Horse)	cellular modified amino acid catabolic process [GO:0042219]	cytosol [GO:0005829]	gamma-glutamylaminecyclotransferase activity [GO:0061929]	VPADCPHVPK	0.9616	-0.14541	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	317.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XQM8	F6XQM8_HORSE	Uroplakin 3B like 1	LOC100060825	Equus caballus (Horse)		membrane [GO:0016020]		QTLRRTDSR	0.96321	-0.13798	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	848.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XSS2	F6XSS2_HORSE	OTU deubiquitinase with linear linkage specificity like	OTULINL	Equus caballus (Horse)		cytoplasm [GO:0005737]; membrane [GO:0016020]		GETPRAK	0.98949	-1.6784	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	723.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	929.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XTV3	F6XTV3_HORSE	"Keratin, type II cytoskeletal 8 (Cytokeratin-8) (Keratin-8) (Type-II keratin Kb8)"	KRT8	Equus caballus (Horse)		keratin filament [GO:0045095]		FASFIDK	0.96632	-0.15473	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	431.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XU93	F6XU93_HORSE	ADP ribosylation factor guanine nucleotide exchange factor 2	ARFGEF2	Equus caballus (Horse)	protein transport [GO:0015031]; regulation of ARF protein signal transduction [GO:0032012]	Golgi apparatus [GO:0005794]; perinuclear region of cytoplasm [GO:0048471]	guanyl-nucleotide exchange factor activity [GO:0005085]	QSLSSIDK	0.94972	0.23754	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	431.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6XYF8	F6XYF8_HORSE	Tripartite motif-containing protein 26 (Zinc finger protein 173)	TRIM26	Equus caballus (Horse)	innate immune response [GO:0045087]; negative regulation of viral entry into host cell [GO:0046597]; protein ubiquitination [GO:0016567]	cytoplasm [GO:0005737]	ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]	GVGELAR	0.95756	0.22133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	723.36	0	0	0	0
F6Y035	F6Y035_HORSE	AP-3 complex subunit mu-2	AP3M2	Equus caballus (Horse)	endocytosis [GO:0006897]; intracellular protein transport [GO:0006886]	clathrin adaptor complex [GO:0030131]; cytoplasmic vesicle [GO:0031410]; cytoplasmic vesicle membrane [GO:0030659]; Golgi apparatus [GO:0005794]		ILSFIPPDGNFR	0.96637	-0.075736	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	882.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	491.92
F6Y0R6	F6Y0R6_HORSE	APC regulator of WNT signaling pathway	APC	Equus caballus (Horse)	cellular component organization [GO:0016043]; negative regulation of Wnt signaling pathway [GO:0030178]; Wnt signaling pathway [GO:0016055]	cell periphery [GO:0071944]; cytoplasm [GO:0005737]; intracellular membrane-bounded organelle [GO:0043231]; microtubule [GO:0005874]	beta-catenin binding [GO:0008013]; microtubule binding [GO:0008017]	HSSPSGTVAAR	0.96673	0.020627	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1021.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	361.89	0	0	0	0	0	0	0	0
F6Y108	F6Y108_HORSE	Transient receptor potential cation channel subfamily M member 4	TRPM4	Equus caballus (Horse)		membrane [GO:0016020]	monoatomic ion channel activity [GO:0005216]	LLLRRFCK	0.96636	-0.10056	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	685.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Y1T2	F6Y1T2_HORSE	G protein-coupled receptor 149	GPR149	Equus caballus (Horse)	antral ovarian follicle growth [GO:0001547]; negative regulation of ovulation [GO:0060280]; neuropeptide signaling pathway [GO:0007218]; preantral ovarian follicle growth [GO:0001546]	membrane [GO:0016020]; neuron projection [GO:0043005]	G protein-coupled receptor activity [GO:0004930]; neuropeptide binding [GO:0042923]	TAKDSQR	0.98862	-1.8029	0	0	0	0	0	0	0	0	0	0	1715.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Y2R5	F6Y2R5_HORSE	"Protein phosphatase, Mg2+/Mn2+ dependent 1H"	PPM1H	Equus caballus (Horse)		mitochondrion [GO:0005739]	[pyruvate dehydrogenase (lipoamide)] phosphatase activity [GO:0004741]; protein serine/threonine phosphatase activity [GO:0004722]	LERQPQPMRLK	0.83883	0.48922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	566.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Y366	F6Y366_HORSE	N-acetylgalactosamine-6-sulfatase (EC 3.1.6.4) (Chondroitinsulfatase) (Galactose-6-sulfate sulfatase) (N-acetylgalactosamine-6-sulfate sulfatase)	GALNS	Equus caballus (Horse)		lysosome [GO:0005764]	metal ion binding [GO:0046872]; N-acetylgalactosamine-6-sulfatase activity [GO:0043890]	DPGERFPLRPKR	0.97276	-0.18353	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4920.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Y4K8	F6Y4K8_HORSE	Spondin 2	SPON2	Equus caballus (Horse)	cell adhesion [GO:0007155]	extracellular region [GO:0005576]	metal ion binding [GO:0046872]	GRAGWMPTSK	0.9896	-1.1383	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	504.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Y548	F6Y548_HORSE	Leucine rich repeat containing 75A	LRRC75A	Equus caballus (Horse)		cytoplasm [GO:0005737]		VGLHPSPHR	0.97126	0.040459	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1095.6	0	0	0	0	2361.5	0	0	0	2356.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Y5A4	F6Y5A4_HORSE	Transcription factor JunB (Transcription factor AP-1 subunit JunB)	JUNB	Equus caballus (Horse)	regulation of cell cycle [GO:0051726]; regulation of cell population proliferation [GO:0042127]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	ALDDLHK	0.96742	-0.029585	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2076	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Y688	F6Y688_HORSE	Terpene cyclase/mutase family member (EC 5.4.99.-)	LSS	Equus caballus (Horse)	triterpenoid biosynthetic process [GO:0016104]	lipid droplet [GO:0005811]	intramolecular transferase activity [GO:0016866]	RRGGPYK	0.96629	-0.0902	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1132.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Y6D6	F6Y6D6_HORSE	T-complex 11 like 2	TCP11L2	Equus caballus (Horse)	signal transduction [GO:0007165]			SLLCLTSPQK	0.92011	0.30819	312.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	978.93	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	436.31	0	0	0	0	0	0	0	0	0
F6YAM5	F6YAM5_HORSE	MBL associated serine protease 2	MASP2	Equus caballus (Horse)	"complement activation, classical pathway [GO:0006958]; complement activation, lectin pathway [GO:0001867]; proteolysis [GO:0006508]"	extracellular space [GO:0005615]	calcium ion binding [GO:0005509]; calcium-dependent protein binding [GO:0048306]; complement component C4b binding [GO:0001855]; serine-type endopeptidase activity [GO:0004252]	RTCSALCLGQVFTDR	0.9794	-0.33698	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1018.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YAP3	F6YAP3_HORSE	Nucleolar complex associated 4 homolog	NOC4L	Equus caballus (Horse)	ribosome biogenesis [GO:0042254]	Noc4p-Nop14p complex [GO:0030692]; nuclear membrane [GO:0031965]; nucleolus [GO:0005730]; small-subunit processome [GO:0032040]		KYKMWMR	0.96559	-0.076577	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	884.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YBY6	F6YBY6_HORSE	Polypeptide N-acetylgalactosaminyltransferase (EC 2.4.1.-) (Protein-UDP acetylgalactosaminyltransferase)	GALNT8	Equus caballus (Horse)	protein O-linked glycosylation [GO:0006493]	Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]	carbohydrate binding [GO:0030246]; polypeptide N-acetylgalactosaminyltransferase activity [GO:0004653]	VIPSSLQR	0.97396	0.10697	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1601.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YDZ0	F6YDZ0_HORSE	Serpin B5	SERPINB5	Equus caballus (Horse)		extracellular space [GO:0005615]	serine-type endopeptidase inhibitor activity [GO:0004867]	HLSMLILLPK	0.96602	-0.15285	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4909.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YF28	F6YF28_HORSE	UDP glycosyltransferase 8	UGT8	Equus caballus (Horse)	galactosylceramide biosynthetic process [GO:0006682]	endoplasmic reticulum [GO:0005783]; membrane [GO:0016020]	2-hydroxyacylsphingosine 1-beta-galactosyltransferase activity [GO:0003851]	AQKLSEIHK	0.064103	1.5421	0	0	0	0	0	0	0	0	0	505.81	0	0	0	0	0	0	1279.3	866.17	0	0	0	0	0	0	0	0	0	0	0	485.2	0	721.45	805.68	985.84	1089.4	0	0	0	0	0	797.2	885.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	278.93	0	0	0	0	254.8	0	0	0	0	0	0	0	0
F6YFM9	F6YFM9_HORSE	Calcium dependent secretion activator 2	CADPS2	Equus caballus (Horse)	dense core granule exocytosis [GO:1990504]; exocytosis [GO:0006887]; positive regulation of exocytosis [GO:0045921]; protein transport [GO:0015031]; synaptic vesicle exocytosis [GO:0016079]	cytoplasmic vesicle [GO:0031410]; glutamatergic synapse [GO:0098978]; presynapse [GO:0098793]		TLIKIVK	0.98611	-0.86442	2912.3	3513	3346.8	4509.7	4510.1	4538.1	4409.7	4203.5	4540.4	3853.4	5322.5	4166.4	4406.1	4657.7	4911.2	0	0	0	2914.8	4195.9	4216.5	4706.5	4886.7	4634.6	3938.1	4681.9	4900.1	0	0	0	452.53	0	451.88	0	0	0	3247.5	3932.9	3517.2	0	0	0	3051.1	3166	3263.6	0	0	0	3160.7	3129.9	3131.7	4661.2	4355.7	5038.1	2553.1	2797.3	4513.8	0	0	0	4886.5	5868.3	6752.7	5458.2	5067.2	6134.4	5907.2	5556.9	6445.2	6280.5	5620.8	4872	6085.1	6145.5	0
F6YGK2	F6YGK2_HORSE	Adenylate cyclase type 2 (EC 4.6.1.1)	ADCY2	Equus caballus (Horse)	cAMP biosynthetic process [GO:0006171]; intracellular signal transduction [GO:0035556]	plasma membrane [GO:0005886]	adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]	ILEKEYR	0.98895	-1.6914	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2359.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YHG4	F6YHG4_HORSE	Calcitonin receptor	CALCR	Equus caballus (Horse)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; amylin receptor signaling pathway [GO:0097647]; cell surface receptor signaling pathway [GO:0007166]; negative regulation of ossification [GO:0030279]; ossification [GO:0001503]; osteoclast differentiation [GO:0030316]; positive regulation of calcium-mediated signaling [GO:0050850]; positive regulation of cAMP-mediated signaling [GO:0043950]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of gene expression [GO:0010628]; positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [GO:0051897]; positive regulation of protein kinase A signaling [GO:0010739]; regulation of mRNA stability [GO:0043488]; response to amyloid-beta [GO:1904645]; response to glucocorticoid [GO:0051384]	acrosomal vesicle [GO:0001669]; amylin receptor complex 1 [GO:0150056]; amylin receptor complex 2 [GO:0150057]; amylin receptor complex 3 [GO:0150058]; axon [GO:0030424]; cilium [GO:0005929]; plasma membrane [GO:0005886]	amylin receptor activity [GO:0097643]; amyloid-beta binding [GO:0001540]; calcitonin binding [GO:0032841]; calcitonin gene-related peptide receptor activity [GO:0001635]; calcitonin receptor activity [GO:0004948]	HWAQFKTQWNQR	0.91639	0.29241	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1023.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YHJ7	F6YHJ7_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	STK10	Equus caballus (Horse)	lymphocyte aggregation [GO:0071593]; regulation of lymphocyte migration [GO:2000401]	cytoplasm [GO:0005737]; plasma membrane [GO:0005886]	ATP binding [GO:0005524]; protein homodimerization activity [GO:0042803]; protein serine/threonine kinase activity [GO:0004674]	GTTVSRVPCGAGR	0.98645	-3.1346	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	782.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YHX0	F6YHX0_HORSE	Olfactory receptor family 2 subfamily T member 68	OR2T68	Equus caballus (Horse)	detection of chemical stimulus involved in sensory perception of smell [GO:0050911]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	EVTGALR	0	2.3604	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	795.03	697.23	0	0	0	0	1771.8	1577.7	0	0	0	0	0	0	0	0	0	0	698.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YHZ6	F6YHZ6_HORSE	"Leucine rich repeat, Ig-like and transmembrane domains 2"	LRIT2	Equus caballus (Horse)		membrane [GO:0016020]		YEACLSLGGRPPR	0.97017	-0.061681	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1067.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YI14	F6YI14_HORSE	ATP-binding cassette sub-family B member 6 (EC 7.6.2.5) (ABC-type heme transporter ABCB6)	ABCB6	Equus caballus (Horse)	brain development [GO:0007420]; cellular detoxification of cadmium ion [GO:0098849]; heme metabolic process [GO:0042168]; heme transport [GO:0015886]; melanosome assembly [GO:1903232]; porphyrin-containing compound biosynthetic process [GO:0006779]; skin development [GO:0043588]; transmembrane transport [GO:0055085]	cytosol [GO:0005829]; early endosome membrane [GO:0031901]; endolysosome membrane [GO:0036020]; endoplasmic reticulum membrane [GO:0005789]; extracellular exosome [GO:0070062]; Golgi membrane [GO:0000139]; melanosome membrane [GO:0033162]; mitochondrial outer membrane [GO:0005741]; multivesicular body membrane [GO:0032585]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; vacuolar membrane [GO:0005774]	ABC-type heme transporter activity [GO:0015439]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; efflux transmembrane transporter activity [GO:0015562]; heme binding [GO:0020037]	LAMGIWIK	0.74359	0.55961	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1064.8	0	0	0	0	0	0	0
F6YIH6	F6YIH6_HORSE	Myeloid leukemia factor 1	MLF1	Equus caballus (Horse)		cytoplasm [GO:0005737]		ALRDSDSGLEK	0.98625	-2.4371	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1797.3	24384	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	642.15	0	0	734.06	0	0
F6YJG4	F6YJG4_HORSE	Zinc finger CCCH-type containing 12A	ZC3H12A	Equus caballus (Horse)	3'-UTR-mediated mRNA destabilization [GO:0061158]; cellular response to chemokine [GO:1990869]; cellular response to glucose starvation [GO:0042149]; cellular response to ionomycin [GO:1904637]; cellular response to lipopolysaccharide [GO:0071222]; cellular response to oxidative stress [GO:0034599]; cellular response to sodium arsenite [GO:1903936]; cellular response to tumor necrosis factor [GO:0071356]; cellular response to virus [GO:0098586]; DNA damage response [GO:0006974]; miRNA catabolic process [GO:0010587]; mRNA catabolic process [GO:0006402]; negative regulation by host of viral genome replication [GO:0044828]; negative regulation of canonical NF-kappaB signal transduction [GO:0043124]; negative regulation of cardiac muscle contraction [GO:0055118]; negative regulation of cytokine production involved in inflammatory response [GO:1900016]; negative regulation of interleukin-1 beta production [GO:0032691]; negative regulation of interleukin-6 production [GO:0032715]; negative regulation of muscle cell apoptotic process [GO:0010656]; negative regulation of nitric oxide biosynthetic process [GO:0045019]; negative regulation of non-canonical NF-kappaB signal transduction [GO:1901223]; negative regulation of protein phosphorylation [GO:0001933]; negative regulation of T-helper 17 cell differentiation [GO:2000320]; negative regulation of tumor necrosis factor production [GO:0032720]; negative regulation of type II interferon production [GO:0032689]; positive regulation of angiogenesis [GO:0045766]; positive regulation of autophagy [GO:0010508]; positive regulation of defense response to virus by host [GO:0002230]; positive regulation of endothelial cell migration [GO:0010595]; positive regulation of execution phase of apoptosis [GO:1900119]; positive regulation of fat cell differentiation [GO:0045600]; positive regulation of gene expression [GO:0010628]; positive regulation of lipid storage [GO:0010884]; positive regulation of miRNA catabolic process [GO:2000627]; positive regulation of p38MAPK cascade [GO:1900745]; positive regulation of protein deubiquitination [GO:1903003]; positive regulation of protein import into nucleus [GO:0042307]; positive regulation of reactive oxygen species metabolic process [GO:2000379]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein complex oligomerization [GO:0051259]; T cell receptor signaling pathway [GO:0050852]	cytoplasmic ribonucleoprotein granule [GO:0036464]; cytoskeleton [GO:0005856]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; P-body [GO:0000932]; protein-containing complex [GO:0032991]; rough endoplasmic reticulum membrane [GO:0030867]	chromatin binding [GO:0003682]; cysteine-type deubiquitinase activity [GO:0004843]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]; miRNA binding [GO:0035198]; mRNA 3'-UTR AU-rich region binding [GO:0035925]; mRNA binding [GO:0003729]; ribosome binding [GO:0043022]; RNA endonuclease activity [GO:0004521]; RNA exonuclease activity [GO:0004532]; RNA stem-loop binding [GO:0035613]	KQPCPYGR	0.9833	-0.68627	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	791.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YK06	F6YK06_HORSE	Family with sequence similarity 200 member B	FAM200B	Equus caballus (Horse)				TLLLWEAR	0.95989	-0.016174	0	0	0	0	0	0	500.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YKA3	F6YKA3_HORSE	Sodium channel protein	SCN2A	Equus caballus (Horse)		voltage-gated sodium channel complex [GO:0001518]	voltage-gated sodium channel activity [GO:0005248]	ESLAAIEQR	0.96575	0.014667	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	776.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YM53	F6YM53_HORSE	Poly(A) binding protein cytoplasmic 5	PABPC5	Equus caballus (Horse)		cytoplasmic stress granule [GO:0010494]; cytosol [GO:0005829]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]	mRNA 3'-UTR binding [GO:0003730]; poly(A) binding [GO:0008143]; poly(U) RNA binding [GO:0008266]	AALYVGDLDPDVTEDMLYKK	0.77124	0.51205	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1957.9	1950.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YMV5	F6YMV5_HORSE	Potassium voltage-gated channel subfamily H member 2 (Ether-a-go-go-related gene potassium channel 1) (Voltage-gated potassium channel subunit Kv11.1)	KCNH2	Equus caballus (Horse)		membrane [GO:0016020]	voltage-gated potassium channel activity [GO:0005249]	MAAPAGK	0.98926	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	951.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	486.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YN70	F6YN70_HORSE	SOGA family member 3	MTCL3 SOGA3	Equus caballus (Horse)	regulation of autophagy [GO:0010506]	extracellular space [GO:0005615]; membrane [GO:0016020]		GGGGGAEK	0.97934	-0.48409	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1155.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	363.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YPT0	F6YPT0_HORSE	"2,4-dienoyl-CoA reductase 1"	DECR1	Equus caballus (Horse)	fatty acid beta-oxidation [GO:0006635]; positive regulation of cold-induced thermogenesis [GO:0120162]	catalytic complex [GO:1902494]; cytosol [GO:0005829]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]	"2,4-dienoyl-CoA reductase (NADPH) activity [GO:0008670]; identical protein binding [GO:0042802]; NADPH binding [GO:0070402]"	IYQNIEAFQSK	0.96727	-0.098228	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2241	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YPU8	F6YPU8_HORSE	"Large ribosomal subunit protein uL23m (39S ribosomal protein L23, mitochondrial)"	MRPL23	Equus caballus (Horse)	translation [GO:0006412]	ribosomal subunit [GO:0044391]	structural constituent of ribosome [GO:0003735]	AEGQVPAR	0.96308	7.67E-05	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	660.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YS25	F6YS25_HORSE	Carbonic anhydrase (EC 4.2.1.1)	CA2	Equus caballus (Horse)	angiotensin-activated signaling pathway [GO:0038166]; regulation of monoatomic anion transport [GO:0044070]	apical part of cell [GO:0045177]; cytoplasm [GO:0005737]; plasma membrane [GO:0005886]	arylesterase activity [GO:0004064]; carbonate dehydratase activity [GO:0004089]; zinc ion binding [GO:0008270]	AGDGATRGHTVQAPDSR	0.98765	-3.732	0	0	0	0	0	0	0	0	0	718.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	731.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YSE4	F6YSE4_HORSE	Exocyst complex component 8	EXOC8	Equus caballus (Horse)	exocytosis [GO:0006887]; Golgi to plasma membrane transport [GO:0006893]; protein localization [GO:0008104]; protein transport [GO:0015031]	exocyst [GO:0000145]; growth cone [GO:0030426]; perinuclear region of cytoplasm [GO:0048471]		AAAVHTAIRQLR	0.98659	-3.1684	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	453.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YSK7	F6YSK7_HORSE	Myristoylated alanine-rich C-kinase substrate	MARCKS	Equus caballus (Horse)		cytoplasm [GO:0005737]; membrane [GO:0016020]	actin binding [GO:0003779]; calmodulin binding [GO:0005516]	RARPPGAGGGAGRGGR	0.89739	0.33543	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1214.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YTQ9	F6YTQ9_HORSE	Wiskott-Aldrich syndrome protein family member (WASP family protein member)	WASF1	Equus caballus (Horse)	actin cytoskeleton organization [GO:0030036]; positive regulation of Arp2/3 complex-mediated actin nucleation [GO:2000601]	cytoskeleton [GO:0005856]; lamellipodium [GO:0030027]; SCAR complex [GO:0031209]	actin binding [GO:0003779]; Arp2/3 complex binding [GO:0071933]; protein kinase A regulatory subunit binding [GO:0034237]	PLVKRNIDPR	0.97184	-0.2018	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2310	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2860.8	0	0	0	0	0	0	0	0	0	0	0	1361.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YUE1	F6YUE1_HORSE	SPARC like 1	SPARCL1	Equus caballus (Horse)	signal transduction [GO:0007165]	collagen-containing extracellular matrix [GO:0062023]; extracellular space [GO:0005615]	calcium ion binding [GO:0005509]	LEGTKKGHQLQLDYFGACK	0.9326	0.26424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11025	11984	0	0	0	0	0	0	0	0	0	0	4734	0	0	0	0	0	0	0
F6YUQ5	F6YUQ5_HORSE	Sosondowah ankyrin repeat domain family member A	SOWAHA	Equus caballus (Horse)				LSVEESGLGLR	0.97149	0.042867	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1228.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YW58	F6YW58_HORSE	A-kinase anchoring protein 13	AKAP13	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]; metal ion binding [GO:0046872]	GEAPGNR	0.98509	-1.4639	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	524.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YWG9	F6YWG9_HORSE	Myosin XVB	MYO15B	Equus caballus (Horse)		cytoskeleton [GO:0005856]		TVKPPAK	0.95849	0.22133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3037	0	0	0	0	2672.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6YXL8	F6YXL8_HORSE	"Small ribosomal subunit protein mS31 (28S ribosomal protein S31, mitochondrial)"	MRPS31	Equus caballus (Horse)		mitochondrial small ribosomal subunit [GO:0005763]; nucleolus [GO:0005730]	protein domain specific binding [GO:0019904]; structural constituent of ribosome [GO:0003735]	APEDAPKK	0.98298	-0.70413	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2563.3	2443.9	0	0	0
F6YZL0	F6YZL0_HORSE	Interleukin 1 receptor associated kinase 1	IRAK1	Equus caballus (Horse)	canonical NF-kappaB signal transduction [GO:0007249]; interleukin-1-mediated signaling pathway [GO:0070498]; interleukin-33-mediated signaling pathway [GO:0038172]; lipopolysaccharide-mediated signaling pathway [GO:0031663]; macromolecule metabolic process [GO:0043170]; nitrogen compound metabolic process [GO:0006807]; phosphate-containing compound metabolic process [GO:0006796]; positive regulation of canonical NF-kappaB signal transduction [GO:0043123]; positive regulation of leukocyte adhesion to vascular endothelial cell [GO:1904996]; positive regulation of type I interferon production [GO:0032481]; primary metabolic process [GO:0044238]; regulation of cytokine-mediated signaling pathway [GO:0001959]; toll-like receptor 2 signaling pathway [GO:0034134]; type I interferon-mediated signaling pathway [GO:0060337]	cell surface [GO:0009986]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; protein-containing complex [GO:0032991]	ATP binding [GO:0005524]; protein heterodimerization activity [GO:0046982]; protein homodimerization activity [GO:0042803]; protein kinase binding [GO:0019901]; protein serine/threonine kinase activity [GO:0004674]	LLSTRPGR	0.88416	0.35032	0	0	1962.7	0	0	0	2027.4	2156.8	2348.1	0	0	0	0	0	0	0	0	0	1692.7	1916.7	0	0	1560	0	0	0	0	2226.4	2438.2	2279.9	0	0	3389.9	4903.7	0	4630.7	0	2262.8	0	1793	1610.2	0	0	1437.9	0	2159.6	0	0	2606	2681	2510.5	0	0	1825.8	0	0	0	1586.1	1644.1	1549.7	0	1662.5	0	0	0	0	0	1369.3	0	2692.7	2858.8	0	0	0	0
F6Z041	F6Z041_HORSE	Beta-2-glycoprotein 1 (Apolipoprotein H) (Beta-2-glycoprotein I)	APOH	Equus caballus (Horse)	"blood coagulation, intrinsic pathway [GO:0007597]; negative regulation of angiogenesis [GO:0016525]; negative regulation of blood coagulation [GO:0030195]; negative regulation of endothelial cell migration [GO:0010596]; negative regulation of endothelial cell proliferation [GO:0001937]; negative regulation of fibrinolysis [GO:0051918]; negative regulation of myeloid cell apoptotic process [GO:0033033]; negative regulation of smooth muscle cell apoptotic process [GO:0034392]; plasminogen activation [GO:0031639]; triglyceride metabolic process [GO:0006641]"	cell surface [GO:0009986]; chylomicron [GO:0042627]; high-density lipoprotein particle [GO:0034364]; very-low-density lipoprotein particle [GO:0034361]	heparin binding [GO:0008201]; identical protein binding [GO:0042802]; lipoprotein lipase activator activity [GO:0060230]; phospholipid binding [GO:0005543]	ATVIYQGERVK	0.35909	0.72873	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	904.86	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z1C6	F6Z1C6_HORSE	E3 ubiquitin-protein ligase (EC 2.3.2.27)	DTX3L	Equus caballus (Horse)	DNA damage checkpoint signaling [GO:0000077]; DNA repair-dependent chromatin remodeling [GO:0140861]; double-strand break repair [GO:0006302]; endosome to lysosome transport [GO:0008333]; Notch signaling pathway [GO:0007219]; positive regulation of defense response to virus by host [GO:0002230]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of protein localization to early endosome [GO:1902966]; positive regulation of protein localization to nucleus [GO:1900182]; positive regulation of receptor catabolic process [GO:2000646]; protein autoubiquitination [GO:0051865]; protein K48-linked ubiquitination [GO:0070936]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytosol [GO:0005829]; early endosome [GO:0005769]; lysosome [GO:0005764]; nucleoplasm [GO:0005654]; protein-containing complex [GO:0032991]	enzyme inhibitor activity [GO:0004857]; histone binding [GO:0042393]; histone H4K91 ubiquitin ligase activity [GO:0141000]; metal ion binding [GO:0046872]; protein ADP-ribosyltransferase-substrate adaptor activity [GO:0140768]; STAT family protein binding [GO:0097677]; ubiquitin-like protein ligase binding [GO:0044389]	GAPAAER	0.97929	-0.45705	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2459.4	0	0	0	0	0	0	0	0	492.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z1R3	F6Z1R3_HORSE	Calsequestrin	CASQ2	Equus caballus (Horse)		sarcoplasmic reticulum lumen [GO:0033018]	calcium ion binding [GO:0005509]	GVAKKLSLK	0.96671	-0.16517	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	832.32	0	0	0	0	0	0	0	0	912.81	1288.3	0	0	0	0	0	0	1396.4	1108	0	0	0	0	0	0	0	0	0	0	761.77	835.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z1Z2	F6Z1Z2_HORSE	G-protein coupled receptors family 1 profile domain-containing protein		Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	VFSFSKP	0.96905	-0.036948	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1757.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z246	F6Z246_HORSE	RBR-type E3 ubiquitin transferase (EC 2.3.2.31)	RNF144A	Equus caballus (Horse)	protein ubiquitination [GO:0016567]	membrane [GO:0016020]	ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]	MSELILNCSAMTTAR	0.67278	0.61145	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1704.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z2F6	F6Z2F6_HORSE	RAD52 motif-containing protein 1	RDM1	Equus caballus (Horse)	DNA repair [GO:0006281]	cytoplasm [GO:0005737]; nucleolus [GO:0005730]	RNA binding [GO:0003723]	ILEDHYHSL	0.96809	0.022328	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	624.57	0	0	0	538.96	947.32	846.75	0	0	0	1238	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	670.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z3J4	F6Z3J4_HORSE	Protein tyrosine phosphatase non-receptor type 23	PTPN23	Equus caballus (Horse)	cilium assembly [GO:0060271]; dephosphorylation [GO:0016311]; early endosome to late endosome transport [GO:0045022]; endocytic recycling [GO:0032456]; negative regulation of epithelial cell migration [GO:0010633]; positive regulation of adherens junction organization [GO:1903393]; positive regulation of early endosome to late endosome transport [GO:2000643]; positive regulation of homophilic cell adhesion [GO:1903387]; positive regulation of Wnt protein secretion [GO:0061357]; protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway [GO:0043328]	ciliary basal body [GO:0036064]; cytosol [GO:0005829]; early endosome [GO:0005769]; endosome [GO:0005768]; nuclear body [GO:0016604]	protein kinase binding [GO:0019901]; protein tyrosine phosphatase activity [GO:0004725]	NAVRVPR	0.98704	-1.1922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3591.4	3063.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z4A7	F6Z4A7_HORSE	Ig-like domain-containing protein		Equus caballus (Horse)				AGSNTVH	0.98816	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	514.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z4G1	F6Z4G1_HORSE	Potassium channel subfamily K member	KCNK9	Equus caballus (Horse)	potassium ion import across plasma membrane [GO:1990573]; potassium ion transmembrane transport [GO:0071805]; stabilization of membrane potential [GO:0030322]	plasma membrane [GO:0005886]	outward rectifier potassium channel activity [GO:0015271]; potassium ion leak channel activity [GO:0022841]	MKRQNVR	0.97232	-0.063635	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	576.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z4N9	F6Z4N9_HORSE	Eukaryotic translation initiation factor 3 subunit C (eIF3c) (Eukaryotic translation initiation factor 3 subunit 8) (eIF3 p110)	EIF3C EIF3S8 LOC100064310	Equus caballus (Horse)	formation of cytoplasmic translation initiation complex [GO:0001732]; translational initiation [GO:0006413]	"eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; eukaryotic translation initiation factor 3 complex, eIF3m [GO:0071541]"	RNA binding [GO:0003723]; translation initiation factor activity [GO:0003743]; translation initiation factor binding [GO:0031369]	GTEITHAVVIKK	0.98592	-0.86157	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1053.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z5B0	F6Z5B0_HORSE	RNA helicase (EC 3.6.4.13)	TDRD12	Equus caballus (Horse)	cell differentiation [GO:0030154]; meiotic cell cycle [GO:0051321]; regulatory ncRNA-mediated gene silencing [GO:0031047]; spermatogenesis [GO:0007283]		ATP binding [GO:0005524]; nucleic acid binding [GO:0003676]	LLPAQDPK	0.99026	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	952.09	0	0	0	0	0	0	0	0	0	0	0	0
F6Z5F4	F6Z5F4_HORSE	Zinc finger protein 556	ZNF556	Equus caballus (Horse)	negative regulation of transcription by RNA polymerase II [GO:0000122]		"DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; metal ion binding [GO:0046872]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	CGKDFSCPK	0.98596	-2.0206	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	748.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z6E9	F6Z6E9_HORSE	Chromosome 2 C4orf45 homolog	SPMIP2 C2H4orf45	Equus caballus (Horse)				AALPRASRPPK	0.9845	-1.2871	0	829.19	783.23	1148.5	1181.9	1281	1163.6	1356.7	1305.1	0	2760.1	0	0	841.6	905.24	0	0	0	0	0	1451.7	1813.9	1720.1	0	1266.2	1186.5	0	0	0	1215.5	0	0	3232.7	0	0	3018.3	0	0	0	0	1345	0	974.48	1071.9	1039.6	0	1492	0	0	849.16	935.17	0	0	1628.5	0	0	0	0	393.41	0	1145.9	0	1210.5	642.55	0	0	0	1224.6	0	0	984.47	0	1786.5	1684.5	0
F6Z7V4	F6Z7V4_HORSE	WD repeat domain 38	WDR38	Equus caballus (Horse)	hematopoietic progenitor cell differentiation [GO:0002244]			VTTTGHPMIPVVR	0.36493	0.74157	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	621.19	576.48	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6Z801	F6Z801_HORSE	Uncharacterized protein		Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	DMKRFIVETNGMNVTNVVK	0.32044	0.81394	0	27744	17770	0	0	0	0	0	0	0	14975	0	16219	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44307	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6934.5	0	0	0	0	33239	0	31756	0	0	32132	25303	30045	0	0	0	26280	0	25879	0	0	0	0	0	19287	16909
F6Z9T2	F6Z9T2_HORSE	PNMA family member 8A	PNMA8A	Equus caballus (Horse)				EPGQAAEVSSALK	0.92993	0.27546	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	593	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZA72	F6ZA72_HORSE	Olfactory receptor	OR6C318	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	QAFSDTIER	0.9723	-0.063558	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	375.08	0	0	0	0	0	0	0	0	0	0
F6ZAV9	F6ZAV9_HORSE	Large tumor suppressor kinase 2	LATS2	Equus caballus (Horse)	phosphorylation [GO:0016310]		ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	GIAPTAVPR	0.96791	-0.097152	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1064.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZB28	F6ZB28_HORSE	PBX homeobox interacting protein 1	PBXIP1	Equus caballus (Horse)		membrane [GO:0016020]		GLEEENARLR	0.95725	0.22356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1630.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZB88	F6ZB88_HORSE	alpha-mannosidase (EC 3.2.1.24)	MAN2C1	Equus caballus (Horse)	mannose metabolic process [GO:0006013]		alpha-mannosidase activity [GO:0004559]; carbohydrate binding [GO:0030246]; metal ion binding [GO:0046872]	MAAAPALKHWR	0.98528	-1.2814	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	397.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZBS0	F6ZBS0_HORSE	ADAM metallopeptidase domain 18	LOC100056890	Equus caballus (Horse)	proteolysis [GO:0006508]	membrane [GO:0016020]	metalloendopeptidase activity [GO:0004222]	IYTFHLK	0.98761	-1.1979	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	828.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZCR0	F6ZCR0_HORSE	Laminin subunit alpha 3	LAMA3	Equus caballus (Horse)	cell adhesion [GO:0007155]; regulation of cell adhesion [GO:0030155]; regulation of cell migration [GO:0030334]; regulation of embryonic development [GO:0045995]	basement membrane [GO:0005604]; extracellular region [GO:0005576]; membrane [GO:0016020]	signaling receptor binding [GO:0005102]	EANMAVTR	0.6446	0.64737	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	441.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZDJ8	F6ZDJ8_HORSE	NGFI-A binding protein 2	NAB2	Equus caballus (Horse)	endochondral ossification [GO:0001958]; myelination [GO:0042552]; negative regulation of transcription by RNA polymerase III [GO:0016480]; regulation of DNA-templated transcription [GO:0006355]; regulation of epidermis development [GO:0045682]; Schwann cell differentiation [GO:0014037]	nucleus [GO:0005634]	identical protein binding [GO:0042802]; transcription coregulator activity [GO:0003712]	AGGSNSRNQAR	0.98401	-0.88629	0	0	0	0	0	0	0	0	0	0	0	854.49	0	0	1410	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZE24	F6ZE24_HORSE	PCF11 cleavage and polyadenylation factor subunit	PCF11	Equus caballus (Horse)	mRNA polyadenylation [GO:0006378]; termination of RNA polymerase II transcription [GO:0006369]		mRNA binding [GO:0003729]; RNA polymerase II complex binding [GO:0000993]	DVSRKVTHR	0.9782	-0.40657	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	376.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZEN5	F6ZEN5_HORSE	Olfactory receptor	OR4K15	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	SSASMAK	0.95333	0.23586	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	846.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZG50	F6ZG50_HORSE	Extracellular matrix protein X-linked	ECMX	Equus caballus (Horse)	extracellular matrix organization [GO:0030198]; positive regulation of cell-substrate adhesion [GO:0010811]	extracellular matrix [GO:0031012]	collagen V binding [GO:0070052]; heparin binding [GO:0008201]	AWIDLPLGEAGR	0.88514	0.42294	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	554.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZGA2	F6ZGA2_HORSE	"Neural cell expressed, developmentally down-regulated 9"	NEDD9	Equus caballus (Horse)		cytoplasm [GO:0005737]		GVYAIPPSACR	0.9637	-0.13779	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	929.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZHG4	F6ZHG4_HORSE	Coiled-coil domain containing 170	LOC100062118	Equus caballus (Horse)				AEAMKRK	0.96471	-0.084458	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1521.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	892.21
F6ZI00	F6ZI00_HORSE	Lipoxygenase homology PLAT domains 1	LOXHD1	Equus caballus (Horse)	sensory perception of sound [GO:0007605]	stereocilium [GO:0032420]		EDNELVVELVPAGR	0.97992	-0.48598	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1476.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZIB4	F6ZIB4_HORSE	Armadillo repeat containing 5	ARMC5	Equus caballus (Horse)	"adrenal cortex development [GO:0035801]; anatomical structure morphogenesis [GO:0009653]; CD4-positive, alpha-beta T cell differentiation [GO:0043367]; defense response to virus [GO:0051607]; in utero embryonic development [GO:0001701]; mesoderm formation [GO:0001707]; regulation of steroid biosynthetic process [GO:0050810]; T cell proliferation [GO:0042098]"	cytosol [GO:0005829]; focal adhesion [GO:0005925]; membrane [GO:0016020]; nucleoplasm [GO:0005654]		AEAGSFR	0.99012	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	630.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZJL7	F6ZJL7_HORSE	Oxidation resistance 1	OXR1	Equus caballus (Horse)				IDALNAEELR	0.9625	-0.14245	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	640.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZJX0	F6ZJX0_HORSE	Structural maintenance of chromosomes protein	SMC4	Equus caballus (Horse)	cell cycle [GO:0007049]; chromosome organization [GO:0051276]	chromosome [GO:0005694]; nucleus [GO:0005634]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]	LLEENVSAFK	0.41296	0.68102	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	835.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8897.7	547.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZKA1	F6ZKA1_HORSE	Coiled-coil domain containing 180	LOC100066059	Equus caballus (Horse)				AGKLKSVLK	0.76535	0.51376	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	743.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	702.58	0	0	0	0	3012.9	0	0	0	0	0	0	2529.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZKC8	F6ZKC8_HORSE	"Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Cytochrome c oxidase polypeptide IV) (Cytochrome c oxidase subunit IV isoform 1)"	COX4I1	Equus caballus (Horse)	"mitochondrial electron transport, cytochrome c to oxygen [GO:0006123]"	mitochondrial respiratory chain complex IV [GO:0005751]		LGPSDAR	0.98829	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	420.66	0	0	465.52	0	579.89	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZKY6	F6ZKY6_HORSE	MORN repeat containing 1	MORN1	Equus caballus (Horse)				RVPPGRPPR	0.98333	-0.80966	0	0	1849.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1285.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZLE2	F6ZLE2_HORSE	WAP four-disulfide core domain protein 5	WFDC5	Equus caballus (Horse)	antibacterial humoral response [GO:0019731]; innate immune response [GO:0045087]	extracellular space [GO:0005615]	serine-type endopeptidase inhibitor activity [GO:0004867]	QGSCPKDPLR	0.98764	-1.273	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	615.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZLY8	F6ZLY8_HORSE	Neuronal guanine nucleotide exchange factor	NGEF	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]	EAGSPAT	0.96292	0.21733	0	0	0	0	0	0	675.23	845.31	709.48	0	528.27	0	0	694.05	656.25	1534.1	1526.5	1511.5	0	690.11	669.42	0	0	0	0	0	0	672.35	0	0	706.76	853.82	704.49	1388.5	0	0	0	833.79	756.34	1400.6	1029.5	1339.3	562.13	499.05	416.57	1687.1	1207.6	1406.4	1120.4	973.91	1140.7	0	892.95	751.39	0	0	0	1270	1234.4	0	0	849.2	946.65	0	0	0	1150.9	1112.1	1239.9	0	0	605.21	0	0	0
F6ZMK0	F6ZMK0_HORSE	PHD finger protein 6	PHF6	Equus caballus (Horse)	blastocyst hatching [GO:0001835]; negative regulation of transcription by RNA polymerase II [GO:0000122]	nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	histone binding [GO:0042393]; histone deacetylase binding [GO:0042826]; metal ion binding [GO:0046872]; phosphoprotein binding [GO:0051219]; ribonucleoprotein complex binding [GO:0043021]; scaffold protein binding [GO:0097110]; tubulin binding [GO:0015631]	LGSLSAQVPIFKKK	0.90472	0.32103	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2702.1	0	0	0	0	0	0	0	0	0	0	0	0	0	404.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZNV9	F6ZNV9_HORSE	Angiomotin like 2	AMOTL2	Equus caballus (Horse)	actin cytoskeleton organization [GO:0030036]; angiogenesis [GO:0001525]; establishment of cell polarity involved in ameboidal cell migration [GO:0003365]; hippo signaling [GO:0035329]; regulation of cell migration [GO:0030334]	bicellular tight junction [GO:0005923]; cytoplasmic vesicle [GO:0031410]; plasma membrane [GO:0005886]		GAPGGNR	0.98822	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	240.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	463.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	366.79	0	0	0
F6ZPA5	F6ZPA5_HORSE	Forkhead box protein N3	FOXN3	Equus caballus (Horse)	cell cycle [GO:0007049]; regulation of DNA-templated transcription [GO:0006355]	nucleus [GO:0005634]	cis-regulatory region sequence-specific DNA binding [GO:0000987]; DNA-binding transcription factor activity [GO:0003700]	QNLIQALK	0.96919	0.16557	0	0	614.42	0	0	0	0	0	0	0	3202.4	0	0	0	0	0	0	0	0	0	0	585.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	651.92	0	0	0	0	0	3599.5	1429.6	0	0	2352.2	2453.8	0	0	0	2813.5	0	1034.7	0
F6ZQR6	F6ZQR6_HORSE	Transmembrane protein 234	TMEM234	Equus caballus (Horse)		membrane [GO:0016020]		KLWGGFR	0.98394	-0.7065	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2776.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZQS4	F6ZQS4_HORSE	Cingulin like 1	CGNL1	Equus caballus (Horse)	actin filament organization [GO:0007015]; negative regulation of small GTPase mediated signal transduction [GO:0051058]; negative regulation of stress fiber assembly [GO:0051497]; protein localization to cell-cell junction [GO:0150105]	myosin complex [GO:0016459]		INPEDRKR	0.98313	-0.8949	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4301.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	498.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZT08	F6ZT08_HORSE	Zinc finger protein 672	ZNF672	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	SLSQHQR	0.96691	-0.039319	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2128.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZT38	F6ZT38_HORSE	C-Maf inducing protein	CMIP	Equus caballus (Horse)				FAEDPRQEVHSCLLSVRAGK	0.92852	0.25722	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1227.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZU48	F6ZU48_HORSE	Rac GTPase activating protein 1	RACGAP1	Equus caballus (Horse)	mitotic cytokinesis [GO:0000281]; mitotic spindle midzone assembly [GO:0051256]; Rho protein signal transduction [GO:0007266]	centralspindlin complex [GO:0097149]; cleavage furrow [GO:0032154]; midbody [GO:0030496]; nucleus [GO:0005634]; spindle midzone [GO:0051233]	GTPase activator activity [GO:0005096]; metal ion binding [GO:0046872]	LHDFVSK	0.9603	-0.014537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2038.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZVS3	F6ZVS3_HORSE	tRNA (adenine(58)-N(1))-methyltransferase (EC 2.1.1.220)	TRMT61B	Equus caballus (Horse)	mitochondrial tRNA methylation [GO:0070901]	mitochondrion [GO:0005739]; tRNA (m1A) methyltransferase complex [GO:0031515]	tRNA (adenine-N1)-methyltransferase activity [GO:0016429]	KNYKHWR	0.94913	0.23737	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	527.3	0	0	0	469.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZWJ4	F6ZWJ4_HORSE	methylated diphthine methylhydrolase (EC 3.1.1.97)	DPH7	Equus caballus (Horse)	protein histidyl modification to diphthamide [GO:0017183]	cytoplasm [GO:0005737]	diphthine methylesterase activity [GO:0061685]	ANDQPLKIISSDSRGK	0.88763	0.36589	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2355.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZWP4	F6ZWP4_HORSE	Natriuretic peptides B (Brain natriuretic factor prohormone) (Gamma-brain natriuretic peptide) (Iso-ANP)	NPPB	Equus caballus (Horse)	blood vessel diameter maintenance [GO:0097746]; cGMP biosynthetic process [GO:0006182]; cGMP-mediated signaling [GO:0019934]; negative regulation of systemic arterial blood pressure [GO:0003085]; neuropeptide signaling pathway [GO:0007218]; receptor guanylyl cyclase signaling pathway [GO:0007168]	cytoplasm [GO:0005737]; extracellular space [GO:0005615]	hormone activity [GO:0005179]; hormone receptor binding [GO:0051427]	DLQMALPR	0.96689	0.01326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2359.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1031.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZWS0	F6ZWS0_HORSE	phosphoenolpyruvate carboxykinase (GTP) (EC 4.1.1.32)	PCK2	Equus caballus (Horse)	gluconeogenesis [GO:0006094]		GTP binding [GO:0005525]; metal ion binding [GO:0046872]; phosphoenolpyruvate carboxykinase (GTP) activity [GO:0004613]	YLEHWLSMEGR	0.96522	-0.12041	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	627.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZY01	F6ZY01_HORSE	Formin like 2	FMNL2	Equus caballus (Horse)	actin cytoskeleton organization [GO:0030036]; regulation of cell morphogenesis [GO:0022604]		actin binding [GO:0003779]; small GTPase binding [GO:0031267]	LQDDAKIAQDAFDDVVKYFGENPK	0.91223	0.30925	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	560.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZZC5	F6ZZC5_HORSE	Guanylate cyclase (EC 4.6.1.2)	GUCY2F	Equus caballus (Horse)	cGMP biosynthetic process [GO:0006182]; detection of light stimulus involved in visual perception [GO:0050908]; intracellular signal transduction [GO:0035556]; receptor guanylyl cyclase signaling pathway [GO:0007168]	plasma membrane [GO:0005886]; rod photoreceptor outer segment [GO:0120200]	adenylate cyclase activity [GO:0004016]; ATP binding [GO:0005524]; guanylate cyclase activity [GO:0004383]; peptide receptor activity [GO:0001653]; protein kinase activity [GO:0004672]	EFTHGRLK	0.98333	-0.73546	0	0	0	0	0	0	855.54	0	0	336.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	889.4	880.93	0
F6ZZD4	F6ZZD4_HORSE	DS cell adhesion molecule	DSCAM	Equus caballus (Horse)	axon guidance [GO:0007411]; dendrite morphogenesis [GO:0048813]; dendrite self-avoidance [GO:0070593]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; locomotory behavior [GO:0007626]; negative regulation of cell adhesion [GO:0007162]; positive regulation of axon extension involved in axon guidance [GO:0048842]; positive regulation of phosphorylation [GO:0042327]; post-embryonic retina morphogenesis in camera-type eye [GO:0060060]	axon [GO:0030424]; dendrite [GO:0030425]; growth cone [GO:0030426]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886]	cell-cell adhesion mediator activity [GO:0098632]; netrin receptor binding [GO:1990890]; protein tyrosine kinase binding [GO:1990782]	DIALPCK	0.98266	-0.71496	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	499.69	0	0	0	0	0	0	0	0	0	0	0	0	543.25	0	0	0	0	0	0	0	0	0	0	0	0	629.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F6ZZQ3	F6ZZQ3_HORSE	Tubulin epsilon and delta complex 2	TEDC2	Equus caballus (Horse)				AASQNSR	0.98456	-0.78742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	857.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	332.29	0	0	0	0	0	407.32	995.8	462.06	569.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7A3K4	F7A3K4_HORSE	Calcium uniporter protein	MCU	Equus caballus (Horse)	mitochondrial calcium ion homeostasis [GO:0051560]	mitochondrial inner membrane [GO:0005743]	calcium channel activity [GO:0005262]; uniporter activity [GO:0015292]	CLYSKVHQR	0.98772	-1.8777	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1802.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7A6A7	F7A6A7_HORSE	Sodium channel protein	SCN10A	Equus caballus (Horse)	AV node cell action potential [GO:0086016]; bundle of His cell action potential [GO:0086043]; membrane depolarization during action potential [GO:0086010]; neuronal action potential [GO:0019228]; regulation of atrial cardiac muscle cell membrane depolarization [GO:0060371]; regulation of cardiac muscle contraction [GO:0055117]; regulation of heart rate [GO:0002027]; regulation of monoatomic ion transmembrane transport [GO:0034765]; sodium ion transmembrane transport [GO:0035725]	axon [GO:0030424]; voltage-gated sodium channel complex [GO:0001518]	transmembrane transporter binding [GO:0044325]; voltage-gated sodium channel activity involved in cardiac muscle cell action potential [GO:0086006]	EATAPGP	0.99014	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	523.38	607.84	0	0	0	0	0	0	0	0	0	0	0	0	322.96	0	0	0	0	0	0	0	0	0	0	0	470.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	355.93	0	302.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7A8H8	F7A8H8_HORSE	Ras-related GTP-binding protein	RRAGB	Equus caballus (Horse)	cellular response to amino acid stimulus [GO:0071230]; positive regulation of TOR signaling [GO:0032008]	lysosome [GO:0005764]	GTP binding [GO:0005525]	KMEKENLGPK	0.9639	-0.13689	0	0	0	0	0	0	0	0	0	0	0	0	0	570.88	646.75	643.01	887.62	0	0	495.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	656.61	0	796.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7A8K8	F7A8K8_HORSE	Muscle-restricted coiled-coil protein	CAVIN4	Equus caballus (Horse)	positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of gene expression [GO:0010468]	caveola [GO:0005901]; cytoplasm [GO:0005737]; sarcoplasm [GO:0016528]; Z disc [GO:0030018]		TVAEGTEEVR	0.96457	0.0030224	0	0	0	0	0	0	0	0	0	0	0	0	0	455.78	0	3099.3	0	0	0	0	0	0	0	0	0	0	0	1113.1	0	1171.2	0	0	0	1649.6	0	0	0	0	0	1898.8	1761.9	0	0	0	0	1423.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7A8X3	F7A8X3_HORSE	oxoglutarate dehydrogenase (succinyl-transferring) (EC 1.2.4.2)	OGDHL	Equus caballus (Horse)	tricarboxylic acid cycle [GO:0006099]		oxoglutarate dehydrogenase (succinyl-transferring) activity [GO:0004591]; thiamine pyrophosphate binding [GO:0030976]	APEQVQR	0.9859	-2.9825	0	0	0	0	0	0	0	0	763.37	0	336.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	358.01	351.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2435.6	806.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7A8Z1	F7A8Z1_HORSE	Jupiter microtubule associated homolog 1	JPT1 NT5C	Equus caballus (Horse)	pyrimidine deoxyribonucleotide catabolic process [GO:0009223]		5'-nucleotidase activity [GO:0008253]	ILALKLCSGHR	0.98668	-1.9207	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	678.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7A9J2	F7A9J2_HORSE	"Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-)"	FUT11	Equus caballus (Horse)	fucosylation [GO:0036065]; protein glycosylation [GO:0006486]	Golgi cisterna membrane [GO:0032580]; Golgi membrane [GO:0000139]	alpha-(1->3)-fucosyltransferase activity [GO:0046920]	YVRELMRYIR	0.9732	-0.19626	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1035.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7A9S2	F7A9S2_HORSE	AarF domain containing kinase 5	ADCK5	Equus caballus (Horse)				AIILRDDAAMK	0.98765	-1.9006	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	497.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AAN5	F7AAN5_HORSE	Iodothyronine deiodinase	DIO3	Equus caballus (Horse)	hormone biosynthetic process [GO:0042446]; positive regulation of multicellular organism growth [GO:0040018]; retinal cone cell apoptotic process [GO:0097474]; retinal cone cell development [GO:0046549]; thyroid hormone catabolic process [GO:0042404]; thyroid hormone metabolic process [GO:0042403]	intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]	thyroxine 5'-deiodinase activity [GO:0004800]; thyroxine 5-deiodinase activity [GO:0033798]	LCTLASLK	0.97345	0.14417	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2150	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AB11	F7AB11_HORSE	Maestro heat like repeat family member 7	MROH7	Equus caballus (Horse)		cytoplasm [GO:0005737]		GGSEEAR	0.95402	0.23586	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	658.63	668.66	542.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	394.56	0	0	0	0	0	0	0	525.78	0	563.44	599.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	696.86	558.35	603.05	0	0	0	0	0	0
F7ABB5	F7ABB5_HORSE	Anaphase-promoting complex subunit 2	ANAPC2	Equus caballus (Horse)	cell cycle [GO:0007049]; cell division [GO:0051301]	voltage-gated potassium channel complex [GO:0008076]	potassium channel activator activity [GO:0099104]; transmembrane transporter binding [GO:0044325]; voltage-gated potassium channel activity [GO:0005249]	SGQGPGGG	0.97406	0.20648	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	183.48	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	290.63	278.56	0	0
F7AC13	F7AC13_HORSE	YY1 transcription factor	YY1	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	PcG protein complex [GO:0031519]; transcription regulator complex [GO:0005667]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	GGGEARR	0.92969	0.27029	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	654.12	644.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	540.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7ACI3	F7ACI3_HORSE	ADAM metallopeptidase with thrombospondin type 1 motif 5	ADAMTS5	Equus caballus (Horse)	extracellular matrix organization [GO:0030198]; proteolysis [GO:0006508]	collagen-containing extracellular matrix [GO:0062023]; extracellular region [GO:0005576]	metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	VVGTFNKK	0.98271	-0.67466	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1054.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	352.95	0	0	0	0	0	0	0	0	0	0
F7ADM2	F7ADM2_HORSE	Uncharacterized protein		Equus caballus (Horse)	endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; Golgi organization [GO:0007030]	Golgi apparatus [GO:0005794]	small GTPase binding [GO:0031267]	LERAQAPSR	0.98473	-2.1623	30381	11718	11210	15599	14577	15246	21966	28342	29057	20555	15410	12610	22424	22192	23655	0	109120	0	17991	26892	751.93	0	0	0	10963	10768	0	99966	0	132180	76532	0	2184.3	136890	143020	130820	11362	43863	34703	114120	0	117460	15985	15260	0	0	1834.2	118980	0	22219	22629	4412.6	16614	1729.3	10217	0	10954	0	0	98046	16251	0	18423	0	0	8449.9	18959	18307	16990	574.37	20478	18669	15182	11412	0
F7AEJ6	F7AEJ6_HORSE	Transforming acidic coiled-coil containing protein 3	TACC3	Equus caballus (Horse)	cell population proliferation [GO:0008283]; cerebral cortex development [GO:0021987]; microtubule cytoskeleton organization [GO:0000226]; mitotic spindle organization [GO:0007052]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]		TVEQKTK	0.9883	-1.7888	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1202.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AEU3	F7AEU3_HORSE	Delta(14)-sterol reductase LBR (EC 1.3.1.70) (3-beta-hydroxysterol Delta (14)-reductase) (C-14 sterol reductase) (Integral nuclear envelope inner membrane protein) (Lamin-B receptor) (Sterol C14-reductase)	LBR	Equus caballus (Horse)	cholesterol biosynthetic process [GO:0006695]	endoplasmic reticulum membrane [GO:0005789]; nuclear inner membrane [GO:0005637]	delta14-sterol reductase activity [GO:0050613]; DNA binding [GO:0003677]	KNPTDPKLAHLK	0.9736	-0.20358	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	526.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AFX3	F7AFX3_HORSE	protein-tyrosine-phosphatase (EC 3.1.3.48)	PTPRQ	Equus caballus (Horse)	dephosphorylation [GO:0016311]; detection of mechanical stimulus involved in sensory perception of sound [GO:0050910]; hematopoietic progenitor cell differentiation [GO:0002244]; neuromuscular process controlling balance [GO:0050885]; vestibular receptor cell morphogenesis [GO:0060116]	membrane [GO:0016020]; receptor complex [GO:0043235]; stereocilium bundle [GO:0032421]	protein tyrosine phosphatase activity [GO:0004725]	DLKIFTR	0.9868	-1.3973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1807.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	690.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AH57	F7AH57_HORSE	Zinc finger protein 709-like	LOC100146395	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	YLHRHER	0.98869	-1.6947	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	337.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AHF3	F7AHF3_HORSE	Actin beta like 2	ACTBL2	Equus caballus (Horse)	axonogenesis [GO:0007409]; cell motility [GO:0048870]	actin filament [GO:0005884]; axon [GO:0030424]; cytoplasm [GO:0005737]; glutamatergic synapse [GO:0098978]; membrane [GO:0016020]; NuA4 histone acetyltransferase complex [GO:0035267]	protein kinase binding [GO:0019901]; structural constituent of postsynaptic actin cytoskeleton [GO:0098973]	IIAPPER	0.39207	0.71198	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4711.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AHZ1	F7AHZ1_HORSE	Phosphoinositide-3-kinase regulatory subunit 6	PIK3R6	Equus caballus (Horse)		"phosphatidylinositol 3-kinase complex, class IB [GO:0005944]"	1-phosphatidylinositol-3-kinase regulator activity [GO:0046935]	DSRRTFR	0.87354	0.40599	0	0	0	0	0	0	0	0	0	605.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	673.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AI06	F7AI06_HORSE	cAMP-dependent protein kinase catalytic subunit alpha (EC 2.7.11.11)	PRKACA	Equus caballus (Horse)	phosphorylation [GO:0016310]		AMP-activated protein kinase activity [GO:0004679]; ATP binding [GO:0005524]; cAMP-dependent protein kinase activity [GO:0004691]	GNAAAAK	0.95707	0.22598	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	766.69	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AI37	F7AI37_HORSE	Zinc finger and BTB domain containing 26	ZBTB26	Equus caballus (Horse)	negative regulation of transcription by RNA polymerase II [GO:0000122]; regulation of cytokine production [GO:0001817]; regulation of immune system process [GO:0002682]	nucleoplasm [GO:0005654]	"DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	NDSTCVN	0.96765	-0.048461	0	0	0	0	0	0	0	0	0	0	0	0	0	1376	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AJY6	F7AJY6_HORSE	Tetraspanin	CD37	Equus caballus (Horse)		membrane [GO:0016020]		NLDHVYDRLAR	0.98229	-0.64891	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	821.14	0	0	0	2013.2	0	869.81	0	0	671.69	637.64	1204.8	859.24	0	0	0	0	1078.6	709.58	0	0	0	0	0	0	752.38	0	0	0	0	0	899.39	0	0	0	0	0	0	654.5	0	538.23	498.04	796.73	642.01	0	0	0
F7AK52	F7AK52_HORSE	Low-density lipoprotein receptor-related protein	LRP5	Equus caballus (Horse)	canonical Wnt signaling pathway [GO:0060070]; endocytosis [GO:0006897]	plasma membrane [GO:0005886]	Wnt receptor activity [GO:0042813]; Wnt-protein binding [GO:0017147]	AGAGISRLWFRCGR	0.88671	0.3656	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	555.66	0	0	0	0	0	0	0	0	0	0	0	0
F7AKX1	F7AKX1_HORSE	Calcium-transporting ATPase (EC 7.2.2.10)	ATP2A1	Equus caballus (Horse)		sarcoplasmic reticulum membrane [GO:0033017]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; P-type calcium transporter activity [GO:0005388]	GAPEGVLDR	0.87912	0.39524	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	698.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AL87	F7AL87_HORSE	USO1 vesicle transport factor	USO1	Equus caballus (Horse)	endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; Golgi vesicle docking [GO:0048211]; intracellular protein transport [GO:0006886]; membrane fusion [GO:0061025]; transcytosis [GO:0045056]; vesicle fusion with Golgi apparatus [GO:0048280]	endoplasmic reticulum [GO:0005783]; ER to Golgi transport vesicle membrane [GO:0012507]; Golgi membrane [GO:0000139]; Golgi stack [GO:0005795]		SLSKKYR	0.97015	-0.061432	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	499.36	0	0	0	1144.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	940.53	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AM30	F7AM30_HORSE	SLX4 interacting protein	SLX4IP	Equus caballus (Horse)				IPLISVGSLR	0.97962	-0.43858	0	0	0	0	0	0	0	366.37	0	0	0	0	0	0	0	739.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1130.3	0	0	0	0	0	0	0	0	0	489.52	0	0	0	0	0	0	0	0	440.01	0	0	0
F7AMG5	F7AMG5_HORSE	"Kaptin, actin binding protein"	KPTN	Equus caballus (Horse)	actin filament organization [GO:0007015]; cellular response to amino acid starvation [GO:0034198]; negative regulation of TORC1 signaling [GO:1904262]	actin cytoskeleton [GO:0015629]; KICSTOR complex [GO:0140007]; lamellipodium [GO:0030027]	actin filament binding [GO:0051015]	LRHQVEQRR	0.97281	-0.18496	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	613.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7ANI7	F7ANI7_HORSE	"La ribonucleoprotein 6, translational regulator"	LARP6	Equus caballus (Horse)	RNA processing [GO:0006396]	nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]	RNA binding [GO:0003723]	RNKLGYVSVK	0.97194	-0.20657	0	0	0	0	0	0	0	0	0	0	0	0	811.56	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7APA1	F7APA1_HORSE	Serine/arginine repetitive matrix 2	SRRM2	Equus caballus (Horse)		nucleus [GO:0005634]	mRNA binding [GO:0003729]	TARRSSR	0.96682	-0.09923	0	0	0	0	0	0	0	763.69	0	0	1302.7	0	605.92	0	0	0	0	1132.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	959.66	0	0	0	0	0	0	0	0	0	0	815.01	905.44	0	759.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1025	0	0	0
F7ARD2	F7ARD2_HORSE	ZFP28 zinc finger protein	ZFP28	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	KTFTQSSSLTVHQR	0.88084	0.45313	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1031.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7ART4	F7ART4_HORSE	DNA polymerase delta interacting protein 3	POLDIP3	Equus caballus (Horse)	poly(A)+ mRNA export from nucleus [GO:0016973]	nuclear speck [GO:0016607]; nucleus [GO:0005634]	mRNA binding [GO:0003729]	VQDAREMLNSR	0.98745	-1.8235	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	645.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7ARX0	F7ARX0_HORSE	Tubby-like protein	TULP3	Equus caballus (Horse)		extracellular region [GO:0005576]		AAGANGR	0.98772	-1.5556	0	0	0	0	0	0	0	0	0	0	0	0	307.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	318.63	0	0	0	0	0	0	0	0	0	0	0	0	931.77	0
F7ASK0	F7ASK0_HORSE	Nucleolar protein interacting with the FHA domain of MKI67	NIFK	Equus caballus (Horse)	"maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463]"	condensed nuclear chromosome [GO:0000794]; cytoplasm [GO:0005737]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	RNA binding [GO:0003723]	AARSWRK	0.95487	0.22755	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	429.02	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7ATA7	F7ATA7_HORSE	Methyltransferase like 7B	TMT1B METTL7B	Equus caballus (Horse)			methyltransferase activity [GO:0008168]; thiol S-methyltransferase activity [GO:0018708]	DALVQLLR	0.9735	0.14178	0	0	614.42	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1286.6	0	0	0	0	0	0	0	0	0
F7ATF1	F7ATF1_HORSE	"Suppressor of glucose, autophagy associated 1"	MTCL2 SOGA1	Equus caballus (Horse)	cell division [GO:0051301]; chromosome segregation [GO:0007059]; insulin receptor signaling pathway [GO:0008286]; regulation of autophagy [GO:0010506]	extracellular space [GO:0005615]; MIS12/MIND type complex [GO:0000444]		AGPGHAR	0.98497	-2.1159	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	258.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1421.2	0
F7ATI0	F7ATI0_HORSE	Desmocollin 1	DSC1	Equus caballus (Horse)	cell-cell adhesion [GO:0098609]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	desmosome [GO:0030057]; plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]	NDQYNVSVVAMDADGR	0.96539	-0.078738	0	0	0	0	0	524.74	0	0	0	0	0	554.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1159.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AUG2	F7AUG2_HORSE	ADP ribosylation factor like GTPase 14 effector protein	ARL14EP	Equus caballus (Horse)		cytosol [GO:0005829]; focal adhesion [GO:0005925]; intracellular membrane-bounded organelle [GO:0043231]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]		QVIPAKSK	0.98803	-1.5983	15161	0	0	13130	0	0	0	0	0	10590	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7061.8	0	0	153480	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AUH2	F7AUH2_HORSE	Retinol dehydrogenase 16	LOC100146471	Equus caballus (Horse)	retinol metabolic process [GO:0042572]; steroid metabolic process [GO:0008202]	intracellular membrane-bounded organelle [GO:0043231]	NAD-retinol dehydrogenase activity [GO:0004745]	VVNVSSPAGR	0.96161	-0.14541	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	593.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AUP4	F7AUP4_HORSE	Integrator complex subunit 7	INTS7	Equus caballus (Horse)	snRNA 3'-end processing [GO:0034472]	integrator complex [GO:0032039]		QLLQQLVTSYPSTK	0.96814	-0.049992	0	0	0	0	0	0	0	0	0	0	432.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AUW8	F7AUW8_HORSE	Laccase domain containing 1	LACC1	Equus caballus (Horse)			2'-deoxyadenosine deaminase activity [GO:0046936]; adenosine deaminase activity [GO:0004000]; metal ion binding [GO:0046872]; S-methyl-5-thioadenosine phosphorylase activity [GO:0017061]	FCQIKTDHANDIWIMGRK	0.92208	0.29034	0	957.68	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AV98	F7AV98_HORSE	[heparan sulfate]-glucosamine N-sulfotransferase (EC 2.8.2.8)	NDST2	Equus caballus (Horse)	"heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process [GO:0015014]; heparin biosynthetic process [GO:0030210]"	Golgi apparatus [GO:0005794]; membrane [GO:0016020]	[heparan sulfate]-glucosamine N-sulfotransferase activity [GO:0015016]; deacetylase activity [GO:0019213]	QFALVLPR	0.96767	-0.044607	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1841.6	0	0	0	0	0	0
F7AWA5	F7AWA5_HORSE	Cadherin-5 (Vascular endothelial cadherin)	CDH5	Equus caballus (Horse)	adherens junction organization [GO:0034332]; bicellular tight junction assembly [GO:0070830]; blood vessel endothelial cell migration [GO:0043534]; blood vessel maturation [GO:0001955]; calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules [GO:0016339]; cell morphogenesis [GO:0000902]; cell-cell adhesion mediated by cadherin [GO:0044331]; cell-cell junction assembly [GO:0007043]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; intracellular calcium ion homeostasis [GO:0006874]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of endothelial cell apoptotic process [GO:2000352]; negative regulation of inflammatory response [GO:0050728]; negative regulation of microtubule polymerization [GO:0031115]; positive regulation of angiogenesis [GO:0045766]; positive regulation of BMP signaling pathway [GO:0030513]; positive regulation of cell migration [GO:0030335]; positive regulation of establishment of endothelial barrier [GO:1903142]; positive regulation of gene expression [GO:0010628]; positive regulation of protein dephosphorylation [GO:0035307]; positive regulation of protein-containing complex assembly [GO:0031334]; protein localization to bicellular tight junction [GO:1902396]; regulation of establishment of cell polarity [GO:2000114]; regulation of protein phosphorylation [GO:0001932]; regulation of vascular permeability [GO:0043114]; transforming growth factor beta receptor signaling pathway [GO:0007179]; vasculature development [GO:0001944]	adherens junction [GO:0005912]; bicellular tight junction [GO:0005923]; catenin complex [GO:0016342]; external side of plasma membrane [GO:0009897]; nuclear membrane [GO:0031965]; nucleoplasm [GO:0005654]	beta-catenin binding [GO:0008013]; BMP receptor binding [GO:0070700]; cadherin binding [GO:0045296]; calcium ion binding [GO:0005509]; fibrinogen binding [GO:0070051]; protein phosphatase binding [GO:0019903]; protein tyrosine kinase binding [GO:1990782]; transmembrane transporter binding [GO:0044325]; vascular endothelial growth factor receptor 2 binding [GO:0043184]	APQRARPRR	0.96718	-0.051671	0	0	0	0	0	0	0	0	0	0	0	0	0	404.05	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	369.11	0	0	0	714.61	0	0	0	0	1133.3	0	0	0	0	0	0	0	0	0	0	742.66	0	0	715.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AWH5	F7AWH5_HORSE	ATP receptor (Purinergic receptor)		Equus caballus (Horse)	calcium ion transmembrane transport [GO:0070588]; response to ATP [GO:0033198]	cell junction [GO:0030054]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]	extracellularly ATP-gated monoatomic cation channel activity [GO:0004931]; purinergic nucleotide receptor activity [GO:0001614]	TAAHWGK	0.95484	0.22298	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	409.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AWN6	F7AWN6_HORSE	Trace amine associated receptor 9	TAAR9	Equus caballus (Horse)		membrane [GO:0016020]	trace-amine receptor activity [GO:0001594]	KAVKLIVTGK	0.9711	-0.20691	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	313.61	0
F7AYB3	F7AYB3_HORSE	Folliculin interacting protein 1	FNIP1	Equus caballus (Horse)	cellular response to starvation [GO:0009267]; immature B cell differentiation [GO:0002327]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of TOR signaling [GO:0032007]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of B cell apoptotic process [GO:0002904]; positive regulation of protein phosphorylation [GO:0001934]; regulation of pro-B cell differentiation [GO:2000973]; regulation of protein phosphorylation [GO:0001932]; TOR signaling [GO:0031929]	cytoplasm [GO:0005737]; lysosomal membrane [GO:0005765]		LETVVCTGSAPVDK	0.28571	0.83118	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	409.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AYM3	F7AYM3_HORSE	Tigger transposable element derived 4	TIGD4	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	IDIINAVESGK	0.9232	0.28889	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	375.64	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AYY8	F7AYY8_HORSE	Fibrous sheath interacting protein 2 like	FSIP2L	Equus caballus (Horse)				EIGINHQPDSNGGNKSLSMLK	0.89804	0.32614	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3189.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AZV3	F7AZV3_HORSE	Hippocalcin-like protein 4	HPCAL4	Equus caballus (Horse)			calcium ion binding [GO:0005509]	AGPAMGK	0.95404	0.23672	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	533.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	572.93	0	0	0	0	608.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7AZX6	F7AZX6_HORSE	Centrosomal protein 43 (FGFR1 oncogene partner)	CEP43	Equus caballus (Horse)	cell projection organization [GO:0030030]; microtubule anchoring [GO:0034453]	centriole [GO:0005814]; centrosome [GO:0005813]		GPANGER	0.95744	0.22074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	524.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7B3E0	F7B3E0_HORSE	LIM domain 7	LMO7	Equus caballus (Horse)	regulation of cell adhesion [GO:0030155]; regulation of signaling [GO:0023051]		metal ion binding [GO:0046872]	LKPGVIK	0.98755	-1.0202	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13733
F7B485	F7B485_HORSE	Ajuba LIM protein	AJUBA	Equus caballus (Horse)	regulatory ncRNA-mediated gene silencing [GO:0031047]		metal ion binding [GO:0046872]	QPPANYI	0.95647	0.23586	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	654.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7B4U0	F7B4U0_HORSE	Disco interacting B	DIP2B	Equus caballus (Horse)				VALVKCR	0.98565	-2.9952	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	672.8	0	0	0	0	0	0	0	0	0	0	0	0
F7B512	F7B512_HORSE	Nonsense-mediated mRNA decay factor	SMG7	Equus caballus (Horse)	"nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]"	nucleus [GO:0005634]		KGGLMGRYLK	0.97305	-0.20013	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	360.44	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7B680	F7B680_HORSE	G protein subunit alpha transducin 1	GNAT1	Equus caballus (Horse)	"adenylate cyclase-modulating G protein-coupled receptor signaling pathway [GO:0007188]; background adaptation [GO:0120302]; cell population proliferation [GO:0008283]; cellular response to electrical stimulus [GO:0071257]; detection of light stimulus involved in visual perception [GO:0050908]; dopamine secretion [GO:0014046]; eye photoreceptor cell development [GO:0042462]; neural tissue regeneration [GO:0097719]; phototransduction, visible light [GO:0007603]; response to light stimulus [GO:0009416]; response to organic cyclic compound [GO:0014070]; retinal cone cell differentiation [GO:0042670]; retinal rod cell differentiation [GO:0060221]; sensory perception of umami taste [GO:0050917]; visual behavior [GO:0007632]"	heterotrimeric G-protein complex [GO:0005834]; membrane [GO:0016020]; photoreceptor connecting cilium [GO:0032391]; photoreceptor inner segment [GO:0001917]; photoreceptor outer segment [GO:0001750]	G protein-coupled receptor binding [GO:0001664]; G-protein beta/gamma-subunit complex binding [GO:0031683]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]	GAGASAEEKHSRELEK	0.98444	-0.24551	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	370.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	578.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7B7G0	F7B7G0_HORSE	Formin homology 2 domain containing 1	FHOD1	Equus caballus (Horse)				FLENVAAAETEKQAALAQGR	0.36771	0.72242	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1723.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	577.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7B7H8	F7B7H8_HORSE	Proteasome activator subunit 4	PSME4	Equus caballus (Horse)	DNA repair [GO:0006281]		lysine-acetylated histone binding [GO:0070577]; peptidase activator activity [GO:0016504]; proteasome binding [GO:0070628]	LHRERYK	0.96938	0.17413	0	0	0	0	0	0	500.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7B7X0	F7B7X0_HORSE	"Keratin, type II cytoskeletal 1 (Cytokeratin-1) (Keratin-1) (Type-II keratin Kb1)"	KRT1 KRT2C	Equus caballus (Horse)		cytoplasm [GO:0005737]; keratin filament [GO:0045095]; plasma membrane [GO:0005886]		AQYEDIAQK	0	86.67	2737.8	3561.2	2127.6	2503.8	2584.1	2651.7	5747.1	4344.4	5723.8	4215.6	9220.8	8879	14388	14322	12567	16763	19428	18039	1734	5743.4	6543.7	2158.5	1614.5	2202.5	2391.3	3107.7	3191.7	17766	19362	22716	23451	24295	22734	12820	17145	10896	7822.3	20865	18666	19603	23511	24863	12741	12603	10705	14903	21507	22911	13146	12906	14984	2492.9	7063.3	8580.9	4311.3	4202.3	5031.2	16607	17654	21395	1482.1	5763.9	6015.7	5778.8	5165.3	5730.6	9586.3	8381.5	8183.8	6796	17480	17001	4033.8	3315.9	5284.7
F7B7X4	F7B7X4_HORSE	CD244 molecule	CD244	Equus caballus (Horse)	natural killer cell activation involved in immune response [GO:0002323]	external side of plasma membrane [GO:0009897]	MHC class I protein binding [GO:0042288]	VQLPSKPGFYR	0.97198	0.031834	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	466.8
F7B8S1	F7B8S1_HORSE	T-box transcription factor 10	TBX10	Equus caballus (Horse)	cell fate specification [GO:0001708]; positive regulation of DNA-templated transcription [GO:0045893]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	DPNKAPASTSR	0.96984	0.17439	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	448.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7B9I7	F7B9I7_HORSE	glycerophosphocholine cholinephosphodiesterase (EC 3.1.4.38) (Choline-specific glycerophosphodiester phosphodiesterase) (Ectonucleotide pyrophosphatase/phosphodiesterase family member 6)	ENPP6	Equus caballus (Horse)	choline metabolic process [GO:0019695]; lipid metabolic process [GO:0006629]	extracellular region [GO:0005576]; plasma membrane [GO:0005886]	glycerophosphocholine cholinephosphodiesterase activity [GO:0047390]; glycerophosphodiester phosphodiesterase activity [GO:0008889]	GPVVSLWPAPGK	0.96505	-0.12926	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2493.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BAM0	F7BAM0_HORSE	Haloacid dehalogenase like hydrolase domain containing 5	HDHD5	Equus caballus (Horse)				KLFSQYHRR	0.96941	0.15641	0	349.78	0	0	0	0	0	0	331.51	0	480.79	0	0	0	0	0	0	2130.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1967.3	0	0	0	0	0	0	0	0	0	0	711.64	0	0	0	0	720.34	0	0	683.67	0	0	0	0	0	0	0	0	0	1114.1	0	0	898.59	0	0	0	728.88	0
F7BCR9	F7BCR9_HORSE	Ligand dependent nuclear receptor corepressor	LCOR	Equus caballus (Horse)				KFPGATPARNNWK	0.91009	0.30031	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	391	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BCS7	F7BCS7_HORSE	"Mucin 20, cell surface associated"	MUC20	Equus caballus (Horse)	hepatocyte growth factor receptor signaling pathway [GO:0048012]			VAGSPAR	0.94849	0.23881	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	413	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39014	0
F7BCX4	F7BCX4_HORSE	IQ motif containing N	IQCN	Equus caballus (Horse)				APARPPLEAEK	0.96791	-0.1582	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1984.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	608.96	0	0	0
F7BDQ9	F7BDQ9_HORSE	RNA helicase (EC 3.6.4.13)	DDX25	Equus caballus (Horse)	poly(A)+ mRNA export from nucleus [GO:0016973]; regulation of translation [GO:0006417]; spermatid development [GO:0007286]	chromatoid body [GO:0033391]; cytoplasmic stress granule [GO:0010494]; nucleus [GO:0005634]	ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724]	GIYAMGFNRPSK	0.9661	-0.075736	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2163.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BE81	F7BE81_HORSE	Transporter	SLC6A7	Equus caballus (Horse)	proline transport [GO:0015824]; protein catabolic process [GO:0030163]; sodium ion transmembrane transport [GO:0035725]	membrane [GO:0016020]; synapse [GO:0045202]	L-proline transmembrane transporter activity [GO:0015193]; proline:sodium symporter activity [GO:0005298]	CAGAAGAK	0.98831	-1.0402	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	370.8	0	0	0	0	0	0	0	0	0	0	0	0	0	436.56	0	0	0	377	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BEX0	F7BEX0_HORSE	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1	SMARCAD1	Equus caballus (Horse)	chromosome separation [GO:0051304]; DNA double-strand break processing [GO:0000729]; regulation of DNA recombination [GO:0000018]	heterochromatin [GO:0000792]; nuclear replication fork [GO:0043596]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; site of double-strand break [GO:0035861]	"ATP binding [GO:0005524]; ATP-dependent activity, acting on DNA [GO:0008094]; ATP-dependent chromatin remodeler activity [GO:0140658]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; ubiquitin binding [GO:0043130]"	SQNYPKNAAK	0.98739	-3.6346	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	386.32	0	0	0	0	2806.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BFK5	F7BFK5_HORSE	Asteroid homolog 1	ASTE1	Equus caballus (Horse)			nuclease activity [GO:0004518]	LHVCFVQCFSEADR	0.96433	-0.022809	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	673.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BHY0	F7BHY0_HORSE	glutaminase (EC 3.5.1.2)	GLS	Equus caballus (Horse)	glutamate biosynthetic process [GO:0006537]; glutamine catabolic process [GO:0006543]		glutaminase activity [GO:0004359]	FLLEACK	0.96463	-0.02277	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	980.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BIM9	F7BIM9_HORSE	"Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B"	MGAT4B	Equus caballus (Horse)	protein N-linked glycosylation [GO:0006487]	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; Golgi stack [GO:0005795]	"acetylglucosaminyltransferase activity [GO:0008375]; alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity [GO:0008454]"	RAVSERQALR	0.97403	-0.20342	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	765.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BK24	F7BK24_HORSE	Homer scaffold protein 2	C1H15orf40	Equus caballus (Horse)		cytoplasm [GO:0005737]		LARAPRCR	0.96358	-0.022255	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	676.86	0	0	0	0	0	333.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BK76	F7BK76_HORSE	Macrophage stimulating 1	MST1	Equus caballus (Horse)	proteolysis [GO:0006508]; regulation of receptor signaling pathway via JAK-STAT [GO:0046425]	extracellular space [GO:0005615]	receptor tyrosine kinase binding [GO:0030971]	GSVSKTR	0.67069	0.60887	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	370.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BKR4	F7BKR4_HORSE	Presequence translocase associated motor 16	PAM16	Equus caballus (Horse)	protein import into mitochondrial matrix [GO:0030150]	TIM23 mitochondrial import inner membrane translocase complex [GO:0005744]		LSPEEIQK	0.97527	0.10711	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1270.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BNG9	F7BNG9_HORSE	Mab-21 like 3	MAB21L3	Equus caballus (Horse)				LHKCVSQR	0.98761	-1.1989	0	0	0	0	557.67	0	0	972.58	0	0	0	0	0	830.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	684.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BNN7	F7BNN7_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	STK26	Equus caballus (Horse)	negative regulation of cell migration [GO:0030336]	cytoplasm [GO:0005737]; Golgi apparatus [GO:0005794]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	CSADESP	0.96791	-0.03768	0	0	0	0	0	0	0	0	0	0	0	0	1005	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	693.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	894.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BQF5	F7BQF5_HORSE	Centrosomal protein 68	CEP68	Equus caballus (Horse)				APSYRRWSCR	0.96982	-0.03202	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1078.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1156.5	1240.9	1180.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BTB9	F7BTB9_HORSE	"Zinc finger protein, FOG family member 2"	ZFPM2 LOC111774999	Equus caballus (Horse)	anatomical structure morphogenesis [GO:0009653]; cell differentiation [GO:0030154]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]	AISEGEELIAFVVDFDSR	0.98117	-0.55819	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1699.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BTI3	F7BTI3_HORSE	AIG1-type G domain-containing protein		Equus caballus (Horse)		cytosol [GO:0005829]	GTP binding [GO:0005525]	IASFVISR	0.96904	-0.06918	0	0	0	0	0	0	0	0	0	0	0	1079.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1940.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BTK5	F7BTK5_HORSE	Rho guanine nucleotide exchange factor 10 like	ARHGEF10L	Equus caballus (Horse)	actin cytoskeleton organization [GO:0030036]; positive regulation of stress fiber assembly [GO:0051496]; SREBP signaling pathway [GO:0032933]	cytosol [GO:0005829]	guanyl-nucleotide exchange factor activity [GO:0005085]	MRKWSWGPR	0.98572	-2.058	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	461.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BTT3	F7BTT3_HORSE	Pleckstrin and Sec7 domain containing	PSD	Equus caballus (Horse)	neuron projection development [GO:0031175]; regulation of ARF protein signal transduction [GO:0032012]	"cleavage furrow [GO:0032154]; dendritic spine [GO:0043197]; postsynaptic density, intracellular component [GO:0099092]; ruffle membrane [GO:0032587]"	guanyl-nucleotide exchange factor activity [GO:0005085]; phospholipid binding [GO:0005543]	LVAGEYLK	0.95184	0.2398	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1876.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BUT9	F7BUT9_HORSE	Protein ZIP4 homolog	TEX11	Equus caballus (Horse)	male meiosis chromosome segregation [GO:0007060]; reciprocal meiotic recombination [GO:0007131]; synaptonemal complex assembly [GO:0007130]	central element [GO:0000801]		QILMNMKTGK	0.98598	-2.7199	0	0	0	0	0	0	0	0	0	0	0	475.06	0	0	0	1024.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BV24	F7BV24_HORSE	Leucine rich repeat transmembrane neuronal 2	LRRTM2	Equus caballus (Horse)	long-term synaptic potentiation [GO:0060291]; negative regulation of receptor internalization [GO:0002091]; positive regulation of synapse assembly [GO:0051965]; synapse organization [GO:0050808]	extracellular space [GO:0005615]; GABA-ergic synapse [GO:0098982]; postsynaptic specialization membrane [GO:0099634]		LRSLARNGFAGLIK	0.89632	0.3363	0	0	0	640.38	0	0	0	0	0	2195.6	2745.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1837.6	0	0	2892.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	920.24	0	0	1398.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1481.3	0
F7BW26	F7BW26_HORSE	Ribosomal RNA-processing protein 42	EXOSC7	Equus caballus (Horse)	"exonucleolytic catabolism of deadenylated mRNA [GO:0043928]; exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000467]; nuclear mRNA surveillance [GO:0071028]; nuclear polyadenylation-dependent mRNA catabolic process [GO:0071042]; nuclear polyadenylation-dependent rRNA catabolic process [GO:0071035]; nuclear polyadenylation-dependent tRNA catabolic process [GO:0071038]; nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5' [GO:0034427]; U1 snRNA 3'-end processing [GO:0034473]; U4 snRNA 3'-end processing [GO:0034475]; U5 snRNA 3'-end processing [GO:0034476]"	cytoplasmic exosome (RNase complex) [GO:0000177]; nuclear exosome (RNase complex) [GO:0000176]		GGDDLGTEIANTLYRIFNNK	0.97088	0.17177	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16521	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60945	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32132	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BW47	F7BW47_HORSE	EvC ciliary complex subunit 1	EVC	Equus caballus (Horse)	endochondral bone growth [GO:0003416]; positive regulation of smoothened signaling pathway [GO:0045880]; smoothened signaling pathway [GO:0007224]	ciliary basal body [GO:0036064]; ciliary membrane [GO:0060170]; cytoplasm [GO:0005737]; plasma membrane protein complex [GO:0098797]		ALEARVQEEASR	0.96779	-0.045909	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	473.13	0	0	0	0	0	0	0	0	0	0	0	0	571.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BXB8	F7BXB8_HORSE	Dynein axonemal heavy chain 17	DNAH17	Equus caballus (Horse)	microtubule-based movement [GO:0007018]	cytoplasm [GO:0005737]; dynein complex [GO:0030286]; microtubule [GO:0005874]; motile cilium [GO:0031514]	ATP binding [GO:0005524]; dynein intermediate chain binding [GO:0045505]; dynein light intermediate chain binding [GO:0051959]; minus-end-directed microtubule motor activity [GO:0008569]	GVYFIKK	0.98031	-0.60719	0	0	0	0	0	0	1700.1	1985.7	1789.6	0	1397	1958.8	2740.4	2659.4	2671.8	0	0	0	0	2743.9	2173.7	0	0	0	0	0	0	3718.2	3614.7	4479.7	3747	4051.8	3990.3	3908.2	3041.4	2804.7	791.9	2205.2	2117.2	1814.9	1556.4	1653.1	0	0	0	2120.1	1981.1	2221.9	566.55	582.3	633.95	0	2191.8	0	0	0	818.38	3885.4	3398.8	4258.9	0	1197.7	1329.5	0	0	0	0	0	0	0	2176.9	1771.2	0	0	0
F7BXH2	F7BXH2_HORSE	Transient receptor potential cation channel subfamily C member 5	TRPC5	Equus caballus (Horse)	calcium ion transmembrane transport [GO:0070588]; neuron apoptotic process [GO:0051402]; phosphatidylserine exposure on apoptotic cell surface [GO:0070782]; regulation of cytosolic calcium ion concentration [GO:0051480]	calcium channel complex [GO:0034704]; cation channel complex [GO:0034703]; plasma membrane [GO:0005886]	"inositol 1,4,5 trisphosphate binding [GO:0070679]; store-operated calcium channel activity [GO:0015279]"	ASGAQGK	0.93074	0.25645	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2303.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BXU7	F7BXU7_HORSE	KIAA0408	KIAA0408	Equus caballus (Horse)				AKIIDLDHKK	0.97025	0.17628	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	649.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BZ64	F7BZ64_HORSE	Transforming growth factor beta regulator 1	TBRG1	Equus caballus (Horse)	DNA replication [GO:0006260]; negative regulation of cell population proliferation [GO:0008285]; protein localization to nucleoplasm [GO:1990173]; protein stabilization [GO:0050821]; regulation of cell cycle [GO:0051726]	nucleoplasm [GO:0005654]; nucleus [GO:0005634]		LEEKFLKAK	0.96689	-0.17459	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1135.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BZ71	F7BZ71_HORSE	Hydroxylysine kinase (EC 2.7.1.81)	HYKK	Equus caballus (Horse)			amino acid kinase activity [GO:0019202]; hydroxylysine kinase activity [GO:0047992]	AGSKSGR	0.68786	0.59698	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1717.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BZN4	F7BZN4_HORSE	RING-type E3 ubiquitin transferase (EC 2.3.2.27)	MIB2	Equus caballus (Horse)	Notch signaling pathway [GO:0007219]; protein ubiquitination [GO:0016567]	early endosome [GO:0005769]; plasma membrane [GO:0005886]; ubiquitin ligase complex [GO:0000151]	ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]	RWPARPPRPARR	0.92548	0.28633	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1859	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BZV2	F7BZV2_HORSE	NADP-retinol dehydrogenase (EC 1.1.1.300)	RDH12	Equus caballus (Horse)	cellular detoxification of aldehyde [GO:0110095]; visual perception [GO:0007601]	photoreceptor inner segment [GO:0001917]	NAD-retinol dehydrogenase activity [GO:0004745]; NADP-retinol dehydrogenase activity [GO:0052650]	VAFLYLR	0.96076	-0.015889	0	0	0	0	0	0	0	0	0	0	0	755.41	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7BZY4	F7BZY4_HORSE	Solute carrier family 23 member 2	SLC23A2	Equus caballus (Horse)	L-ascorbic acid metabolic process [GO:0019852]	plasma membrane region [GO:0098590]	L-ascorbic acid transmembrane transporter activity [GO:0015229]	GVGKGSK	0.98713	-1.0609	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1526.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1158.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C086	F7C086_HORSE	stearoyl-CoA 9-desaturase (EC 1.14.19.1)	SCD5	Equus caballus (Horse)	unsaturated fatty acid biosynthetic process [GO:0006636]	endoplasmic reticulum membrane [GO:0005789]	metal ion binding [GO:0046872]; stearoyl-CoA 9-desaturase activity [GO:0004768]	GEGSGGGGGR	0.97281	0.13226	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	337.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C091	F7C091_HORSE	Kinase (EC 2.7.-.-)	ITPKB	Equus caballus (Horse)	inositol phosphate biosynthetic process [GO:0032958]; phosphorylation [GO:0016310]		kinase activity [GO:0016301]	VSPARCGLR	0.98922	-1.68	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	623.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C1E4	F7C1E4_HORSE	"ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3"	ST8SIA3	Equus caballus (Horse)	ganglioside biosynthetic process [GO:0001574]; N-glycan processing [GO:0006491]; oligosaccharide metabolic process [GO:0009311]; protein glycosylation [GO:0006486]; sialylation [GO:0097503]	Golgi apparatus [GO:0005794]; membrane [GO:0016020]	"alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity [GO:0003828]; identical protein binding [GO:0042802]"	LTLSHCA	0.99014	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	311.25	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C355	F7C355_HORSE	Primary cilia formation	CIMAP3 PIFO	Equus caballus (Horse)	regulation of cell projection organization [GO:0031344]		cytoskeletal protein binding [GO:0008092]	KGYTFGAR	0.98286	-0.71709	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	848.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C3D3	F7C3D3_HORSE	DnaJ heat shock protein family (Hsp40) member C1	DNAJC1	Equus caballus (Horse)		endomembrane system [GO:0012505]; membrane [GO:0016020]		LSLTLHPDKNK	0.98753	-1.9034	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	589.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C3S4	F7C3S4_HORSE	Phosphodiesterase (EC 3.1.4.-)	PDE4A	Equus caballus (Horse)	cAMP catabolic process [GO:0006198]; signal transduction [GO:0007165]		"3',5'-cyclic-AMP phosphodiesterase activity [GO:0004115]; metal ion binding [GO:0046872]"	RQRQSLR	0.96775	-0.070162	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3060
F7C4R7	F7C4R7_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	STK32A	Equus caballus (Horse)			ATP binding [GO:0005524]; protein kinase activity [GO:0004672]	RLVPGFVPNKGR	0.98103	-0.21388	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	770.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C5E5	F7C5E5_HORSE	Nuclear apoptosis-inducing factor 1	NAIF1	Equus caballus (Horse)		nucleus [GO:0005634]		LIQEQRVTNLHVK	0.89026	0.36232	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	532.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	377.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C5F1	F7C5F1_HORSE	Retinoic acid receptor responder protein 2 (Chemerin)	RARRES2	Equus caballus (Horse)	cell differentiation [GO:0030154]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; positive regulation of chemotaxis [GO:0050921]; regulation of lipid catabolic process [GO:0050994]	extracellular matrix [GO:0031012]; extracellular space [GO:0005615]	signaling receptor binding [GO:0005102]	GPGGGSGR	0.97332	0.054048	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	263.37	347.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C6Q1	F7C6Q1_HORSE	"Presequence protease, mitochondrial (Pitrilysin metalloproteinase 1)"	PITRM1	Equus caballus (Horse)	protein processing [GO:0016485]	mitochondrial matrix [GO:0005759]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	DPFFKMLNR	0.9864	-1.1837	0	0	0	0	0	0	0	0	504.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	573.04	0	510.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	392.16	0	0	0	0	0	0	0	0	0	0	0	0
F7C6Z4	F7C6Z4_HORSE	Leucine rich repeat containing 8 VRAC subunit E	LRRC8E	Equus caballus (Horse)	monoatomic ion transmembrane transport [GO:0034220]; signal transduction [GO:0007165]	plasma membrane [GO:0005886]		EVPLWVFGLR	0.98387	-0.22772	0	0	0	0	0	0	0	0	0	0	0	0	0	2705.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1298.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C714	F7C714_HORSE	Potassium voltage-gated channel subfamily H member 5	KCNH5	Equus caballus (Horse)	potassium ion transmembrane transport [GO:0071805]; regulation of G2/M transition of mitotic cell cycle [GO:0010389]; regulation of membrane potential [GO:0042391]	cell surface [GO:0009986]; monoatomic ion channel complex [GO:0034702]	calmodulin binding [GO:0005516]; voltage-gated potassium channel activity [GO:0005249]	VNSPIRMK	0.97964	-0.44393	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1108.5	1151.1	1038.2	0	0	0	1220	1174.4	787.84	0	0	0	0	808.54	815.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	968.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C738	F7C738_HORSE	DNA helicase MCM9 (EC 3.6.4.12) (Minichromosome maintenance 9)	MCM9	Equus caballus (Horse)	DNA duplex unwinding [GO:0032508]	chromosome [GO:0005694]; nucleus [GO:0005634]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; DNA binding [GO:0003677]	LSLGSIPR	0.88017	0.38313	21026	13482	12358	9382.6	10042	10078	64308	65884	66281	17217	32809	30308	70460	69900	70710	45503	43372	39775	12268	67479	56616	8077.4	15462	8399.3	10361	10222	10424	81111	85552	89748	87447	88016	84226	86516	92393	83771	20349	83199	81998	102700	94563	97036	30655	30420	28860	61075	55567	56474	69899	69274	68938	11151	34103	31923	7378.9	12648	13092	81311	87726	90956	14868	39390	42278	16986	16195	14897	1474.1	31787	34199	16592	70793	66477	19481	18185	18247
F7C7J6	F7C7J6_HORSE	Coagulation factor XIII B chain	F13B	Equus caballus (Horse)	blood coagulation [GO:0007596]			YPLCIKK	0.98288	-0.72159	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2722.6	0	0	0	0	0	0	782.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C9D2	F7C9D2_HORSE	Tumor necrosis factor ligand 2A	TNLG2A	Equus caballus (Horse)	positive regulation of cell adhesion [GO:0045785]; positive regulation of leukocyte migration [GO:0002687]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]; regulation of T cell proliferation [GO:0042129]; T cell proliferation involved in immune response [GO:0002309]; tumor necrosis factor-mediated signaling pathway [GO:0033209]	cell surface [GO:0009986]	identical protein binding [GO:0042802]; tumor necrosis factor receptor superfamily binding [GO:0032813]	FGPLPSK	0.96644	-0.038319	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1402.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7C9N2	F7C9N2_HORSE	Large ribosomal subunit protein uL29 (60S ribosomal protein L35)		Equus caballus (Horse)	"maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463]; translation [GO:0006412]"	cytosolic large ribosomal subunit [GO:0022625]	mRNA binding [GO:0003729]; structural constituent of ribosome [GO:0003735]	ATCRWLNKYK	0.91211	0.31236	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	738.31	0	0	0	3170.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CA98	F7CA98_HORSE	"Lon protease homolog, mitochondrial (EC 3.4.21.53) (Lon protease-like protein) (LONP) (Mitochondrial ATP-dependent protease Lon) (Serine protease 15)"	LONP1	Equus caballus (Horse)	cellular response to oxidative stress [GO:0034599]; chaperone-mediated protein complex assembly [GO:0051131]; mitochondrion organization [GO:0007005]; negative regulation of insulin receptor signaling pathway [GO:0046627]; oxidation-dependent protein catabolic process [GO:0070407]; protein quality control for misfolded or incompletely synthesized proteins [GO:0006515]; regulation of peptidyl-tyrosine phosphorylation [GO:0050730]; response to hypoxia [GO:0001666]	cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; mitochondrial nucleoid [GO:0042645]; nucleoplasm [GO:0005654]	ADP binding [GO:0043531]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent peptidase activity [GO:0004176]; DNA polymerase binding [GO:0070182]; G-quadruplex DNA binding [GO:0051880]; identical protein binding [GO:0042802]; insulin receptor substrate binding [GO:0043560]; mitochondrial promoter sequence-specific DNA binding [GO:0001018]; PH domain binding [GO:0042731]; serine-type endopeptidase activity [GO:0004252]; single-stranded DNA binding [GO:0003697]; single-stranded RNA binding [GO:0003727]	GLPHGQDPAGGR	0.97147	-0.06056	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	885.57	0	0	0	0	0	0	0	0
F7CAJ8	F7CAJ8_HORSE	Hormone-sensitive lipase (EC 3.1.1.23) (EC 3.1.1.79) (Monoacylglycerol lipase LIPE) (Retinyl ester hydrolase)	LIPE	Equus caballus (Horse)	cholesterol metabolic process [GO:0008203]; triglyceride catabolic process [GO:0019433]	caveola [GO:0005901]; cytosol [GO:0005829]; lipid droplet [GO:0005811]	acylglycerol lipase activity [GO:0047372]; hormone-sensitive lipase activity [GO:0033878]; sterol esterase activity [GO:0004771]; triglyceride lipase activity [GO:0004806]	LISYDLR	0.96734	-0.072887	0	0	0	0	0	0	0	0	0	0	0	1714.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1031.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CAW0	F7CAW0_HORSE	Family with sequence similarity 50 member B	FAM50B	Equus caballus (Horse)	chromatin organization [GO:0006325]	nucleus [GO:0005634]		LEALREQER	0.98439	-0.97528	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1471.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1319.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CAZ8	F7CAZ8_HORSE	Palmitoyltransferase (EC 2.3.1.225)	ZDHHC2	Equus caballus (Horse)	protein targeting to membrane [GO:0006612]	endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]	protein-cysteine S-palmitoyltransferase activity [GO:0019706]	APSGPGSVR	0.95911	-0.017201	0	0	0	0	0	0	0	0	763.37	0	0	0	0	0	0	2519.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2714.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CBK3	F7CBK3_HORSE	CUB domain containing protein 2	CDCP2	Equus caballus (Horse)		membrane [GO:0016020]		AAGPASIK	0.97224	0.043835	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	696.81	1115.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	435	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	397.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CC20	F7CC20_HORSE	Ventral anterior homeobox 2	VAX2	Equus caballus (Horse)	axonogenesis [GO:0007409]; brain development [GO:0007420]; central nervous system development [GO:0007417]; dorsal/ventral axis specification [GO:0009950]; embryonic eye morphogenesis [GO:0048048]; forebrain development [GO:0030900]; neuron differentiation [GO:0030182]; regulation of transcription by RNA polymerase II [GO:0006357]; retina development in camera-type eye [GO:0060041]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	"chromatin DNA binding [GO:0031490]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding [GO:0001162]"	GVGSPVGGK	0.94527	0.2425	0	0	0	0	0	0	0	0	0	0	0	533.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1410.9	0	0	0	0	0	0	1058.2	1073.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	587.83	0	0	0	0	0	0	0	0
F7CCK6	F7CCK6_HORSE	dual-specificity kinase (EC 2.7.12.1)	TESK1	Equus caballus (Horse)	actin cytoskeleton organization [GO:0030036]; positive regulation of stress fiber assembly [GO:0051496]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	DLTSKNCLIRR	0.9733	-0.18538	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	844.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CD26	F7CD26_HORSE	Syntaxin 11	STX11	Equus caballus (Horse)	vesicle-mediated transport [GO:0016192]	membrane [GO:0016020]		AVQYQKK	0.98409	-0.69886	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	852.6	0	0	0	0	0	0	0	0	0	0	0
F7CD67	F7CD67_HORSE	"Selenide, water dikinase 1 (EC 2.7.9.3) (Selenium donor protein 1) (Selenophosphate synthase 1)"	SEPHS1	Equus caballus (Horse)	phosphorylation [GO:0016310]; selenocysteine biosynthetic process [GO:0016260]	cytoplasm [GO:0005737]	"ATP binding [GO:0005524]; identical protein binding [GO:0042802]; selenide, water dikinase activity [GO:0004756]"	SLSLPAVR	0.87981	0.45213	20197	9885.3	0	9382.6	10042	10078	0	0	0	0	0	0	0	0	0	34005	0	0	5465.2	0	38953	0	0	8399.3	0	8062.4	0	70468	0	0	0	0	0	0	77633	56794	0	1040.1	0	0	0	0	28967	28623	26973	47550	44411	0	49589	50498	0	0	33306	0	0	0	0	57901	63829	0	0	1177.5	0	0	13481	0	0	0	0	0	0	0	0	13930	0
F7CDW6	F7CDW6_HORSE	Cysteine and serine rich nuclear protein 2	CSRNP2	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; phosphatase binding [GO:0019902]; sequence-specific DNA binding [GO:0043565]"	LHAKKMK	0.96841	-0.072373	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5452.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CE49	F7CE49_HORSE	Cytochrome P450 family 4 subfamily X member 1	CYP4X1	Equus caballus (Horse)		membrane [GO:0016020]	"heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [GO:0016705]"	DLRPFPAPPTHWFYGHQK	0.8714	0.46199	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	877.94	0	0	0	0	831.94	515.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	718.78	0	0	0	0	0	0	723.91	0	0	0	0	0	0	0	0
F7CEF2	F7CEF2_HORSE	IQ motif containing H	IQCH	Equus caballus (Horse)				GLIPPTAR	0.98406	-0.73259	0	0	0	0	0	0	0	0	0	5128.1	0	0	0	0	0	0	0	857.46	0	0	0	0	0	5058.8	4707	0	0	0	0	47319	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CGB2	F7CGB2_HORSE	Leucine rich repeat containing 2	LRRC2	Equus caballus (Horse)	signal transduction [GO:0007165]			QSSLSKER	0.28235	0.85063	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	377.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	847.18	920.54	0	0	0	0	0	0	0	403.57	347.58	0	0	0	452	520.27	474.85	0	0	337.32	0	0	0
F7CGT3	F7CGT3_HORSE	Vitellogenin domain-containing protein	LOC102148840	Equus caballus (Horse)			lipid transporter activity [GO:0005319]	ALPEDIVSR	0.98698	-1.1502	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	507.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CHA8	F7CHA8_HORSE	Mex-3 RNA binding family member A	MEX3A	Equus caballus (Horse)		cytosol [GO:0005829]; nucleus [GO:0005634]; P-body [GO:0000932]	metal ion binding [GO:0046872]; RNA binding [GO:0003723]	LCALYKEAELR	0.92557	0.28288	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	861.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CHT6	F7CHT6_HORSE	Protein arginine methyltransferase 9	PRMT9	Equus caballus (Horse)	mRNA processing [GO:0006397]	cytoplasm [GO:0005737]	protein-arginine omega-N monomethyltransferase activity [GO:0035241]; protein-arginine omega-N symmetric methyltransferase activity [GO:0035243]	EVKVQICK	0.98394	-1.1712	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	722.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CJ45	F7CJ45_HORSE	NK2 homeobox 8	NKX2-8	Equus caballus (Horse)	axonogenesis [GO:0007409]; cell differentiation [GO:0030154]; epithelial cell proliferation [GO:0050673]; lung development [GO:0030324]; negative regulation of epithelial cell proliferation [GO:0050680]; regulation of transcription by RNA polymerase II [GO:0006357]; transcription by RNA polymerase II [GO:0006366]	nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	DGQPCGGGGEVGPPAVRAK	0.9854	-1.9527	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1268.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CJJ0	F7CJJ0_HORSE	PR/SET domain 13	PRDM13	Equus caballus (Horse)	methylation [GO:0032259]; regulation of gene expression [GO:0010468]	nucleus [GO:0005634]	methyltransferase activity [GO:0008168]	HPGQNLLAK	0.96663	-0.081907	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	505.06	0	0	0	0	0	0	0	0	0	0	0	0	555.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CJM0	F7CJM0_HORSE	Signal transducer and activator of transcription	STAT4	Equus caballus (Horse)	cytokine-mediated signaling pathway [GO:0019221]; defense response [GO:0006952]; receptor signaling pathway via JAK-STAT [GO:0007259]; regulation of cell population proliferation [GO:0042127]; regulation of transcription by RNA polymerase II [GO:0006357]; response to peptide hormone [GO:0043434]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	VLQGPLEK	0.93486	0.24901	0	1367.8	0	0	0	0	464.44	581.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1092.9	0	0	0	0	0	0	0	0	0	0	0	0	996.48	571.68	0	0	0	0	0	0	0	0	718.09	0	0	1108.8	1064.8	0	0	0	0	1510.8	0	1444.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CJM6	F7CJM6_HORSE	Family with sequence similarity 241 member A	FAM241A	Equus caballus (Horse)		Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]		GGGGGER	0.98785	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	363.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	406.08	0	0	0	0
F7CK74	F7CK74_HORSE	Zinc finger protein 677	LOC102150861	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]		DNA-binding transcription factor activity [GO:0003700]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]	EKQGNKSCINLSLK	0.92755	0.2602	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	540.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CK81	F7CK81_HORSE	Lymphocyte antigen 6 family member H	LY6H	Equus caballus (Horse)				KDHSVNK	0.98357	-0.70756	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2282.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	614.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CKI0	F7CKI0_HORSE	DnaJ heat shock protein family (Hsp40) member B1	DNAJB1	Equus caballus (Horse)	chaperone cofactor-dependent protein refolding [GO:0051085]; negative regulation of transcription by RNA polymerase II [GO:0000122]	cytosol [GO:0005829]	Hsp70 protein binding [GO:0030544]; transcription corepressor activity [GO:0003714]; unfolded protein binding [GO:0051082]	GKDYYQTLGLAR	0.89093	0.42914	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	684.68	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CPQ7	F7CPQ7_HORSE	WSC domain containing 1	WSCD1	Equus caballus (Horse)		Golgi membrane [GO:0000139]	sulfotransferase activity [GO:0008146]	MAKPFFRLQK	0.98537	-2.4681	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	589.6	0	590.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CQ32	F7CQ32_HORSE	SET binding factor 2	SBF2	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]	AGGFHGK	0.93377	0.26532	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	567.48	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1294.9	0
F7CQ86	F7CQ86_HORSE	Lipocalin/cytosolic fatty-acid binding domain-containing protein	LOC100051562	Equus caballus (Horse)	acute-phase response [GO:0006953]; regulation of immune system process [GO:0002682]	extracellular space [GO:0005615]		KEGTLSIHENGR	0.98465	-0.81813	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2331.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CQX6	F7CQX6_HORSE	Golgi transport 1A	GOLT1A	Equus caballus (Horse)	"endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; retrograde transport, endosome to Golgi [GO:0042147]"	cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; Golgi membrane [GO:0000139]; membrane [GO:0016020]		EPEDPDSHAK	0.91527	0.30819	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	447.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CR52	F7CR52_HORSE	WD repeat containing planar cell polarity effector	WDPCP	Equus caballus (Horse)	cell projection organization [GO:0030030]	cilium [GO:0005929]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; plasma membrane [GO:0005886]		DIGVYQYYDKK	0.97895	-0.39513	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7831.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CR77	F7CR77_HORSE	Tripartite motif containing 67	TRIM67	Equus caballus (Horse)	negative regulation of Ras protein signal transduction [GO:0046580]; positive regulation of neuron projection development [GO:0010976]; positive regulation of ubiquitin-dependent protein catabolic process [GO:2000060]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	zinc ion binding [GO:0008270]	AKLLTKVTK	0.98609	-2.0152	0	0	0	0	0	0	0	0	0	0	1302.7	0	0	0	652.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	719.28	0	0	0	0	0	0	0	522.99	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	723.07	0	0
F7CRD2	F7CRD2_HORSE	"Tryptophan 2,3-dioxygenase (TDO) (EC 1.13.11.11) (Tryptamin 2,3-dioxygenase) (Tryptophan oxygenase) (TO) (TRPO) (Tryptophan pyrrolase) (Tryptophanase)"	TDO2	Equus caballus (Horse)	protein homotetramerization [GO:0051289]; tryptophan catabolic process to acetyl-CoA [GO:0019442]; tryptophan catabolic process to kynurenine [GO:0019441]		"heme binding [GO:0020037]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; tryptophan 2,3-dioxygenase activity [GO:0004833]"	SQTGVNR	0.96847	-0.037265	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2908.8	0	0	0	1183.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CRY5	F7CRY5_HORSE	"WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2"	WFIKKN2	Equus caballus (Horse)	transforming growth factor beta receptor signaling pathway [GO:0007179]	extracellular space [GO:0005615]	metalloendopeptidase inhibitor activity [GO:0008191]; receptor antagonist activity [GO:0048019]; serine-type endopeptidase inhibitor activity [GO:0004867]; transforming growth factor beta binding [GO:0050431]	GPVGMPK	0.97933	-0.39251	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	358.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1439.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CS17	F7CS17_HORSE	HAUS augmin like complex subunit 6	HAUS6	Equus caballus (Horse)	spindle assembly [GO:0051225]	HAUS complex [GO:0070652]		LSDLKYMRYK	0.966	-0.084141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	344.98	0	0	0	0	1042.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5259.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CSE9	F7CSE9_HORSE	"Corepressor interacting with RBPJ, CIR1"	CIR1	Equus caballus (Horse)	in utero embryonic development [GO:0001701]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]	centrosome [GO:0005813]; nuclear speck [GO:0016607]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]	histone deacetylase binding [GO:0042826]; protein kinase binding [GO:0019901]; protein-containing complex binding [GO:0044877]; transcription corepressor activity [GO:0003714]	ISYDKKK	0.96511	-0.11691	0	0	0	0	0	0	0	0	0	0	0	0	1348.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	522.95	0	0	0	0	0	1367	0	0	0	0	0	890.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	739.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CUE7	F7CUE7_HORSE	Solute carrier family 35 member G2	SLC35G2	Equus caballus (Horse)		plasma membrane [GO:0005886]		LYWRNLR	0.98826	-1.7754	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7783.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CUP4	F7CUP4_HORSE	Zinc finger protein 26	ZNF26	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	THVSSRPRLHK	0.98604	-1.445	0	0	0	0	0	0	0	0	0	0	776.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CVC9	F7CVC9_HORSE	Fibrosin like 1	FBRSL1	Equus caballus (Horse)				EAPGPPR	0.93423	0.24899	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	981.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2263.2	0	0	0	0	0	0	0	0	0	0	0	3483.5	0
F7CVN8	F7CVN8_HORSE	FRY microtubule binding protein	FRY	Equus caballus (Horse)	cell morphogenesis [GO:0000902]			EVEILKDIR	0.97877	-0.40193	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	758.48	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CWB2	F7CWB2_HORSE	Coiled-coil domain containing 112	CCDC112	Equus caballus (Horse)				DKHSDFYNQKSDFR	0.9778	0.081175	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	981.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CXI1	F7CXI1_HORSE	RNA helicase (EC 3.6.4.13) (DEAD box protein 6)	DDX6	Equus caballus (Horse)	miRNA-mediated gene silencing by inhibition of translation [GO:0035278]; negative regulation of neuron differentiation [GO:0045665]; neuron differentiation [GO:0030182]; P-body assembly [GO:0033962]; stem cell population maintenance [GO:0019827]; viral RNA genome packaging [GO:0019074]	cytoplasmic stress granule [GO:0010494]; cytosol [GO:0005829]; nucleus [GO:0005634]; P-body [GO:0000932]; RISC complex [GO:0016442]	ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; nucleic acid binding [GO:0003676]; protein domain specific binding [GO:0019904]; RNA helicase activity [GO:0003724]	LPPKDLR	0.98878	-1.1847	0	0	0	0	0	0	0	0	0	0	0	0	0	0	425.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CXJ7	F7CXJ7_HORSE	Transcription factor SOX	SOX12	Equus caballus (Horse)	anatomical structure morphogenesis [GO:0009653]; cell differentiation [GO:0030154]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of transcription by RNA polymerase II [GO:0045944]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	AARGPAER	0.98952	-1.2145	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1247.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CXK4	F7CXK4_HORSE	ADP ribosylation factor like GTPase 4D	ARL4D	Equus caballus (Horse)	intracellular protein transport [GO:0006886]; vesicle-mediated transport [GO:0016192]		GTP binding [GO:0005525]; GTPase activity [GO:0003924]	TSLLYRLKFK	0.9729	-0.19577	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	588.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CYV6	F7CYV6_HORSE	"Pseudouridylate synthase RPUSD4, mitochondrial (RNA pseudouridylate synthase domain-containing protein 4)"	RPUSD4	Equus caballus (Horse)	mitochondrial tRNA pseudouridine synthesis [GO:0070902]; mRNA pseudouridine synthesis [GO:1990481]; positive regulation of mitochondrial translation [GO:0070131]	mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; ribonucleoprotein granule [GO:0035770]	mitochondrial ribosomal large subunit rRNA binding [GO:1990400]; pseudouridine synthase activity [GO:0009982]; tRNA binding [GO:0000049]	LSVGTLK	0.88462	0.37161	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	548.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7CZP0	F7CZP0_HORSE	Lipocalin/cytosolic fatty-acid binding domain-containing protein	LOC106781326	Equus caballus (Horse)		extracellular space [GO:0005615]	odorant binding [GO:0005549]; small molecule binding [GO:0036094]	ISSLAIK	0.20661	1.0513	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	591.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1900.2	0	0	0	0	0	0	0	0
F7D0B5	F7D0B5_HORSE	"Beta-1,4-glucuronyltransferase 1 (I-beta-1,3-N-acetylglucosaminyltransferase) (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase) (Poly-N-acetyllactosamine extension enzyme) (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1)"	B4GAT1	Equus caballus (Horse)	protein O-linked mannosylation [GO:0035269]	Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]	glucuronosyltransferase activity [GO:0015020]; metal ion binding [GO:0046872]	VPTFDER	0.96963	0.034482	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	442.46	0	0	0	0	0	0	0
F7D172	F7D172_HORSE	Olfactory receptor	OR9E4	Equus caballus (Horse)		plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; odorant binding [GO:0005549]; olfactory receptor activity [GO:0004984]	EMKVALEK	0.98758	-1.5557	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	790.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	547.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D1B9	F7D1B9_HORSE	Macrophage-expressed gene 1 protein (Perforin-2)	MPEG1	Equus caballus (Horse)	defense response to bacterium [GO:0042742]; defense response to Gram-negative bacterium [GO:0050829]; defense response to Gram-positive bacterium [GO:0050830]	phagolysosome membrane [GO:0061474]	wide pore channel activity [GO:0022829]	VQPESLPR	0.96977	0.038052	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	643	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D1N0	F7D1N0_HORSE	Type-1 angiotensin II receptor	AGTR1	Equus caballus (Horse)	G protein-coupled receptor signaling pathway [GO:0007186]; inflammatory response [GO:0006954]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; regulation of vasoconstriction [GO:0019229]	plasma membrane [GO:0005886]	angiotensin type I receptor activity [GO:0001596]; angiotensin type II receptor activity [GO:0004945]	AKSHSSLSTK	0.98572	-2.0564	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	116570	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D242	F7D242_HORSE	POM121 transmembrane nucleoporin like 2		Equus caballus (Horse)	protein import into nucleus [GO:0006606]; RNA export from nucleus [GO:0006405]	nuclear pore [GO:0005643]	nuclear localization sequence binding [GO:0008139]; structural constituent of nuclear pore [GO:0017056]	ALPPAEVR	0.69186	0.59791	0	0	0	0	0	0	0	0	0	0	0	0	529.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D281	F7D281_HORSE	"Keratin, type II cytoskeletal 6A"	KRT6A	Equus caballus (Horse)		keratin filament [GO:0045095]		AQYEEIAQR	0	2.3791	0	0	0	0	0	0	0	0	0	0	0	0	0	470.35	545.13	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	734.84	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	544.06	0	520.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D2G7	F7D2G7_HORSE	Tumor protein p53 inducible protein 3	TP53I3	Equus caballus (Horse)			oxidoreductase activity [GO:0016491]	IVLELPQ	0.96867	-0.042282	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2048.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D2J8	F7D2J8_HORSE	Endothelial PAS domain protein 1	EPAS1	Equus caballus (Horse)	cellular response to hypoxia [GO:0071456]; regulation of transcription by RNA polymerase II [GO:0006357]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; protein dimerization activity [GO:0046983]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	NGSGFGK	0.95509	0.23459	0	0	0	0	0	0	0	0	0	0	0	227.91	0	332.11	366.26	615.58	0	0	0	376.06	420.21	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1113.7	0	346.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D3X6	F7D3X6_HORSE	Transmembrane serine protease 9	TMPRSS9	Equus caballus (Horse)	proteolysis [GO:0006508]	membrane [GO:0016020]	serine-type endopeptidase activity [GO:0004252]	EGSAYHR	0.97625	0.089865	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	245.06	0	0	0	0	0	0	0	0	0	0	0	339.41	0	0	416.99	429.25	0	0	0	827.31	0	0	0	0	540.59	0	0	0	0	0	1186.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D3Y9	F7D3Y9_HORSE	Phosphodiesterase (EC 3.1.4.-)	PDE5A	Equus caballus (Horse)	signal transduction [GO:0007165]		"3',5'-cyclic-GMP phosphodiesterase activity [GO:0047555]; metal ion binding [GO:0046872]"	GLGSAGR	0.98682	-3.0801	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1481.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D440	F7D440_HORSE	Dysbindin domain containing 2	DBNDD2	Equus caballus (Horse)		cytoplasm [GO:0005737]		GVGEQQVCVGR	0.92314	0.2892	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1024.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	648.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D4D4	F7D4D4_HORSE	Inflammation and lipid regulator with UBA-like and NBR1-like domains	ILRUN	Equus caballus (Horse)	macroautophagy [GO:0016236]; negative regulation of defense response to virus [GO:0050687]; negative regulation of protein localization to nucleus [GO:1900181]; negative regulation of tumor necrosis factor production [GO:0032720]; negative regulation of type I interferon production [GO:0032480]	centrosome [GO:0005813]; cytosol [GO:0005829]; nuclear speck [GO:0016607]; phagophore assembly site [GO:0000407]	ubiquitin binding [GO:0043130]	GLHGARPR	0.93261	0.2776	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1984.3	0	0	0	2776.7	2567.4	3180.1	0	0	0	0	0	0	1451.4	1948.5	0	0	0	0	0	0	0
F7D4G5	F7D4G5_HORSE	Ubiquitin carboxyl-terminal hydrolase (EC 3.4.19.12)	USP51	Equus caballus (Horse)	proteolysis [GO:0006508]		cysteine-type deubiquitinase activity [GO:0004843]; zinc ion binding [GO:0008270]	LGSRPQTRR	0.98073	-0.51267	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	419.43	0	0	0	0	0	0	0	0	0	0	0	0	0	1613.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D541	F7D541_HORSE	DnaJ homolog subfamily B member 11 (ER-associated DNAJ) (ER-associated Hsp40 co-chaperone) (Endoplasmic reticulum DNA J domain-containing protein 3)	DNAJB11	Equus caballus (Horse)	protein folding [GO:0006457]		unfolded protein binding [GO:0051082]	QAIILDVHVR	0.96579	-0.15285	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1345	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D5C7	F7D5C7_HORSE	Patched domain containing 3	PTCHD3	Equus caballus (Horse)		membrane [GO:0016020]		LSDVYSK	0.95975	-0.019544	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3506.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1608.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D677	F7D677_HORSE	Sterile alpha motif domain containing 9	SAMD9	Equus caballus (Horse)		cytoplasm [GO:0005737]		DFSSALK	0.96898	-0.042282	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2606.8	0	0	0	0	0	0	2200.7	0	0	0	0	0	0	0	0	1596.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D705	F7D705_HORSE	Zinc finger protein 318	ZNF318	Equus caballus (Horse)	negative regulation of DNA-templated transcription [GO:0045892]; positive regulation of DNA-templated transcription [GO:0045893]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]	nucleic acid binding [GO:0003676]; protein homodimerization activity [GO:0042803]; zinc ion binding [GO:0008270]	FGSFLSHKEK	0.98607	-1.9872	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	717.65	0	0	0	0	0	0	635.58	0	0	0	0	2708.3	0	0	0	0	0	0	0	0	591.85	0	0	0	0	0	0	0
F7D843	F7D843_HORSE	RNA helicase (EC 3.6.4.13)	DHX8	Equus caballus (Horse)	spliceosomal complex disassembly [GO:0000390]	catalytic step 2 spliceosome [GO:0071013]	ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724]	HWVDPLPDAEGRQIAANMR	0.95031	0.23755	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	841.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D930	F7D930_HORSE	Tetratricopeptide repeat domain 13	TTC13	Equus caballus (Horse)				GIAYGKKGLHILSPLGR	0.9119	0.31653	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	606.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D9A5	F7D9A5_HORSE	Olfactory receptor family 10 subfamily D member 3	OR10D3	Equus caballus (Horse)	detection of chemical stimulus involved in sensory perception of smell [GO:0050911]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	ITISILSIRSTEGR	0.93134	0.26361	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	803.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7D9I5	F7D9I5_HORSE	Epoxide hydrolase (EC 3.3.2.9)	EPHX1	Equus caballus (Horse)	arachidonic acid metabolic process [GO:0019369]; aromatic compound catabolic process [GO:0019439]; epoxide metabolic process [GO:0097176]; response to toxic substance [GO:0009636]	endoplasmic reticulum membrane [GO:0005789]	cis-stilbene-oxide hydrolase activity [GO:0033961]; epoxide hydrolase activity [GO:0004301]	LTPPLEDSR	0.97168	0.12351	0	0	0	0	0	0	0	0	0	525.57	0	0	0	0	0	0	0	0	0	0	0	0	1287.7	1242.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1158.4	0	0	0	0	0	0	847.98	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DA11	F7DA11_HORSE	Beta-crystallin B1 (Beta-B1 crystallin)	CRYBB1	Equus caballus (Horse)	lens development in camera-type eye [GO:0002088]; visual perception [GO:0007601]		structural constituent of eye lens [GO:0005212]	DRQWHHK	0.98845	-1.7928	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	438.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DC07	F7DC07_HORSE	Leucine rich repeats and IQ motif containing 1	LRRIQ1	Equus caballus (Horse)				ITNTRPSK	0.97892	-0.29548	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3286.2	0	418.95	0	786.94	0	601.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	411.38	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DD93	F7DD93_HORSE	"phosphatidylinositol-4,5-bisphosphate 3-kinase (EC 2.7.1.153)"	PIK3CG	Equus caballus (Horse)	cellular response to cAMP [GO:0071320]; negative regulation of fibroblast apoptotic process [GO:2000270]; phosphatidylinositol 3-kinase/protein kinase B signal transduction [GO:0043491]; phosphatidylinositol-3-phosphate biosynthetic process [GO:0036092]; phosphatidylinositol-mediated signaling [GO:0048015]; phosphorylation [GO:0016310]; positive regulation of endothelial cell migration [GO:0010595]; positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [GO:0051897]; positive regulation of Rac protein signal transduction [GO:0035022]; regulation of angiogenesis [GO:0045765]; regulation of calcium ion transmembrane transport [GO:1903169]; regulation of protein phosphorylation [GO:0001932]; sphingosine-1-phosphate receptor signaling pathway [GO:0003376]	"cytoplasm [GO:0005737]; cytosol [GO:0005829]; phosphatidylinositol 3-kinase complex, class IA [GO:0005943]; phosphatidylinositol 3-kinase complex, class IB [GO:0005944]; plasma membrane [GO:0005886]"	"1-phosphatidylinositol-3-kinase activity [GO:0016303]; 1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity [GO:0046934]; 1-phosphatidylinositol-4-phosphate 3-kinase activity [GO:0035005]; ATP binding [GO:0005524]; ephrin receptor binding [GO:0046875]; identical protein binding [GO:0042802]; protein serine kinase activity [GO:0106310]"	APALSGK	0.986	-1.3306	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	691.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DDY0	F7DDY0_HORSE	Chromosome 7 C19orf38 homolog	C7H19orf38	Equus caballus (Horse)		membrane [GO:0016020]		VTFNLSGSSR	0.96836	-0.035668	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	699.56	601.14	624.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DE18	F7DE18_HORSE	Coiled-coil domain-containing protein 80	CCDC80	Equus caballus (Horse)	extracellular matrix organization [GO:0030198]; positive regulation of cell-substrate adhesion [GO:0010811]	basement membrane [GO:0005604]		LEKPEKEK	0.9875	-1.7275	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5378.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DF61	F7DF61_HORSE	Kinesin family member 11	KIF11	Equus caballus (Horse)	cell division [GO:0051301]; microtubule-based movement [GO:0007018]; mitotic spindle assembly [GO:0090307]; spindle elongation [GO:0051231]	mitotic spindle [GO:0072686]; nucleus [GO:0005634]; spindle microtubule [GO:0005876]; spindle pole [GO:0000922]	ATP binding [GO:0005524]; microtubule binding [GO:0008017]; plus-end-directed microtubule motor activity [GO:0008574]	AMLEVHK	0.98498	-1.4784	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	323.77	0	0	0	0	0	0	0
F7DFK2	F7DFK2_HORSE	ER membrane associated RNA degradation	ERMARD	Equus caballus (Horse)				MKLTLCLER	0.99029	-1.2521	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	511.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DGP4	F7DGP4_HORSE	Rho GTPase activating protein 45	ARHGAP45	Equus caballus (Horse)	signal transduction [GO:0007165]	cytosol [GO:0005829]; membrane [GO:0016020]; plasma membrane [GO:0005886]	GTPase activator activity [GO:0005096]; metal ion binding [GO:0046872]	CLETLAIQCGHK	0.96964	0.034384	0	0	0	0	0	0	0	0	0	0	0	0	0	314.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DGS2	F7DGS2_HORSE	Katanin interacting protein	KATNIP	Equus caballus (Horse)				LPQHGLMSGQTLRKAER	0.99237	-1.2312	0	0	0	0	0	0	0	0	0	0	0	0	0	595.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DH45	F7DH45_HORSE	Muscleblind like splicing regulator 3	MBNL3	Equus caballus (Horse)			GTP binding [GO:0005525]; GTPase activity [GO:0003924]; metal ion binding [GO:0046872]	ADADCKFAHPPR	0.97876	-0.39964	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	349.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DHB6	F7DHB6_HORSE	RNA helicase (EC 3.6.4.13)	DHX37	Equus caballus (Horse)	"maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000462]"	nucleolus [GO:0005730]	ATP binding [GO:0005524]; helicase activity [GO:0004386]; RNA binding [GO:0003723]	LGMGHRMYQTR	0.98929	-1.2632	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	689.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DHI5	F7DHI5_HORSE	Interleukin 20 receptor subunit alpha	IL20RA	Equus caballus (Horse)	cytokine-mediated signaling pathway [GO:0019221]; positive regulation of intrinsic apoptotic signaling pathway [GO:2001244]; regulation of bone resorption [GO:0045124]	membrane [GO:0016020]	cytokine receptor activity [GO:0004896]; interleukin-20 binding [GO:0042015]	WLSKSECR	0.98834	-1.7409	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	365.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DHR4	F7DHR4_HORSE	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (EC 4.2.1.134)	HACD1	Equus caballus (Horse)	fatty acid biosynthetic process [GO:0006633]	endoplasmic reticulum membrane [GO:0005789]	very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase activity [GO:0102158]	GRLTEAAAAGGGASAAR	0.98132	-0.26379	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	702.44	0	0	0	0	0	0	730.22	0	0	0	393.9	0	0	0	0	0	0	0	0	0	0	0
F7DHV1	F7DHV1_HORSE	Microtubule associated protein 10	MAP10	Equus caballus (Horse)	cytoplasmic microtubule organization [GO:0031122]; mitotic spindle midzone assembly [GO:0051256]; positive regulation of cytokinesis [GO:0032467]; regulation of microtubule-based process [GO:0032886]	centrosome [GO:0005813]; cytoplasmic microtubule [GO:0005881]; midbody [GO:0030496]; mitotic spindle midzone [GO:1990023]; mitotic spindle pole [GO:0097431]	microtubule binding [GO:0008017]	KSVSLQCKK	0.97355	0.1396	0	0	0	479.37	0	597.26	0	565.36	0	1443.6	1587.6	1728.7	0	0	0	0	1398.7	0	0	0	0	0	1049	0	0	561.69	0	0	0	0	0	0	0	1639.2	0	0	0	0	0	0	0	0	0	0	0	0	823.39	0	0	0	0	0	0	0	740.59	0	0	0	0	0	0	851.72	854.16	0	0	0	0	625.41	0	0	0	0	0	0	0
F7DIE1	F7DIE1_HORSE	Uncharacterized protein		Equus caballus (Horse)				VIPEPGQQK	0.9663	-0.096156	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	717.15	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DIS5	F7DIS5_HORSE	Pleckstrin homology and RhoGEF domain containing G4B	PLEKHG4B	Equus caballus (Horse)			guanyl-nucleotide exchange factor activity [GO:0005085]	AEWERPR	0.98693	-1.8311	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1746.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DJ35	F7DJ35_HORSE	Acid sensing ion channel subunit family member 4	ASIC4	Equus caballus (Horse)	behavioral fear response [GO:0001662]	membrane [GO:0016020]	sodium channel activity [GO:0005272]	VQEVDQLSR	0.97423	0.11313	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2436.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DJ78	F7DJ78_HORSE	Peptidase S1 domain-containing protein	LOC100147321	Equus caballus (Horse)	germ cell development [GO:0007281]; proteolysis [GO:0006508]; spermatogenesis [GO:0007283]	extracellular space [GO:0005615]	serine-type endopeptidase activity [GO:0004252]	LGSNTLHDDSR	0.88642	0.4185	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	399.93	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DM90	F7DM90_HORSE	Potassium two pore domain channel subfamily K member 4	KCNK4	Equus caballus (Horse)	cellular response to fatty acid [GO:0071398]; cellular response to mechanical stimulus [GO:0071260]; detection of mechanical stimulus involved in sensory perception of touch [GO:0050976]; potassium ion transmembrane transport [GO:0071805]; sensory perception of pain [GO:0019233]; sensory perception of temperature stimulus [GO:0050951]; stabilization of membrane potential [GO:0030322]	plasma membrane [GO:0005886]; potassium channel complex [GO:0034705]	mechanosensitived potassium channel activity [GO:0098782]; outward rectifier potassium channel activity [GO:0015271]; potassium ion leak channel activity [GO:0022841]	APGRAMR	0.98956	-1.1215	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1122.1	1169.7	0	0	0	0	0	0	0	0	0	0	0	1428.9	789.09	723.51	0	0	1524.2	1239.9	0	474.57	405.25	1149	1148.3	1176.3	0	0	0	753.15	0	1156.7	0	0	0	0	0	0	0	0	0	0	1018.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DMA1	F7DMA1_HORSE	Carboxypeptidase M	CPM	Equus caballus (Horse)	peptide metabolic process [GO:0006518]; protein processing [GO:0016485]	extracellular space [GO:0005615]	metallocarboxypeptidase activity [GO:0004181]; zinc ion binding [GO:0008270]	GRNLWVLVVGR	0.98949	-1.6789	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	588.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3481.1	0	0	0	0	0	0	0	0	0	0	0	0	0	2775.4	0	0	0	0	0	0	0	0
F7DNJ0	F7DNJ0_HORSE	RNA-directed DNA polymerase (EC 2.7.7.49)		Equus caballus (Horse)				EIADSMR	0.90894	0.29869	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1562.9	0	0	0	1663.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1119.2	0
F7DNX0	F7DNX0_HORSE	Pleckstrin homology and RhoGEF domain containing G7	PLEKHG7	Equus caballus (Horse)	intracellular signal transduction [GO:0035556]		guanyl-nucleotide exchange factor activity [GO:0005085]	DLQMFSRGQNK	0.9712	0.2043	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	748.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DP35	F7DP35_HORSE	"Calcium-activated potassium channel subunit beta (BKbeta) (BK channel subunit beta) (Calcium-activated potassium channel, subfamily M subunit beta) (Charybdotoxin receptor subunit beta) (K(VCA)beta) (Maxi K channel subunit beta) (Slo-beta)"	KCNMB3	Equus caballus (Horse)	detection of calcium ion [GO:0005513]	voltage-gated potassium channel complex [GO:0008076]	calcium-activated potassium channel activity [GO:0015269]; potassium channel regulator activity [GO:0015459]	QTLTVSDEHK	0.96467	-0.13759	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2812.3	0	0	0
F7DQ73	F7DQ73_HORSE	THUMP domain containing 2	THUMPD2	Equus caballus (Horse)	tRNA methylation [GO:0030488]		RNA binding [GO:0003723]; tRNA (guanine) methyltransferase activity [GO:0016423]	SILQEMER	0.96655	0.01326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	961.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DR20	F7DR20_HORSE	Retrotransposon Gag like 6	RTL6	Equus caballus (Horse)				NNYQGFLAELR	0.98641	-1.5016	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	425.41	0	1621.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DS15	F7DS15_HORSE	Sulfotransferase (EC 2.8.2.-)	SULT2B1	Equus caballus (Horse)			sulfotransferase activity [GO:0008146]	GEVQFGSWFDHIK	0.98435	-1.2863	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	715.24	0	0	0	0	0	0	1313.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DS88	F7DS88_HORSE	Syntaxin 2	STX2	Equus caballus (Horse)	exocytosis [GO:0006887]; intracellular protein transport [GO:0006886]; synaptic vesicle fusion to presynaptic active zone membrane [GO:0031629]; vesicle docking [GO:0048278]	endomembrane system [GO:0012505]; plasma membrane [GO:0005886]; presynaptic active zone membrane [GO:0048787]; SNARE complex [GO:0031201]; synaptic vesicle [GO:0008021]	SNAP receptor activity [GO:0005484]; SNARE binding [GO:0000149]	LKSIEQSFDQDEGGHRTSVDLR	0.7082	0.6232	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	842.05	820.68	0	0	0	0	0	0	0	0	0	0	0	0	591.12	0	0	0	0	0	0	0	0	0
F7DSF7	F7DSF7_HORSE	Neudesin neurotrophic factor	NENF	Equus caballus (Horse)	MAPK cascade [GO:0000165]; negative regulation of appetite [GO:0032099]; positive regulation of MAPK cascade [GO:0043410]	endomembrane system [GO:0012505]; endoplasmic reticulum [GO:0005783]; extracellular space [GO:0005615]; membrane [GO:0016020]; mitochondrion [GO:0005739]	growth factor activity [GO:0008083]	LFTEEELAR	0.96981	-0.067999	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	568.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DSH3	F7DSH3_HORSE	Cytokine dependent hematopoietic cell linker	CLNK	Equus caballus (Horse)				ESEYADTRYFK	0.67273	0.60924	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	500.68	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DSZ5	F7DSZ5_HORSE	Extracellular sulfatase (EC 3.1.6.-)	SULF2	Equus caballus (Horse)	bone development [GO:0060348]; chondrocyte development [GO:0002063]; embryonic skeletal system development [GO:0048706]; esophagus smooth muscle contraction [GO:0014846]; glial cell-derived neurotrophic factor receptor signaling pathway [GO:0035860]; glomerular basement membrane development [GO:0032836]; glomerular filtration [GO:0003094]; heparan sulfate proteoglycan metabolic process [GO:0030201]; innervation [GO:0060384]; liver regeneration [GO:0097421]; negative regulation of fibroblast growth factor receptor signaling pathway [GO:0040037]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of vascular endothelial growth factor production [GO:0010575]; regulation of hepatocyte proliferation [GO:2000345]; response to wounding [GO:0009611]	cell surface [GO:0009986]; endoplasmic reticulum [GO:0005783]; extracellular space [GO:0005615]; Golgi stack [GO:0005795]; plasma membrane [GO:0005886]	arylsulfatase activity [GO:0004065]; calcium ion binding [GO:0005509]; N-acetylglucosamine-6-sulfatase activity [GO:0008449]	VTGIFFKSQGK	0.98786	-1.7781	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	568.6	674.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DT41	F7DT41_HORSE	Sodium channel protein	SCN7A	Equus caballus (Horse)	cellular homeostasis [GO:0019725]; membrane depolarization during action potential [GO:0086010]; neuronal action potential [GO:0019228]; response to bacterium [GO:0009617]; sodium ion homeostasis [GO:0055078]; sodium ion transmembrane transport [GO:0035725]	axon [GO:0030424]; glial cell projection [GO:0097386]; voltage-gated sodium channel complex [GO:0001518]	voltage-gated sodium channel activity [GO:0005248]	KQHHALKR	0.96732	-0.09888	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	880.78	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DT94	F7DT94_HORSE	Rhotekin 2	RTKN2	Equus caballus (Horse)	hemopoiesis [GO:0030097]; positive regulation of cell population proliferation [GO:0008284]; signal transduction [GO:0007165]			LESLTDIIQK	0.98348	-0.24826	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1596.3	0	0	0	0	0	0	0	0	0	0	0	0	579.42	0	0
F7DTT1	F7DTT1_HORSE	CDK5 regulatory subunit-associated protein 2	CDK5RAP2	Equus caballus (Horse)	brain development [GO:0007420]; centriole replication [GO:0007099]; chromosome segregation [GO:0007059]; establishment of mitotic spindle orientation [GO:0000132]; microtubule bundle formation [GO:0001578]; negative regulation of centriole replication [GO:0046600]; negative regulation of neuron differentiation [GO:0045665]; neurogenesis [GO:0022008]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of microtubule polymerization [GO:0031116]; regulation of mitotic cell cycle spindle assembly checkpoint [GO:0090266]	cell junction [GO:0030054]; cytosol [GO:0005829]; gamma-tubulin ring complex [GO:0000931]; Golgi apparatus [GO:0005794]; microtubule plus-end [GO:0035371]; mitotic spindle pole [GO:0097431]; pericentriolar material [GO:0000242]; perinuclear region of cytoplasm [GO:0048471]	calmodulin binding [GO:0005516]; gamma-tubulin binding [GO:0043015]; microtubule binding [GO:0008017]; protein kinase binding [GO:0019901]; transcription cis-regulatory region binding [GO:0000976]	IMEDHSKGGCKNGYLR	0.98536	-0.85513	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1245.6	0	971.46	0	1027.3	0	1208.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	687.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DUF7	F7DUF7_HORSE	"RAB33A, member RAS onco family"	RAB33A	Equus caballus (Horse)	antigen processing and presentation [GO:0019882]; Rab protein signal transduction [GO:0032482]	endosome [GO:0005768]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]	QQGKVQKLEFPQEANSK	0.64685	0.64745	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	951.95	885.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DUP4	F7DUP4_HORSE	Zinc finger imprinted 2	ZIM2	Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	SWFSQAGTSGPRGR	0.98437	-0.78226	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3277.3	3094.7	0	0	0	0	0	0	0	0	2378.1	1603.2	1543.8	0	0	0	0	0	0	0	2142.9	0	0	0	0	0	0	0	514.65	0	0	1163.6	0	0	0	0	0	0
F7DUZ6	F7DUZ6_HORSE	Signal peptidase complex subunit 3	SPCS3	Equus caballus (Horse)	protein targeting to ER [GO:0045047]; signal peptide processing [GO:0006465]; viral protein processing [GO:0019082]	signal peptidase complex [GO:0005787]		SVPVRLHVSR	0.98665	-1.9119	0	0	0	0	0	0	0	0	0	0	1168.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	675.68	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DVU6	F7DVU6_HORSE	Olfactory receptor	OR6B13	Equus caballus (Horse)	detection of chemical stimulus involved in sensory perception of smell [GO:0050911]	plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	AAQALSASS	0.96293	-0.13246	0	0	0	0	0	0	911.39	0	0	0	0	1353.5	0	0	816.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	974.08	0	0	0	0	0	651.64	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1620.5	0	0	0	0
F7DWQ2	F7DWQ2_HORSE	Rho family GTPase 2	RND2	Equus caballus (Horse)	actin filament organization [GO:0007015]; cell migration [GO:0016477]; signal transduction [GO:0007165]; small GTPase mediated signal transduction [GO:0007264]	cytosol [GO:0005829]; plasma membrane [GO:0005886]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]; protein kinase binding [GO:0019901]	GPGGGLR	0.93559	0.24981	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1323.2	949.37	888.02	2454.9	2366.6	2608.6	1936.1	1455.8	0	0	0	0	0	645.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	844.67	1126	1089.1	1031	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DWS3	F7DWS3_HORSE	RNA-directed DNA polymerase (EC 2.7.7.49)		Equus caballus (Horse)			catalytic activity [GO:0003824]	EDLIPILFKLFQK	0.97069	-0.029017	0	0	0	0	0	0	0	0	0	0	0	0	0	561.27	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	599.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	656.71	0	0	0	0	0	0	0	0	674.67	793.58	0	0	0	0	0	0	0	0	0	0	1034.4	0
F7DXU3	F7DXU3_HORSE	DNA polymerase (EC 2.7.7.7)	POLD1	Equus caballus (Horse)	DNA repair [GO:0006281]; DNA replication [GO:0006260]	nuclear lumen [GO:0031981]	"4 iron, 4 sulfur cluster binding [GO:0051539]; DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]"	GVAAYMK	0.98605	-2.5117	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	596.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7DY73	F7DY73_HORSE	Upstream binding transcription factor	UBTF	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	EKLMWIKK	0.9681	-0.04624	0	0	0	455.53	0	1500.4	2227	2075.2	1893.6	0	2731.7	0	0	0	0	0	0	0	1710.4	0	0	0	0	1756.6	0	1387.7	1245.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1309.5	1343.3	0	0	0	0	0	0	1162.2	0	0	0	0	0	0	900.01	830.3	868.07	1473.8	0	1434.2	0	0	0	0	0	0
F7E030	F7E030_HORSE	Cell cycle associated protein 1	CAPRIN1	Equus caballus (Horse)	cell differentiation [GO:0030154]; negative regulation of translation [GO:0017148]	cytoplasm [GO:0005737]	RNA binding [GO:0003723]	GPANGFR	0.98524	-1.4706	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	611.86	0	0	0	0	0	0
F7E0I5	F7E0I5_HORSE	Crossover junction endonuclease MUS81 (EC 3.1.22.-)	MUS81	Equus caballus (Horse)	DNA catabolic process [GO:0006308]; double-strand break repair via break-induced replication [GO:0000727]; mitotic intra-S DNA damage checkpoint signaling [GO:0031573]; resolution of meiotic recombination intermediates [GO:0000712]	Holliday junction resolvase complex [GO:0048476]; nucleus [GO:0005634]	3'-flap endonuclease activity [GO:0048257]; crossover junction DNA endonuclease activity [GO:0008821]; DNA binding [GO:0003677]; metal ion binding [GO:0046872]	YSTPASLLAAYDTCATPK	0.88027	0.42482	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	585.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7E1F0	F7E1F0_HORSE	Poly [ADP-ribose] polymerase (PARP) (EC 2.4.2.-)	PARP10A LOC102150439	Equus caballus (Horse)	negative regulation of gene expression [GO:0010629]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	NAD+ ADP-ribosyltransferase activity [GO:0003950]; NAD+-protein ADP-ribosyltransferase activity [GO:1990404]; transcription corepressor activity [GO:0003714]	LEQRCERR	0.96903	0.19978	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	494.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7E1J5	F7E1J5_HORSE	ShKT domain-containing protein	LOC100629418	Equus caballus (Horse)		extracellular space [GO:0005615]		NAEKWAK	0.98924	-1.6947	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	817.55	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7E208	F7E208_HORSE	Versican	VCAN	Equus caballus (Horse)	cell adhesion [GO:0007155]	extracellular region [GO:0005576]	calcium ion binding [GO:0005509]; carbohydrate binding [GO:0030246]; hyaluronic acid binding [GO:0005540]	LVTSSER	0.98777	-1.726	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	711.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1413.4	0	0	0	0	0	616.47	0
F7E252	F7E252_HORSE	Gastrulation brain homeobox 2	GBX2	Equus caballus (Horse)	autonomic nervous system development [GO:0048483]; axon guidance [GO:0007411]; branching involved in blood vessel morphogenesis [GO:0001569]; cerebellar granule cell precursor proliferation [GO:0021930]; cerebellum development [GO:0021549]; forebrain neuron development [GO:0021884]; inner ear morphogenesis [GO:0042472]; midbrain-hindbrain boundary morphogenesis [GO:0021555]; neural crest cell migration [GO:0001755]; regulation of nervous system development [GO:0051960]; regulation of transcription by RNA polymerase II [GO:0006357]; rhombomere 2 development [GO:0021568]; thalamus development [GO:0021794]	nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II core promoter sequence-specific DNA binding [GO:0000979]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]"	TAFTSEQLLELEKEFHCK	0.93383	0.26805	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1719.4	0	1261.9	1295.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7E2W2	F7E2W2_HORSE	Cell division cycle associated 5	CDCA5	Equus caballus (Horse)	cell cycle [GO:0007049]; cell division [GO:0051301]	chromosome [GO:0005694]; nucleus [GO:0005634]		KNRSFFFK	0.96461	0.18726	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	919.51	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7E3Y7	F7E3Y7_HORSE	Heat shock protein family B (small) member 1	HSPB1	Equus caballus (Horse)	negative regulation of apoptotic process [GO:0043066]; protein refolding [GO:0042026]; response to heat [GO:0009408]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	unfolded protein binding [GO:0051082]	QLSSGVSEIR	0.97172	-0.063368	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	712.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F7E4F4	F7E4F4_HORSE	Sulfotransferase (EC 2.8.2.-)	LOC100052993	Equus caballus (Horse)	sulfation [GO:0051923]	cytoplasm [GO:0005737]	sulfotransferase activity [GO:0008146]	EYFEWFIK	0.988	-1.5492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	482.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	771.57	0	0	0	0
F7E4K4	F7E4K4_HORSE	Dynein axonemal heavy chain 11	DNAH11	Equus caballus (Horse)	microtubule-based movement [GO:0007018]	axoneme [GO:0005930]; dynein complex [GO:0030286]; microtubule [GO:0005874]; motile cilium [GO:0031514]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; dynein intermediate chain binding [GO:0045505]; dynein light intermediate chain binding [GO:0051959]; minus-end-directed microtubule motor activity [GO:0008569]	DRSWKAAK	0.98577	-2.9877	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	508.7	0	0	0	0	0	0	0	0	0	0	0	0	0	524.19	0	0	487.55	0	0	0	0	0	364.65	0	0	0	0	0	0	0	3180.1	415.63	0	799.34	0	0	0	0	0	0	0	0	0	0	0	0
G8GV94	G8GV94_HORSE	Androgen receptor	AR	Equus caballus (Horse)	androgen receptor signaling pathway [GO:0030521]	nucleus [GO:0005634]	DNA binding [GO:0003677]; nuclear receptor activity [GO:0004879]; steroid binding [GO:0005496]	EVIQNPGPR	0.96405	-0.11574	0	0	0	0	0	0	0	0	514.88	0	0	0	0	595.85	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1838.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
H9GZM7	H9GZM7_HORSE	"FYVE, RhoGEF and PH domain containing 1"	FGD1	Equus caballus (Horse)	cytoskeleton organization [GO:0007010]; filopodium assembly [GO:0046847]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	guanyl-nucleotide exchange factor activity [GO:0005085]; metal ion binding [GO:0046872]	NGTTQDR	0.98818	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1198.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
H9GZN9	H9GZN9_HORSE	Immunoglobulin heavy constant mu	IGHM	Equus caballus (Horse)				DAFTGPGQR	0	14.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	619.7	670.07	0	0	0	0	0	0	0	0	0	652.5	0	0	362.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	722.18	1447.1	564.24	671.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	925.22	473.12	0	0	0	0	0	0	0
H9GZQ9	H9GZQ9_HORSE	Immunoglobulin heavy constant mu	IGHM	Equus caballus (Horse)		membrane [GO:0016020]		ALPAPVER	0	90.88	0	491.87	0	0	0	0	0	0	0	0	0	0	0	0	0	1166.8	515.7	0	0	0	0	0	0	0	0	0	0	962.83	1471.5	938.68	0	0	0	0	0	0	0	0	0	1155.1	0	562.68	0	0	0	0	0	0	0	0	0	4095.8	8101.7	7556.4	0	0	0	1466.6	1100.2	1106.9	0	997.1	1025.3	0	0	0	441.74	387.23	0	0	0	0	0	0	0
H9GZT5	H9GZT5_HORSE	Ig-like domain-containing protein		Equus caballus (Horse)	"antibacterial humoral response [GO:0019731]; complement activation, classical pathway [GO:0006958]"	"immunoglobulin complex, circulating [GO:0042571]; membrane [GO:0016020]"	antigen binding [GO:0003823]; immunoglobulin receptor binding [GO:0034987]	DVLMISR	0	69.976	583.53	0	0	0	0	0	1479.5	0	1574.3	0	1053.3	847.26	1686.8	1280.9	1324.4	8126.5	8141	8186.3	0	1378.7	1260.6	0	0	0	0	0	0	3385.1	3549.7	3607.5	309.43	1672.3	1828	3075.4	572.74	3278.6	0	1824.4	1658.5	4399.5	3309.5	1034	567	0	487.83	418.56	769.38	933.91	432.23	1806.3	1149.8	2224.3	5089.5	4402.5	1573.5	1446.4	1480.1	3328.6	4603.8	6389.6	0	560.04	0	368	338.68	496.62	1742.3	938.85	1500	0	452.91	0	552.15	511.28	596.8
H9GZT8	H9GZT8_HORSE	Vasoactive intestinal peptide receptor 2	VIPR2	Equus caballus (Horse)	cell surface receptor signaling pathway [GO:0007166]	plasma membrane [GO:0005886]	vasoactive intestinal polypeptide receptor activity [GO:0004999]	LTSPDVGGNDQSQYKR	0.67857	0.60561	0	0	457.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
H9GZW6	H9GZW6_HORSE	THAP domain containing 2	THAP2	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	FPLDPKRR	0.9302	0.27504	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	671.86	529.89	0	0	0	0	0	0	0	0	0	0	0	0	0	589.71	532.37	0
H9H002	H9H002_HORSE	RAN binding protein 1	RANBP1	Equus caballus (Horse)	nucleocytoplasmic transport [GO:0006913]			TLEEDEEELFKMRAK	0.88154	0.38626	0	0	0	0	0	0	0	0	0	0	0	0	0	537.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1140.1	1079.9	972.93	0	0	776.4	1057.4	750.38	0	0	0	763.06	531.39	577.46	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1091.5	0	0	0	651.27	659.54	591.61	758.42	0	711.14	0	0	0	987.76	0	0
H9H028	H9H028_HORSE	Ribosome biogenesis protein NOP53	NOP53	Equus caballus (Horse)	ribosome biogenesis [GO:0042254]	nucleolus [GO:0005730]; nucleoplasm [GO:0005654]		GIKVQVAR	0.98729	-4.0435	0	0	12237	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
H9H035	H9H035_HORSE	PTPRF interacting protein alpha 1	PPFIA1	Equus caballus (Horse)	synapse organization [GO:0050808]	cytoplasm [GO:0005737]; presynaptic active zone [GO:0048786]		AELDQARLR	0.98663	-2.4242	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2699.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	526.06	0	0	0	0	0	0	0	0	1455.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K241	K9K241_HORSE	Gamma-glutamylcyclotransferase (EC 4.3.2.7)		Equus caballus (Horse)	glutathione catabolic process [GO:0006751]		gamma-glutamylcyclotransferase activity [GO:0003839]; glutathione specific gamma-glutamylcyclotransferase activity [GO:0061928]	KQNLSCL	0.98326	-0.72258	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	360.87	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K261	K9K261_HORSE	Mitochondrial inner membrane protease subunit (EC 3.4.21.-)		Equus caballus (Horse)	protein processing involved in protein targeting to mitochondrion [GO:0006627]; signal peptide processing [GO:0006465]	mitochondrial inner membrane peptidase complex [GO:0042720]	serine-type endopeptidase activity [GO:0004252]	NRYVKVPR	0.96753	-0.049672	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	647.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K2G3	K9K2G3_HORSE	Heterogeneous nuclear ribonucleoprotein-like protein		Equus caballus (Horse)		nucleoplasm [GO:0005654]; ribonucleoprotein complex [GO:1990904]	RNA binding [GO:0003723]	ALGKHKER	0.96043	-0.010438	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	571.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K2J0	K9K2J0_HORSE	DnaJ homolog subfamily C member 2 (Zuotin-related factor 1)		Equus caballus (Horse)	'de novo' cotranslational protein folding [GO:0051083]; regulation of translational fidelity [GO:0006450]	cytosol [GO:0005829]	Hsp70 protein binding [GO:0030544]; ribosome binding [GO:0043022]	DNFFEVFSPVFERNSRWSNK	0.89662	0.33492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	728.58	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	675.64	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K2L4	K9K2L4_HORSE	Tumor susceptibility 101 protein-like protein		Equus caballus (Horse)	protein modification process [GO:0036211]; protein transport [GO:0015031]	endosome [GO:0005768]		TGTIPVPYR	0.36275	0.75343	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	694.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K2R8	K9K2R8_HORSE	U3 small nucleolar ribonucleoprotein protein MPP10-like protein		Equus caballus (Horse)	rRNA processing [GO:0006364]	Mpp10 complex [GO:0034457]; sno(s)RNA-containing ribonucleoprotein complex [GO:0005732]		DQAWDDVVRK	0.98349	-0.8064	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	647.31	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K2T7	K9K2T7_HORSE	Ribokinase-like protein		Equus caballus (Horse)	nucleoside phosphate metabolic process [GO:0006753]; phosphorylation [GO:0016310]		kinase activity [GO:0016301]	AALVLVER	0.98154	-0.54859	15161	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	331.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13730	0	0	0	0	0	0	0	0	0	0	0	433.11	0	0	0	0	0	0
K9K351	K9K351_HORSE	Elongation factor 1-gamma (eEF-1B gamma)		Equus caballus (Horse)			translation elongation factor activity [GO:0003746]	TRTFLVGER	0.13592	1.1734	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	806.53	0	375.6	0	0	0	0	0	0	0	349.23	0	1423.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1334	0	0	0
K9K356	K9K356_HORSE	FAM200A-like protein		Equus caballus (Horse)		membrane [GO:0016020]		KEIYVFLIEK	0.98473	-0.84024	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1133.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1168	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K3H4	K9K3H4_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)		Equus caballus (Horse)	phosphorylation [GO:0016310]; Rho protein signal transduction [GO:0007266]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]; small GTPase binding [GO:0031267]	LEETNSMLTK	0.65753	0.63951	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	630.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K3K0	K9K3K0_HORSE	Golgin-45-like protein		Equus caballus (Horse)	Golgi organization [GO:0007030]; Golgi to plasma membrane protein transport [GO:0043001]	intracellular membrane-bounded organelle [GO:0043231]		VTLTSTPIR	0.96361	-0.12427	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2583.2
K9K3K2	K9K3K2_HORSE	DNA/RNA-binding protein KIN17-like protein		Equus caballus (Horse)				KLGEKYHK	0.98154	-0.22107	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	505.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K3Y4	K9K3Y4_HORSE	Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)		Equus caballus (Horse)	GMP biosynthetic process [GO:0006177]		IMP dehydrogenase activity [GO:0003938]; metal ion binding [GO:0046872]	VSEYARR	0.98372	-0.69963	0	0	0	0	0	0	0	0	743.95	0	0	0	0	766.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	956.11	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	739.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K405	K9K405_HORSE	Hydroxyacyl-thioester dehydratase type 2	LOC111768318	Equus caballus (Horse)	fatty acid biosynthetic process [GO:0006633]	mitochondrion [GO:0005739]; nucleolus [GO:0005730]	(3R)-hydroxyacyl-[acyl-carrier-protein] dehydratase activity [GO:0019171]	AELSRAFTQR	0.95676	0.22356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	381.1	797.48	0	0	0	0	0	0	0	0	0	0	467.92	0	0	0	0	0	0	0	0	0	0	0	0	0	0	373.54	0	0	0	0	0	0	0	0	0	0	806.12
K9K412	K9K412_HORSE	Putative BMP-2-inducible kinase-like protein-like protein		Equus caballus (Horse)	phosphorylation [GO:0016310]		kinase activity [GO:0016301]	QRSLQKLSSR	0.9742	-0.1901	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	375.38	0	0	444.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K454	K9K454_HORSE	Malic enzyme		Equus caballus (Horse)			malate dehydrogenase (decarboxylating) (NAD+) activity [GO:0004471]; metal ion binding [GO:0046872]; NAD binding [GO:0051287]	VTGKSISEHK	0.99143	-1.245	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	930.82	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K458	K9K458_HORSE	Ankyrin repeat family A protein 2-like protein		Equus caballus (Horse)				GYTDIVK	0.98867	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	587.5	678.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	502.25	541	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K494	K9K494_HORSE	WD repeat-containing protein 43-like protein		Equus caballus (Horse)		nucleolus [GO:0005730]		NLNLIKR	0.98376	-0.70756	0	0	0	13130	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K4B4	K9K4B4_HORSE	Cisplatin resistance-associated overexpresse protein-like protein		Equus caballus (Horse)	mRNA splice site recognition [GO:0006376]	U1 snRNP [GO:0005685]	mRNA binding [GO:0003729]	KSSVKSSSR	0.96687	-0.17001	0	0	0	0	0	657.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K4C8	K9K4C8_HORSE	Actin-related protein 8		Equus caballus (Horse)	DNA recombination [GO:0006310]; DNA repair [GO:0006281]	chromosome [GO:0005694]; nucleus [GO:0005634]	ATP binding [GO:0005524]	MADQAIWSK	0.96599	-0.084006	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1171.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K4D0	K9K4D0_HORSE	Crooked neck-like protein 1-like protein		Equus caballus (Horse)	"mRNA splicing, via spliceosome [GO:0000398]"			LLQRTQHVK	0.98695	-3.0914	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	348	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K4E4	K9K4E4_HORSE	phosphoacetylglucosamine mutase (EC 5.4.2.3) (Acetylglucosamine phosphomutase) (N-acetylglucosamine-phosphate mutase)		Equus caballus (Horse)	carbohydrate metabolic process [GO:0005975]; UDP-N-acetylglucosamine biosynthetic process [GO:0006048]		metal ion binding [GO:0046872]; phosphoacetylglucosamine mutase activity [GO:0004610]	LSTAFVELTK	0.96343	-0.0054898	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	854.07	605.07	0	0	0	0	0	0	0	0	0	0	0	0	0	406.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K4G6	K9K4G6_HORSE	Tigger transposable element-derived protein-like protein		Equus caballus (Horse)			nucleic acid binding [GO:0003676]	AAGKGTK	0.9865	-0.86442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2033.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K4I1	K9K4I1_HORSE	Zinc finger CCHC domain-containing protein-like protein		Equus caballus (Horse)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	LSLKSDVPQAK	0.98637	-1.9077	0	0	0	0	0	0	0	0	0	445.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K9B8	K9K9B8_HORSE	Cullin-3-like protein		Equus caballus (Horse)	protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511]	cullin-RING ubiquitin ligase complex [GO:0031461]	ubiquitin protein ligase binding [GO:0031625]	VEARINEEIER	0.98931	-1.2665	0	0	0	0	0	0	0	0	0	0	0	0	526.58	0	0	848.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K9F6	K9K9F6_HORSE	ATP-binding cassette sub-family E member 1-like protein		Equus caballus (Horse)			ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]	VGTNGIGK	0.93659	0.25431	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14166	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10014	9437.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K9L7	K9K9L7_HORSE	DNA replication licensing factor MCM4 (EC 3.6.4.12)		Equus caballus (Horse)	cell cycle [GO:0007049]; DNA replication initiation [GO:0006270]	chromosome [GO:0005694]; MCM complex [GO:0042555]; nucleus [GO:0005634]	ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; hydrolase activity [GO:0016787]	GQYTSGK	0.98814	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	682.53	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K9Q5	K9K9Q5_HORSE	Zinc finger protein with KRAB and SCAN domains 2-like protein		Equus caballus (Horse)				CFGRSRSLIR	0.96938	0.037589	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	723.53	0	0
K9K9S3	K9K9S3_HORSE	Cytoplasmic phosphatidylinositol transfer protein 1-like protein		Equus caballus (Horse)				ATLNLPGVHSSDKPCRPKSE	0.96047	0.21713	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19697	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K9V0	K9K9V0_HORSE	Transmembrane 9 superfamily member		Equus caballus (Horse)		membrane [GO:0016020]		FDKYLDPSFFQHR	0.98789	-1.1943	0	0	0	0	409.54	0	0	0	0	434.06	0	447.2	0	0	0	1078.2	0	0	0	0	0	0	0	0	0	0	0	0	0	857	0	0	0	0	0	0	0	0	867.77	0	575.87	0	0	0	0	514.53	0	0	0	0	678.73	0	0	0	0	0	0	631.17	662.73	0	0	0	0	0	0	0	483.47	0	0	0	0	753.26	0	0	526.7
K9K9V4	K9K9V4_HORSE	ubiquitinyl hydrolase 1 (EC 3.4.19.12)		Equus caballus (Horse)			cysteine-type deubiquitinase activity [GO:0004843]; zinc ion binding [GO:0008270]	SINDKNLK	0.98551	-1.458	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	645.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9K9Y8	K9K9Y8_HORSE	ubiquitinyl hydrolase 1 (EC 3.4.19.12)		Equus caballus (Horse)			cysteine-type deubiquitinase activity [GO:0004843]	SFLALDWDPDLKK	0.97954	-0.60128	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	335.24	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KA18	K9KA18_HORSE	Superkiller viralicidic activity 2-like 2-like protein		Equus caballus (Horse)			ATP binding [GO:0005524]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]	TVLFTNAR	0.97185	0.043835	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1143.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KA30	K9KA30_HORSE	Muscleblind-like protein 1-like protein		Equus caballus (Horse)			metal ion binding [GO:0046872]	AVSVTPIR	0.89565	0.43155	20197	9885.3	0	0	0	0	48030	50028	0	0	0	0	0	0	0	0	31769	0	0	0	0	0	0	8399.3	0	0	8379.7	0	0	0	0	0	0	0	0	0	0	1040.1	0	0	0	0	28967	0	0	0	44411	0	0	0	0	0	0	0	7378.9	0	0	0	0	0	10181	0	1141.2	0	0	13215	0	0	0	11227	0	0	0	0	0
K9KA39	K9KA39_HORSE	Protein FAM161A-like protein		Equus caballus (Horse)				KNRPLLFERVAQK	0.97227	-0.19591	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	439.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KA70	K9KA70_HORSE	"Transcription factor A, mitochondrial"		Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	EITQKTFKK	0.9629	-0.14081	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	378.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KA81	K9KA81_HORSE	Ras-like protein Rab-28-like protein		Equus caballus (Horse)			GTP binding [GO:0005525]; GTPase activity [GO:0003924]	TVKPEKHLR	0.98856	-1.7011	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	569.92	0	0	0	0	0	0	0
K9KAE7	K9KAE7_HORSE	WD repeat-containing protein 7-like protein		Equus caballus (Horse)				LPTSCLPASDSFR	0.90958	0.31502	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	786.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAF1	K9KAF1_HORSE	Signal transducer and activator of transcription 1-like protein		Equus caballus (Horse)	response to organic substance [GO:0010033]; signal transduction [GO:0007165]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	DNA binding [GO:0003677]; DNA-binding transcription factor activity [GO:0003700]	HLLSLWNDGCIVGFISK	0.83852	0.48943	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1707	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAF6	K9KAF6_HORSE	"Trifunctional enzyme subunit alpha, mitochondrial-like protein"		Equus caballus (Horse)	fatty acid metabolic process [GO:0006631]		"NAD+ binding [GO:0070403]; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [GO:0016616]"	SGKGFYIYQEGVK	0.88985	0.33283	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1159	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAG3	K9KAG3_HORSE	Peroxisomal acyl-coenzyme A oxidase 1 (Palmitoyl-CoA oxidase) (Peroxisomal fatty acyl-CoA oxidase) (Straight-chain acyl-CoA oxidase)		Equus caballus (Horse)	fatty acid beta-oxidation [GO:0006635]	peroxisome [GO:0005777]	acyl-CoA oxidase activity [GO:0003997]; FAD binding [GO:0071949]	NLQTEVFHR	0.97084	0.15573	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	640.87	0	0	0	0	0	0	0	0	0	0	0	673.16	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAG4	K9KAG4_HORSE	Serine/threonine-protein phosphatase (EC 3.1.3.16)		Equus caballus (Horse)	calcineurin-mediated signaling [GO:0097720]		calmodulin-dependent protein phosphatase activity [GO:0033192]; myosin phosphatase activity [GO:0017018]	QTIETATVEAVEAR	0.96703	-0.050314	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	501.41	466.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAG8	K9KAG8_HORSE	Protein furry-like protein-like-like protein		Equus caballus (Horse)				LAQLESILK	0.97586	0.088747	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	572.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	462.84	0	0	0	0	0	0	0	0	0
K9KAI9	K9KAI9_HORSE	Transmembrane and TPR repeat-containing protein 4-like protein		Equus caballus (Horse)		membrane [GO:0016020]		YPDCYYNLGR	0.91937	0.30819	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	447.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAP8	K9KAP8_HORSE	"Transcription factor A, mitochondrial"		Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	KKIKPTSAWNLAQK	0.91041	0.31504	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	732.12	842.36	749.67	813.06	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAR2	K9KAR2_HORSE	52 kDa repressor of the inhibitor of the protein kinase-like protein		Equus caballus (Horse)	phosphorylation [GO:0016310]		kinase activity [GO:0016301]; protein dimerization activity [GO:0046983]	VLCILPVMK	0.74155	0.54251	0	0	0	0	0	0	0	0	0	0	0	0	0	714.65	523.27	0	0	0	0	0	0	0	0	0	0	0	0	1326.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAU2	K9KAU2_HORSE	CCR4-NOT transcription complex subunit 10		Equus caballus (Horse)	regulation of translation [GO:0006417]; regulatory ncRNA-mediated gene silencing [GO:0031047]	CCR4-NOT complex [GO:0030014]; cytoplasm [GO:0005737]; nucleus [GO:0005634]		FIPAPPSSPLKK	0.98474	-0.84258	0	0	0	0	0	0	0	0	0	0	0	701.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	914.03	0	0	1107.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAV0	K9KAV0_HORSE	dynamin GTPase (EC 3.6.5.5)		Equus caballus (Horse)			GTP binding [GO:0005525]; GTPase activity [GO:0003924]	LLMHHIR	0.96359	-0.024801	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11710	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAV1	K9KAV1_HORSE	Myelin expression factor 2-like protein		Equus caballus (Horse)			RNA binding [GO:0003723]	EIDVRLDR	0.98989	-1.2615	0	639.47	0	0	553.5	0	0	0	0	897.42	0	1166.3	0	589.75	0	0	1224.4	0	0	0	0	0	0	597.07	0	0	0	0	0	0	0	0	0	0	0	0	719.28	0	0	0	0	0	0	0	0	0	0	0	0	0	0	645.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAV5	K9KAV5_HORSE	Gamma-tubulin complex component		Equus caballus (Horse)	microtubule nucleation [GO:0007020]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; microtubule organizing center [GO:0005815]; spindle pole [GO:0000922]	gamma-tubulin binding [GO:0043015]	VFSTGVAEVPPDTR	0.77895	0.50665	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1073.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAY4	K9KAY4_HORSE	DnaJ-like protein subfamily C member 9-like protein		Equus caballus (Horse)				RRAQEEAK	0.96809	-0.053978	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	730.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KAZ2	K9KAZ2_HORSE	Ubiquitin-conjugating enzyme E2 E1-like protein		Equus caballus (Horse)			ATP binding [GO:0005524]; transferase activity [GO:0016740]	ELADITLDPPPNCSAGPK	0.866	0.46103	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1092.3	0	658.02	0	0	0	771.49	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KB14	K9KB14_HORSE	Vacuolar protein sorting-associated protein VTA1-like protein-like protein		Equus caballus (Horse)	late endosome to vacuole transport via multivesicular body sorting pathway [GO:0032511]			LLTTGRE	0.9837	-0.73359	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	868.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KB30	K9KB30_HORSE	Intron-binding protein aquarius-like protein		Equus caballus (Horse)				HLIRDIINR	0.98828	-1.8905	0	0	0	0	0	0	0	0	0	907.67	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	560.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KB53	K9KB53_HORSE	WASH complex subunit 5 (WASH complex subunit strumpellin)		Equus caballus (Horse)		WASH complex [GO:0071203]		ITDPKMTCHIDQLNTWYDMK	0.95472	0.22711	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1813.3	0	0	1153.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KB60	K9KB60_HORSE	Polyprenol reductase (EC 1.3.1.22) (EC 1.3.1.94)		Equus caballus (Horse)	dolichol-linked oligosaccharide biosynthetic process [GO:0006488]; polyprenol catabolic process [GO:0016095]	endoplasmic reticulum membrane [GO:0005789]	3-oxo-5-alpha-steroid 4-dehydrogenase activity [GO:0003865]; 3-oxo-5alpha-steroid 4-dehydrogenase (NADP+) [GO:0047751]; polyprenol reductase activity [GO:0102389]	KAFLPFLF	0.98279	-0.73761	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	492.03	0	495.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KB89	K9KB89_HORSE	Progesterone-induced-blocking factor 1-like protein		Equus caballus (Horse)				LKSFESER	0.98589	-0.85113	0	0	0	0	0	0	0	0	0	591.73	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	901.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBA1	K9KBA1_HORSE	Uncharacterized protein KIAA1586-like protein		Equus caballus (Horse)				HLGSKAEK	0.98636	-3.3186	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	504.59	0	0	0	0	0	0	0
K9KBB5	K9KBB5_HORSE	"alpha-1,2-Mannosidase (EC 3.2.1.-)"		Equus caballus (Horse)	carbohydrate metabolic process [GO:0005975]; response to unfolded protein [GO:0006986]	endoplasmic reticulum [GO:0005783]; membrane [GO:0016020]	"calcium ion binding [GO:0005509]; mannosyl-oligosaccharide 1,2-alpha-mannosidase activity [GO:0004571]"	QIDQMVGLI	0.68091	0.59537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	746.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBC4	K9KBC4_HORSE	polynucleotide adenylyltransferase (EC 2.7.7.19)		Equus caballus (Horse)				YICVEEPFDGTNTAR	0.68391	0.59678	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1134.6	0	0	0	0	0	0	0
K9KBI0	K9KBI0_HORSE	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like protein		Equus caballus (Horse)	positive regulation of apoptotic process [GO:0043065]; regulation of metabolic process [GO:0019222]	membrane [GO:0016020]; mitochondrial envelope [GO:0005740]	identical protein binding [GO:0042802]	EFLFRHPK	0.98642	-1.4238	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	738.41	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBI3	K9KBI3_HORSE	NF-kappa-B-repressing factor-like protein		Equus caballus (Horse)			nucleic acid binding [GO:0003676]	QIHQIAQK	0.96796	-0.044607	0	0	0	0	0	0	0	0	824.79	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	610.71	0
K9KBJ1	K9KBJ1_HORSE	Kinesin-like protein		Equus caballus (Horse)	microtubule-based movement [GO:0007018]	microtubule [GO:0005874]	ATP binding [GO:0005524]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777]	SHAVFQIILRR	0.98589	-0.85104	0	0	0	0	612.59	611.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1204.6	0	0	0	0	0	0	0	0	0	1939.4	0	0	0	0	0	0	0	0	0	0	0	934.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBN5	K9KBN5_HORSE	Cyclin-I-like protein		Equus caballus (Horse)				LSPSQHLSVLTK	0.96784	-0.16332	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	580.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBP0	K9KBP0_HORSE	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 (tRNA(m1A58)-methyltransferase subunit TRM6)		Equus caballus (Horse)	tRNA methylation [GO:0030488]	nucleus [GO:0005634]; tRNA (m1A) methyltransferase complex [GO:0031515]	methyltransferase activity [GO:0008168]	TEEPAAK	0.93128	0.25591	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	373.26	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBQ8	K9KBQ8_HORSE	Cullin-5		Equus caballus (Horse)	protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511]	cullin-RING ubiquitin ligase complex [GO:0031461]	ubiquitin protein ligase binding [GO:0031625]	ILNAGAWSR	0.96269	-0.13246	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	819.75	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBS2	K9KBS2_HORSE	GMP synthase (Glutamine-hydrolyzing)-like protein		Equus caballus (Horse)	glutamine metabolic process [GO:0006541]		ATP binding [GO:0005524]; GMP synthase activity [GO:0003921]	IIGDTFVK	0.96366	0.0017283	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1322.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBT2	K9KBT2_HORSE	Ribosomal protein L15		Equus caballus (Horse)	translation [GO:0006412]	cytoplasm [GO:0005737]; ribosomal subunit [GO:0044391]	structural constituent of ribosome [GO:0003735]	RRNTLQLHR	0.9749	-0.19503	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	666.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBU5	K9KBU5_HORSE	Zinc finger protein 667-like protein		Equus caballus (Horse)				TLSQSLQQR	0.96072	0.21842	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1471.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBU7	K9KBU7_HORSE	Protein DEK-like protein		Equus caballus (Horse)	chromatin organization [GO:0006325]	nucleus [GO:0005634]	DNA binding [GO:0003677]	KNQNSSK	0.98329	-0.72649	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	963.13	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBV0	K9KBV0_HORSE	C2H2-type domain-containing protein		Equus caballus (Horse)				TFKGSSSLNNHQR	0.88878	0.34315	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1122.7	0	0	0	0	0	0	0	0	0	0	0	0
K9KBV7	K9KBV7_HORSE	Protein strawberry notch-like protein 1-like protein		Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]			YLCIASKVK	0.98727	-1.8597	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	290.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBW4	K9KBW4_HORSE	Male-specific lethal 1-like protein-like protein		Equus caballus (Horse)		MSL complex [GO:0072487]		GPSTHPK	0.96762	-0.041157	0	0	0	0	0	0	0	0	2909.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBX6	K9KBX6_HORSE	Transcription elongation factor		Equus caballus (Horse)	transcription elongation by RNA polymerase II [GO:0006368]	nucleus [GO:0005634]	DNA binding [GO:0003677]; translation elongation factor activity [GO:0003746]; zinc ion binding [GO:0008270]	LLDGPSTDK	0.88613	0.36887	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	354.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KBY7	K9KBY7_HORSE	Guanine nucleotide-binding protein subunit gamma		Equus caballus (Horse)	G protein-coupled receptor signaling pathway [GO:0007186]	heterotrimeric G-protein complex [GO:0005834]	G-protein beta-subunit binding [GO:0031681]	LEAGVER	0.98833	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	316.24	0	0	372.31	0	825.27	0	544.3	0	0	0	0	0	272.86	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	353.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KC03	K9KC03_HORSE	3-hydroxy-3-methylglutaryl coenzyme A reductase (HMG-CoA reductase) (EC 1.1.1.34)		Equus caballus (Horse)	coenzyme A metabolic process [GO:0015936]; isoprenoid biosynthetic process [GO:0008299]	endoplasmic reticulum membrane [GO:0005789]	hydroxymethylglutaryl-CoA reductase (NADPH) activity [GO:0004420]; NADP binding [GO:0050661]	GVSIRRQLLSTK	0.96651	-0.07974	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	536.45	0	549.61	0	0	0	310.98	0	0	0	0	0	0	338.87	0	0	0	0	0	0	0	0	776.54	0	0	0	0	0	0	0	0	0	0	501.61	546.43	0	0	0	0	0	0	0	382.35	0	0	0	0	0	0	0	0	0	0	0	0	473.83	0	0	0	0
K9KC91	K9KC91_HORSE	Alkylated DNA repair protein alkB homolog 8 (EC 2.1.1.229) (Probable alpha-ketoglutarate-dependent dioxygenase ABH8) (S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8) (tRNA (carboxymethyluridine(34)-5-O)-methyltransferase ABH8)		Equus caballus (Horse)	tRNA methylation [GO:0030488]	cytoplasm [GO:0005737]	2-oxoglutarate-dependent dioxygenase activity [GO:0016706]; RNA binding [GO:0003723]; S-adenosylmethionine-dependent methyltransferase activity [GO:0008757]; tRNA (5-carboxymethyluridine(34)-5-O)-methyltransferase activity [GO:0106335]	SLLVMTGESR	0.96847	0.21073	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	614.03	0	0	0	0	0	0	0	0	0	0	0	564.25	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KC93	K9KC93_HORSE	"Thioredoxin-dependent peroxide reductase, mitochondrial (EC 1.11.1.24) (Thioredoxin-dependent peroxiredoxin 3)"		Equus caballus (Horse)			peroxiredoxin activity [GO:0051920]	LLSDLTK	0	3.0399	852.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	730.56	746.27	1446.5	0	1379.6	0	0	0	0	0	0
K9KC98	K9KC98_HORSE	Fragile X mental retardation protein 1-like protein-like protein		Equus caballus (Horse)	regulation of translation [GO:0006417]	cytoplasmic ribonucleoprotein granule [GO:0036464]; synapse [GO:0045202]	mRNA binding [GO:0003729]	RGPGYTSGT	0.98549	-2.4584	0	0	0	0	0	0	0	879.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCA6	K9KCA6_HORSE	Macoilin (Transmembrane protein 57)		Equus caballus (Horse)	neuronal signal transduction [GO:0023041]	nuclear membrane [GO:0031965]; rough endoplasmic reticulum membrane [GO:0030867]		ADLQASRQVEQELR	0.98534	-2.0793	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	420.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCB6	K9KCB6_HORSE	Tyrosine-protein phosphatase non-receptor type 13-like protein		Equus caballus (Horse)	dephosphorylation [GO:0016311]		protein tyrosine phosphatase activity [GO:0004725]	LVRMQQLK	0.96839	-0.17616	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14485	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCB7	K9KCB7_HORSE	Exportin-1-like protein		Equus caballus (Horse)	protein export from nucleus [GO:0006611]	nucleus [GO:0005634]	nuclear export signal receptor activity [GO:0005049]	SAFPHLQDAQVK	0.96499	-0.12084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1524.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCE0	K9KCE0_HORSE	Coiled-coil domain-containing protein 46-like protein		Equus caballus (Horse)				ELESQEQITYIRQGYETK	0.93496	0.24971	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1754.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCF4	K9KCF4_HORSE	tRNA methyltransferase 10 homolog C (EC 2.1.1.218) (EC 2.1.1.221) (Mitochondrial ribonuclease P protein 1) (RNA (guanine-9-)-methyltransferase domain-containing protein 1) (mRNA methyladenosine-N(1)-methyltransferase) (tRNA (adenine(9)-N(1))-methyltransferase) (tRNA (guanine(9)-N(1))-methyltransferase)		Equus caballus (Horse)	tRNA methylation [GO:0030488]	mitochondrion [GO:0005739]	tRNA (guanosine(9)-N1)-methyltransferase activity [GO:0052905]	TFNSFPKGSLNK	0.98691	-1.911	0	0	0	0	0	0	0	0	0	0	0	503.03	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCM5	K9KCM5_HORSE	Protein BAT5-like protein		Equus caballus (Horse)				QLALFLAQK	0.96245	-0.14159	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1251.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCM6	K9KCM6_HORSE	"Twinkle protein, mitochondrial-like protein"		Equus caballus (Horse)	DNA replication [GO:0006260]		5'-3' DNA helicase activity [GO:0043139]; ATP binding [GO:0005524]; single-stranded DNA binding [GO:0003697]	LVTGPGKRYLQVSK	0.88507	0.34645	0	0	0	0	0	0	0	0	0	0	447.89	527.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	592.21	467.38	569.36	0	0	0	0	0	0	0	0	0	518.35	0	467.68	0	0	0	0	0	0
K9KCM7	K9KCM7_HORSE	Transmembrane protein 138		Equus caballus (Horse)		cilium [GO:0005929]; vacuolar membrane [GO:0005774]		KEFLQVR	0.98364	-0.72386	0	0	0	0	0	0	0	0	0	0	0	0	3377.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCP3	K9KCP3_HORSE	Bone morphoproteintic protein receptor type-2-like protein		Equus caballus (Horse)				LDPKEVDK	0.98882	-1.6934	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2489.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCQ9	K9KCQ9_HORSE	ETS-like transcription factor Elf-2-like protein		Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	DNA-binding transcription factor activity [GO:0003700]; sequence-specific DNA binding [GO:0043565]	ALTPVSIAHGTPVMR	0.97973	-0.60093	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	478.38	525.31	0
K9KCR7	K9KCR7_HORSE	Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8)		Equus caballus (Horse)			peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	IESFGSK	0.96915	-0.034015	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1505.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1642.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCS9	K9KCS9_HORSE	RNA-binding region-containing protein 3		Equus caballus (Horse)			RNA binding [GO:0003723]	LMELANLQPKRPK	0.76211	0.51526	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	709.93	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCT9	K9KCT9_HORSE	Intraflagellar transport protein 74-like protein-like protein		Equus caballus (Horse)	cilium assembly [GO:0060271]; intraciliary transport [GO:0042073]	intraciliary transport particle B [GO:0030992]; motile cilium [GO:0031514]	beta-tubulin binding [GO:0048487]	SSGEEKK	0.59011	0.64803	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	498.19	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KCZ4	K9KCZ4_HORSE	ATP-dependent RNA helicase DHX29-like protein		Equus caballus (Horse)			helicase activity [GO:0004386]	NLPKSPNPSFEK	0.98799	-1.8783	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1091.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KD28	K9KD28_HORSE	Adenosine deaminase-like protein-like protein		Equus caballus (Horse)			deaminase activity [GO:0019239]	TYVESILEGIK	0.74016	0.56651	0	0	0	0	0	0	990.77	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1209.7	1411.4	0	0	0	0	0	0	0	0	0	0	0	0	1904.9	0	0	0	0	0	2525.2	0	0	0	0	0	0
K9KD92	K9KD92_HORSE	Centrosomal protein of 120 kDa-like protein		Equus caballus (Horse)				DLLLGIAR	0.97016	-0.061583	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	139750	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	141870	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KD93	K9KD93_HORSE	Dynactin subunit 2		Equus caballus (Horse)	microtubule-based process [GO:0007017]	cytoplasm [GO:0005737]; dynactin complex [GO:0005869]; dynein complex [GO:0030286]		GAGSGGK	0.94558	0.24194	0	0	0	0	0	0	0	0	0	0	218.48	0	336.74	0	0	2774.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1079.7	286.91	0	926.54	0	0	0	0	652.71	0	0	0	0	0	0	0	0	0	0	329.95	0	927.37	0	0	0	0	0	1223.6	0	0	0	379.45	0	609.08	942.07	0	0	0	0	0	453.78	0	0	441.87	500.44
K9KDC0	K9KDC0_HORSE	Guanine nucleotide exchange factor VAV3-like protein		Equus caballus (Horse)	intracellular signal transduction [GO:0035556]		guanyl-nucleotide exchange factor activity [GO:0005085]	DLAQYVNEVK	0.98489	-0.87354	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	970.71	0	0	0	0	0	0	0	0	0	0	0	0	464.34	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	421.17	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KDD0	K9KDD0_HORSE	UPF0681 protein KIAA1033-like protein		Equus caballus (Horse)		WASH complex [GO:0071203]		LIKDIRFFR	0.97463	-0.18954	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2860.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KDD9	K9KDD9_HORSE	Ankyrin repeat and SOCS box protein 8		Equus caballus (Horse)	intracellular signal transduction [GO:0035556]; protein ubiquitination [GO:0016567]			SLGLQYLPDAVK	0.98525	-1.3114	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	834.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KDE3	K9KDE3_HORSE	"Large ribosomal subunit protein mL51 (39S ribosomal protein L51, mitochondrial)"		Equus caballus (Horse)		mitochondrion [GO:0005739]; ribosome [GO:0005840]	structural constituent of ribosome [GO:0003735]	ELIRGPRWLR	0.97452	-0.19895	0	0	0	0	721.21	765.4	0	0	0	0	0	0	0	0	0	0	1833.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KDE5	K9KDE5_HORSE	Zinc finger CCHC domain-containing protein 7 (TRAMP-like complex RNA-binding factor ZCCHC7)		Equus caballus (Horse)			nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	LPREGRR	0.96647	-0.10277	0	0	0	0	0	0	0	0	0	0	0	0	0	0	405.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1465.8	1537.2	0	0	0	0	883.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	634.37	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KDF8	K9KDF8_HORSE	Tyrosine-protein kinase BAZ1B-like protein		Equus caballus (Horse)	phosphorylation [GO:0016310]	WICH complex [GO:0090535]	histone H2AXY142 kinase activity [GO:0140801]	YPDLNPSTKRK	0.97293	-0.19256	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	954.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KDM2	K9KDM2_HORSE	Rho GTPase-activating protein 10-like-like protein		Equus caballus (Horse)	signal transduction [GO:0007165]		GTPase activator activity [GO:0005096]	IGGVNSK	0.94969	0.23881	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3722.3	0	0	0	0	0	0	0	0	0	0	0	0	2466.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2656.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KDS8	K9KDS8_HORSE	Myosin-Vc-like protein		Equus caballus (Horse)				LLEKSFELK	0.98621	-2.0062	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	769.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	782.81	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KDX2	K9KDX2_HORSE	"Lipoyltransferase 1, mitochondrial-like protein"		Equus caballus (Horse)	protein modification process [GO:0036211]		transferase activity [GO:0016740]	WNILCEK	0.98874	-1.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	425.13	0	0	0	0	0	0	0	0	0	0	0	0
K9KE22	K9KE22_HORSE	Cell cycle progression protein 1-like protein		Equus caballus (Horse)		membrane [GO:0016020]		GPTTHREGR	0.98658	-3.1313	0	0	0	0	379.61	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KE37	K9KE37_HORSE	Splicing factor 45-like protein		Equus caballus (Horse)	"mRNA cis splicing, via spliceosome [GO:0045292]"		RNA binding [GO:0003723]	EGQGLGK	0.95629	0.23355	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	415.23	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KE51	K9KE51_HORSE	"ATP synthase subunit alpha, mitochondrial (ATP synthase F1 subunit alpha)"		Equus caballus (Horse)		"plasma membrane [GO:0005886]; proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]"	"ATP binding [GO:0005524]; proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]"	AVDSLVPIGR	0	2.1467	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	425.96	0	1282.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KE82	K9KE82_HORSE	SNW domain-containing protein 1		Equus caballus (Horse)	"mRNA splicing, via spliceosome [GO:0000398]"	spliceosomal complex [GO:0005681]		AGIKTHVEK	0.98484	-1.4795	0	0	0	0	0	0	0	507.93	0	0	754.13	0	0	0	313.64	0	549.71	0	0	0	0	369.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	411.38	445.59	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	566.4	0	0	0	0
K9KE84	K9KE84_HORSE	Structural maintenance of chromosomes flexible hinge domain-containing protein 1-like protein		Equus caballus (Horse)	chromosome organization [GO:0051276]; double-strand break repair [GO:0006302]	chromosome [GO:0005694]	ATP binding [GO:0005524]	FASRTLVK	0.98812	-1.2742	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	652.35	0	0	0	0	0	0	0	0
K9KEB6	K9KEB6_HORSE	Transmembrane protein 185B-like protein		Equus caballus (Horse)		membrane [GO:0016020]		KGGNHWWFGIR	0.98375	-0.8237	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2328.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KEE8	K9KEE8_HORSE	ERO1-like protein beta-like protein		Equus caballus (Horse)	protein folding in endoplasmic reticulum [GO:0034975]	endoplasmic reticulum membrane [GO:0005789]	FAD binding [GO:0071949]; protein-disulfide reductase activity [GO:0015035]; thiol oxidase activity [GO:0016972]	SLKEEFR	0.98847	-1.1853	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1115	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KEH4	K9KEH4_HORSE	Probable U3 small nucleolar RNA-associated protein 11		Equus caballus (Horse)	rRNA processing [GO:0006364]	nucleolus [GO:0005730]; small-subunit processome [GO:0032040]		GVTYQTRLKR	0.90498	0.32083	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	481.14	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KEI2	K9KEI2_HORSE	Phosducin-like protein-like protein		Equus caballus (Horse)	regulation of G protein-coupled receptor signaling pathway [GO:0008277]			RVKSSVIGASSR	0.97359	-0.18719	0	0	0	0	0	0	0	0	0	0	465.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KEI3	K9KEI3_HORSE	Eukaryotic peptide chain release factor subunit 1		Equus caballus (Horse)	"nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]"	cytoplasm [GO:0005737]	translation release factor activity [GO:0003747]	KVAETAVQLFISGDK	0.98381	-0.7799	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	619.66	0	0
K9KEJ9	K9KEJ9_HORSE	Advillin-like protein		Equus caballus (Horse)	cytoskeleton organization [GO:0007010]		actin binding [GO:0003779]	NATLSLNSEPK	0.96828	-0.055307	0	0	0	0	0	0	0	0	0	0	0	0	0	570.88	0	0	0	0	0	0	444.3	0	0	0	0	0	0	0	0	0	0	0	697.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	567.94	0	0	0	0	0	0	0	0	0	0	0	0
K9KEL9	K9KEL9_HORSE	Trifunctional purine biosynthetic protein adenosine-3-like protein		Equus caballus (Horse)	'de novo' IMP biosynthetic process [GO:0006189]		ATP binding [GO:0005524]; phosphoribosylformylglycinamidine cyclo-ligase activity [GO:0004641]; phosphoribosylglycinamide formyltransferase activity [GO:0004644]	VKLAEHK	0.98674	-1.1842	0	0	0	0	0	0	0	0	0	0	19924	0	31812	31309	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17512	0	29321	0	0	0	0	31969	0	20362	19330	0	0	1115.4	36607	0	0	0	0	0	0	0	0	0	0	0	0	0	26900	0	0	0
K9KEP3	K9KEP3_HORSE	Torsin-1A-interacting protein 1		Equus caballus (Horse)		endomembrane system [GO:0012505]; membrane [GO:0016020]; nucleus [GO:0005634]	ATPase activator activity [GO:0001671]	IDGAGKATQDSDAVK	0.98727	-1.8573	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	976.13	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KET4	K9KET4_HORSE	Cell division cycle protein 27 homolog		Equus caballus (Horse)				EVRRIENYR	0.97456	0.10394	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1638.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KEW0	K9KEW0_HORSE	"Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.5) (2-methyl branched chain acyl-CoA dehydrogenase) (2-methylbutyryl-coenzyme A dehydrogenase)"		Equus caballus (Horse)			acyl-CoA dehydrogenase activity [GO:0003995]; flavin adenine dinucleotide binding [GO:0050660]	VPEANVLGQIGHGYK	0.86704	0.48242	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	512.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KEX8	K9KEX8_HORSE	Uncharacterized protein C4orf14-like protein-like protein		Equus caballus (Horse)			GTP binding [GO:0005525]	TKKPPSLVYNLQK	0.97351	0.14139	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3240.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KEZ1	K9KEZ1_HORSE	"A kinase anchor protein 1, mitochondrial-like protein"		Equus caballus (Horse)	phosphorylation [GO:0016310]		kinase activity [GO:0016301]	YVDYGGYKRVK	0.9654	-0.11758	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	500.43	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KEZ6	K9KEZ6_HORSE	Mediator of RNA polymerase II transcription subunit 13		Equus caballus (Horse)	regulation of transcription by RNA polymerase II [GO:0006357]	mediator complex [GO:0016592]	transcription coregulator activity [GO:0003712]	LLSREAPEELK	0.98813	-1.7774	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1464.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KF07	K9KF07_HORSE	Biorientation of chromosomes in cell division protein 1-like-like protein		Equus caballus (Horse)	cell division [GO:0051301]			HKYKGDSMHK	0.98634	-2.0061	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	568.49	0	0	0	0	1286.6	707.29	0	0	0	0	0	0	0	0
K9KF21	K9KF21_HORSE	Ciliary neurotrophic factor		Equus caballus (Horse)	ciliary neurotrophic factor-mediated signaling pathway [GO:0070120]; negative regulation of neuron apoptotic process [GO:0043524]	cytoplasm [GO:0005737]	ciliary neurotrophic factor receptor binding [GO:0005127]	SIWLARKIR	0.97498	0.10394	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	288.36	0
K9KF41	K9KF41_HORSE	DNA-directed RNA polymerase (EC 2.7.7.6)		Equus caballus (Horse)	DNA-templated transcription [GO:0006351]	DNA-directed RNA polymerase complex [GO:0000428]	DNA binding [GO:0003677]; DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; ribonucleoside binding [GO:0032549]	IPQIGDK	0.98691	-1.2702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2304.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KF47	K9KF47_HORSE	F-actin-capping protein subunit alpha		Equus caballus (Horse)	barbed-end actin filament capping [GO:0051016]	F-actin capping protein complex [GO:0008290]	actin binding [GO:0003779]	IDWNKILSYKIGK	0.98136	-0.55669	0	0	0	0	0	0	0	0	520.05	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	992.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KF72	K9KF72_HORSE	Glucoside xylosyltransferase 1 (EC 2.4.2.42) (Glycosyltransferase 8 domain-containing protein 3)		Equus caballus (Horse)			UDP-glycosyltransferase activity [GO:0008194]	KLFKPCASQR	0.9834	-0.76415	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	512.03	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KF80	K9KF80_HORSE	Oxysterol-binding protein-like protein 8-like protein		Equus caballus (Horse)	lipid transport [GO:0006869]	membrane [GO:0016020]	lipid binding [GO:0008289]	DYFIIFLLILLQVIINFMFK	0.97193	0.13159	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	568.65	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFA0	K9KFA0_HORSE	RNA helicase (EC 3.6.4.13)		Equus caballus (Horse)	defense response to virus [GO:0051607]	cytoplasm [GO:0005737]	hydrolase activity [GO:0016787]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724]; zinc ion binding [GO:0008270]	NFVVVFKSNSPKK	0.90884	0.31799	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	696.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFA3	K9KFA3_HORSE	Kelch domain-containing protein 2-like protein		Equus caballus (Horse)				LGVWVYK	0.96224	-0.0068425	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	580.04	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFB8	K9KFB8_HORSE	N-acetyltransferase ESCO1-like protein		Equus caballus (Horse)			transferase activity [GO:0016740]	IWVFSMMR	0.96922	0.16504	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1250.8	0	0	0	0	0	0	0	0	0	0	0	0	916.49	1021.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFC3	K9KFC3_HORSE	Paraspeckle component 1-like protein		Equus caballus (Horse)	rhythmic process [GO:0048511]	nuclear speck [GO:0016607]	RNA binding [GO:0003723]	LEAEMEAAR	0.96807	-0.070826	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	823.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFD1	K9KFD1_HORSE	Protein arginine N-methyltransferase 3-like protein		Equus caballus (Horse)	methylation [GO:0032259]		protein-arginine N-methyltransferase activity [GO:0016274]	DFIYQNPHIFKDK	0.97043	0.17109	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	489.71	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFD9	K9KFD9_HORSE	dihydrolipoyllysine-residue acetyltransferase (EC 2.3.1.12)		Equus caballus (Horse)	acetyl-CoA biosynthetic process from pyruvate [GO:0006086]	pyruvate dehydrogenase complex [GO:0045254]	dihydrolipoyllysine-residue acetyltransferase activity [GO:0004742]	GTGPEGR	0.98594	-1.0118	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	462.42	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFF8	K9KFF8_HORSE	E3 UFM1-protein ligase 1 (E3 UFM1-protein transferase 1)		Equus caballus (Horse)	protein ufmylation [GO:0071569]		UFM1 ligase activity [GO:0061666]	GGGGGNAR	0.95993	-0.011356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	393.84	507.07	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFG7	K9KFG7_HORSE	CDC45-like protein-like protein		Equus caballus (Horse)	cell cycle [GO:0007049]; DNA replication initiation [GO:0006270]	nucleus [GO:0005634]		ISFEYDLR	0.96843	0.15947	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1239.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFG9	K9KFG9_HORSE	Replication protein A subunit		Equus caballus (Horse)	DNA recombination [GO:0006310]; DNA repair [GO:0006281]; DNA replication [GO:0006260]	PML body [GO:0016605]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	VIDQQNGLYR	0.41935	0.67835	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	380.83	0	0	0	0	0	0	0	0	0	0	0	0
K9KFH7	K9KFH7_HORSE	Protein kinase C theta type-like protein		Equus caballus (Horse)	phosphorylation [GO:0016310]		ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	EIDPPFRPK	0.96387	-0.024494	0	0	0	0	0	0	0	514.34	495.69	0	0	0	0	0	0	0	0	0	0	632.57	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	594.33	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFI9	K9KFI9_HORSE	Ribonucleoside-diphosphate reductase large subunit-like protein		Equus caballus (Horse)	deoxyribonucleotide biosynthetic process [GO:0009263]			IAKYGVR	0.9859	-0.99905	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1227.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	433.25	0	0	977.01	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFM6	K9KFM6_HORSE	Bcl-2-associated transcription factor 1-like protein		Equus caballus (Horse)				EENQKGDKK	0.98871	-1.7118	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2129.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFP7	K9KFP7_HORSE	M-phase phosphoprotein 8-like protein		Equus caballus (Horse)				QSETKEDTSPKK	0.91344	0.31444	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	382.18	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFW8	K9KFW8_HORSE	Putative lysosomal cobalamin transporter-like protein		Equus caballus (Horse)		membrane [GO:0016020]		TYLFLHK	0.9657	-0.026344	0	0	0	0	0	0	0	0	0	1210.4	0	0	0	0	0	0	0	0	0	0	726.85	0	0	0	0	0	0	0	0	0	0	1945.5	0	0	0	0	1027	0	0	758.87	0	0	0	0	0	0	0	0	0	0	1027.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1348.2	0	0	0	0
K9KFX6	K9KFX6_HORSE	"Splicing factor, arginine/serine-rich 12-like protein"		Equus caballus (Horse)				SYNASRRSR	0.97193	0.042281	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	565.76	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KFZ5	K9KFZ5_HORSE	Inhibitor of nuclear factor kappa-B kinase subunit alpha-like protein		Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]	IkappaB kinase activity [GO:0008384]	SIQLDLER	0.97547	0.086229	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2861.4	0	0	0	0	0	0	0	0	0	0	0
K9KG01	K9KG01_HORSE	UHRF1-binding protein 1-like-like protein		Equus caballus (Horse)				IQVSNTK	0.9594	-0.017025	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	607.12	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KG50	K9KG50_HORSE	Eukaryotic translation initiation factor 4 gamma 3-like protein		Equus caballus (Horse)			RNA binding [GO:0003723]; translation initiation factor activity [GO:0003743]	GVIDLVFEK	0.98412	-0.70622	1705.6	2041.3	1968.7	0	0	1878	1913.2	0	0	2407.8	3295.1	0	0	0	0	0	0	2624.5	1511.9	1743.7	1662	0	0	1578.3	0	0	0	2291.1	0	2195	3591.4	3063.5	0	4592.9	4339.5	0	0	2256.8	0	0	0	0	1383.1	0	0	0	2057.9	0	2444.9	0	0	1570.2	0	0	0	1130.1	926.9	0	0	0	1387.7	0	1469.9	665.99	0	0	0	0	0	0	3370.2	2743.8	1937.4	0	2017.3
K9KG53	K9KG53_HORSE	Leukocyte common antigen-like protein		Equus caballus (Horse)	dephosphorylation [GO:0016311]		protein tyrosine phosphatase activity [GO:0004725]	IYDLHKK	0.9672	0.0094847	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3777.9	4093.3	3707.4	0	0	0	0	0	0	0	0	0	1029.3	1529	1544.1	7824.1	7592.1	7318.1	1388.2	1591.7	1537.3	0	1255.7	1195	1100.9	1322.3	1361.8	0	0	0	1386.4	3574.8	3516.8	0	0	619.91	0	0	0	0	0	0	955.92	1004.2	1061.6	0	0	0	0	0	0	691.58	0	0	0	682.06	629.18	0	0	0
K9KG85	K9KG85_HORSE	sulfate adenylyltransferase (EC 2.7.7.4)		Equus caballus (Horse)	sulfate assimilation [GO:0000103]		ATP binding [GO:0005524]; sulfate adenylyltransferase (ATP) activity [GO:0004781]	VAAYNKK	0.51852	0.64803	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	585.45	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9KGK8	K9KGK8_HORSE	ESF1-like protein-like protein		Equus caballus (Horse)	rRNA processing [GO:0006364]	nucleolus [GO:0005730]		IMKNLHK	0.98825	-1.7727	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1483.6	0	0	0	0	0	0
K9KGL9	K9KGL9_HORSE	Coiled-coil domain-containing protein 150-like protein		Equus caballus (Horse)				SVEVSRTNR	0.96804	-0.070447	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	711.87	0	0	0	0	0	0	0
K9KGM8	K9KGM8_HORSE	CCAAT/enhancer-binding protein zeta-like protein		Equus caballus (Horse)		intracellular membrane-bounded organelle [GO:0043231]		YYKKVAVFK	0.10588	1.384	0	0	0	0	0	1701.2	0	1672.2	1854	0	1943.1	0	0	2336.3	0	2720.9	2495.2	0	1711.5	0	3639.9	0	0	0	0	1706.7	0	2052.8	2021.4	2395.3	3165.2	0	3416.8	2647.9	3077.4	2125.6	0	0	1899.8	3613.3	0	3025	0	0	1985	0	0	2197.7	2854.7	2765.5	0	1727.5	0	4034.9	2337.9	0	0	0	2056.4	0	1310.6	2698.8	0	1566.3	0	1593.5	0	0	0	0	0	2082.2	0	0	1164.9
L7MRF7	L7MRF7_HORSE	CD40 ligand (Tumor necrosis factor ligand superfamily member 5)	CD40LG	Equus caballus (Horse)	immune response [GO:0006955]	cell surface [GO:0009986]; extracellular space [GO:0005615]; membrane [GO:0016020]	cytokine activity [GO:0005125]; tumor necrosis factor receptor binding [GO:0005164]	SVSGSER	0.95718	0.2288	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	490.88	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	302.42	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
L7MRH6	L7MRH6_HORSE	Interferon-induced very large GTPase 1-like protein	GVIN1	Equus caballus (Horse)				KNKLYGINR	0.96198	-0.14694	0	0	0	0	499.6	0	0	0	0	920.53	0	1189.8	0	0	0	0	0	900.44	0	0	0	681.03	0	0	0	0	0	0	0	0	0	0	0	0	0	1127	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	575.18	0	0
L7MRL8	L7MRL8_HORSE	Protein KTI12 homolog	KTI12	Equus caballus (Horse)			ATP binding [GO:0005524]	NAIPGDLLK	0.98774	-1.0244	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	561.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2596.1	0	0	0	0	0	0	0
L7MRQ1	L7MRQ1_HORSE	Coiled-coil domain-containing 82-like protein	CCDC82	Equus caballus (Horse)				ELSKQRSR	0.96673	0.18183	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5366.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
L7MRQ8	L7MRQ8_HORSE	non-specific serine/threonine protein kinase (EC 2.7.11.1)	PIK3R4	Equus caballus (Horse)	late endosome to vacuole transport [GO:0045324]; macroautophagy [GO:0016236]; phosphorylation [GO:0016310]	cellular anatomical entity [GO:0110165]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	SSSNAWTLKHDLK	0.65979	0.64014	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	676.25	0	0	0	0	0	0	0	0	0	0	0	0	391	0	542.68	0	710.39	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
L7MRS0	L7MRS0_HORSE	Adenylyltransferase and sulfurtransferase MOCS3-like protein	MOCS3	Equus caballus (Horse)			nucleotidyltransferase activity [GO:0016779]	VSVTDYK	0.96875	-0.036948	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1876.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
L7MRS3	L7MRS3_HORSE	L-lactate dehydrogenase (EC 1.1.1.27)	LDHA	Equus caballus (Horse)	carboxylic acid metabolic process [GO:0019752]		L-lactate dehydrogenase activity [GO:0004459]	NVVKYSPNCK	0.98792	-1.8994	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1649.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
L7MRU6	L7MRU6_HORSE	Tyrosine-protein kinase ITK/TSK-like protein		Equus caballus (Horse)	intracellular signal transduction [GO:0035556]; phosphorylation [GO:0016310]		kinase activity [GO:0016301]; metal ion binding [GO:0046872]	YFPPLSR	0.96082	-0.010962	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1893.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
L7MRY2	L7MRY2_HORSE	Polycomb protein EED-like protein	EED	Equus caballus (Horse)				INSKRMMNAIK	0.9687	-0.17338	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	732.36	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
L7MS24	L7MS24_HORSE	3'-phosphate/5'-hydroxy nucleic acid ligase (EC 6.5.1.8)		Equus caballus (Horse)	tRNA processing [GO:0008033]		GTP binding [GO:0005525]; metal ion binding [GO:0046872]; RNA ligase activity [GO:0008452]	NLDFQDVLDK	0.40784	0.67499	0	0	0	0	0	0	0	0	535.13	0	797.48	782.63	0	0	0	0	2960.6	0	0	0	0	0	266.31	339.16	0	0	0	0	0	1016.1	0	0	0	0	0	0	519.8	1732.8	1764.6	0	0	1090.8	834.25	0	849.52	0	0	1264.7	0	0	0	0	1200.1	0	0	0	0	0	0	0	0	0	0	476.39	556.39	451.01	0	0	1242.2	622.16	0	1901.8	0	0	0
L7MS59	L7MS59_HORSE	LYRIC-like protein	MTDH	Equus caballus (Horse)	negative regulation of apoptotic process [GO:0043066]; positive regulation of angiogenesis [GO:0045766]; positive regulation of canonical NF-kappaB signal transduction [GO:0043123]			ELFHREI	0.98801	-1.7819	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	836.97	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
L7MSB5	L7MSB5_HORSE	Survival of motor neuron-related-splicing factor 30-like protein	SMNDC1	Equus caballus (Horse)				PLLNLKPVEEGRKAK	0.91227	0.30087	0	0	0	0	0	0	0	0	0	0	918.91	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
L7MSE7	L7MSE7_HORSE	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15-like protein	DHX15	Equus caballus (Horse)			helicase activity [GO:0004386]	QQLSRIMDR	0.98744	-1.8171	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	319.89	0	0	0	0	0	0	0	0	0	0
L7MSM2	L7MSM2_HORSE	Actin-related protein 10-like protein	ACTR10	Equus caballus (Horse)				YLVEKPKYKK	0.9736	-0.20559	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1833.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
L7MT82	L7MT82_HORSE	Phospholipase A-2-activating-like protein	PLAA	Equus caballus (Horse)				ELRFKLISVF	0.97264	-0.20056	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2291.3	0	0	0	0	0	1577.3	0	0	0	0	0	0	0	0	2591.7	0	0	0	2874.4	0	957.16	0	0	0	0	0	0	0	0	0	1318.7	0	596.22	0	0	0	0	0	0	0	0	0	0	0	0	1222.7	1132.5	0	0	0	0	0	1091.7	720.66	0	0	0	0	0
L7MTC7	L7MTC7_HORSE	Histone-lysine N-methyltransferase SETDB1-like protein	SETDB1	Equus caballus (Horse)	chromatin organization [GO:0006325]; methylation [GO:0032259]		methyltransferase activity [GO:0008168]	LEGNLGR	0.96688	0.023937	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	789.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
O77718	O77718_HORSE	Sperm-membrane associated protein P47		Equus caballus (Horse)				IFLGNLDNNSHK	0.98561	-0.87051	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2605	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	647.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
O97677	O97677_HORSE	Transferrin		Equus caballus (Horse)				DLLFRDDTECLANLQPTTTYK	0	6.9958	0	733.72	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
O97678	O97678_HORSE	Transferrin		Equus caballus (Horse)		extracellular region [GO:0005576]		AVTEFESCNLAEAPNHAVVSR	0	42.178	0	1270.8	1021.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	522.13	0	0	0	0	2697.4	2807.3	2793.3	0	0	0	4037.5	4380.8	2966	0	0	0	4628.1	4786.6	4164.2	0	0	0	0	0	0	0	0	0	966.3	2980.5	2538.4	0	0	0	0	0	0	0	0	0	815.11	738.25	628.62	0	0	0	0	0	0	0	0	0
P01958	HBA_HORSE	Hemoglobin subunit alpha (Alpha-globin) (Hemoglobin alpha chain) [Cleaved into: Hemopressin]	HBA	Equus caballus (Horse)	cellular oxidant detoxification [GO:0098869]; hydrogen peroxide catabolic process [GO:0042744]	haptoglobin-hemoglobin complex [GO:0031838]; hemoglobin complex [GO:0005833]	heme binding [GO:0020037]; iron ion binding [GO:0005506]; organic acid binding [GO:0043177]; oxygen binding [GO:0019825]; oxygen carrier activity [GO:0005344]	MFLGFPTTK	0.26119	0.94879	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	614.36	562.81	568.74	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3201.4	3051.1	3052.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
P02062	HBB_HORSE	Hemoglobin subunit beta (Beta-globin) (Hemoglobin beta chain)	HBB	Equus caballus (Horse)	cellular oxidant detoxification [GO:0098869]; hydrogen peroxide catabolic process [GO:0042744]	haptoglobin-hemoglobin complex [GO:0031838]; hemoglobin complex [GO:0005833]	heme binding [GO:0020037]; hemoglobin alpha binding [GO:0031721]; metal ion binding [GO:0046872]; organic acid binding [GO:0043177]; oxygen binding [GO:0019825]; oxygen carrier activity [GO:0005344]	DFTPELQASYQK	0	37.143	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	514.6	0	0	0	0	0	0	0	1665.1	1537.6	1418.2	0	0	897.22	0	0	0	0	0	0	0	0	0	0	0	0
P27425	TRFE_HORSE	Serotransferrin (Transferrin) (Beta-1 metal-binding globulin) (Siderophilin)	TF	Equus caballus (Horse)	antibacterial humoral response [GO:0019731]; intracellular iron ion homeostasis [GO:0006879]; iron ion transport [GO:0006826]	early endosome [GO:0005769]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]	ferric iron binding [GO:0008199]	AACVCQELHNQQASYGK	0	323.31	12836	18470	14873	6563.2	7253.2	6761.3	49687	51080	54816	14298	46640	45944	67921	65299	66839	183860	178120	170110	22342	115140	99834	19893	20970	19554	12362	14633	16246	106770	102880	95864	154070	154350	149100	105540	109980	83880	28840	65663	63427	134700	117630	106640	53584	47174	43024	108510	111560	106700	64631	66948	60599	30818	104210	93493	53766	55279	55145	97402	97520	94284	26990	79739	89115	35741	33430	29019	91708	85255	88207	25799	57594	48998	23438	25704	23883
P49066	FETA_HORSE	Alpha-fetoprotein (Alpha-1-fetoprotein) (Alpha-fetoglobulin)	AFP	Equus caballus (Horse)		cytoplasm [GO:0005737]; extracellular space [GO:0005615]	metal ion binding [GO:0046872]	KAPQLTPPELIALTR	0	5.7654	0	0	0	0	0	0	555.62	564.26	634.02	0	0	477.34	0	0	466.02	1719.5	702.88	711.8	0	0	0	0	0	0	0	0	0	3195.6	0	2045.8	1413.5	1356.8	1327.4	1454.4	1427.1	1084.7	0	738.42	722.56	1026.7	0	1168.8	0	586.4	455.31	919.39	832.38	853.95	0	524.59	560.98	0	566.96	571.92	0	0	0	0	1112.5	1152	0	491.91	538.24	0	0	0	0	0	0	0	465.53	507.14	0	0	0
Q06W38	Q06W38_HORSE	Phosphotransferase (EC 2.7.1.-)	GCK	Equus caballus (Horse)	glycolytic process [GO:0006096]; hexose metabolic process [GO:0019318]; intracellular glucose homeostasis [GO:0001678]		ATP binding [GO:0005524]; glucokinase activity [GO:0004340]; glucose binding [GO:0005536]	VGEGEAGQWSVKTK	0.91281	0.30973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	879.94	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q0EAB8	TPH2_HORSE	Tryptophan 5-hydroxylase 2 (EC 1.14.16.4) (Tryptophan 5-monooxygenase 2)	TPH2	Equus caballus (Horse)	aromatic amino acid metabolic process [GO:0009072]; serotonin biosynthetic process [GO:0042427]	neuron projection [GO:0043005]	iron ion binding [GO:0005506]; tryptophan 5-monooxygenase activity [GO:0004510]	TAVVFSLR	0.97261	0.043895	0	0	0	0	236.01	339.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q0R0B4	Q0R0B4_HORSE	MHC class I antigen 5.7	Eqca-7	Equus caballus (Horse)		membrane [GO:0016020]		AYLDGKCVVWLR	0.98712	-1.0523	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	368.66	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	590.38	0	0	0	0	0	0	0	0
Q2QLB1	CAV2_HORSE	Caveolin-2	CAV2	Equus caballus (Horse)	caveola assembly [GO:0070836]; cell differentiation [GO:0030154]; endoplasmic reticulum organization [GO:0007029]; insulin receptor signaling pathway [GO:0008286]; mitochondrion organization [GO:0007005]; negative regulation of endothelial cell proliferation [GO:0001937]; positive regulation of dopamine receptor signaling pathway [GO:0060161]; positive regulation of MAPK cascade [GO:0043410]; regulation of cytosolic calcium ion concentration [GO:0051480]; skeletal muscle fiber development [GO:0048741]; vesicle docking [GO:0048278]; vesicle fusion [GO:0006906]	caveola [GO:0005901]; cytoplasmic vesicle [GO:0031410]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane raft [GO:0044853]	D1 dopamine receptor binding [GO:0031748]; molecular adaptor activity [GO:0060090]; protein kinase binding [GO:0019901]	GLETEKADVQLFLDDESYSR	0.95787	0.22193	0	0	440.63	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2612	0	0	0	0	0	0	1957.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q30476	Q30476_HORSE	MHC ELA-DQbeta cell surface glycoprotein		Equus caballus (Horse)	antigen processing and presentation [GO:0019882]; immune response [GO:0006955]	MHC class II protein complex [GO:0042613]		DELERVRA	0.97231	-0.063567	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1619	0	0
Q3Y4F9	Q3Y4F9_HORSE	Plasma membrane calcium ATPase	PMCA	Equus caballus (Horse)		membrane [GO:0016020]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; P-type calcium transporter activity [GO:0005388]	LPDESFR	0.97844	0.060441	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	336.15	0	0	0	0	0	0	0	0	0	0	0	0
Q4JK40	Q4JK40_HORSE	TFRC		Equus caballus (Horse)				LNGNSYV	0.95772	0.2288	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	506.27	518.91	0	0	0	0	0	0	0	0	0	0	0	0	544.53	0	0	0	0	0	0	0	0	370.58	445.22	0	0	0	274.61	0	0	0	0	0	0	414.07	0	486.84	0	0	0	0	0	443.09	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q4W446	Q4W446_HORSE	SMF protein	smf	Equus caballus (Horse)		nucleus [GO:0005634]	DNA binding [GO:0003677]	APGPGASGNVSR	0.9807	-0.4938	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1250.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3078.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	587.44	0	0	0	0
Q58II4	Q58II4_HORSE	"Vitamin D3 receptor (1,25-dihydroxyvitamin D3 receptor) (Nuclear receptor subfamily 1 group I member 1)"		Equus caballus (Horse)		cytoplasm [GO:0005737]; nucleus [GO:0005634]	nuclear receptor activity [GO:0004879]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DLTSEDQIVLLK	0.92863	0.27997	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	650.62	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q5XWB8	Q5XWB8_HORSE	Monocyte differentiation antigen CD14 (Myeloid cell-specific leucine-rich glycoprotein)	CD14	Equus caballus (Horse)		extracellular region [GO:0005576]; Golgi apparatus [GO:0005794]; membrane raft [GO:0045121]; plasma membrane [GO:0005886]		GASADPK	0.96097	0.21719	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	329.66	0	0	0	0
Q65YZ2	Q65YZ2_HORSE	"Cholinergic receptor, muscarinic 4"	CHRM4	Equus caballus (Horse)	regulation of locomotion [GO:0040012]	postsynaptic membrane [GO:0045211]	G protein-coupled acetylcholine receptor activity [GO:0016907]	VHKHRSEGPK	0.77802	0.5097	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	506.86	0	0	0	0	0	0	0	0	0	0	0	0	439.54	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q6VCR9	Q6VCR9_HORSE	Ribosomal protein L18-like		Equus caballus (Horse)		ribosome [GO:0005840]		MGVDIRHNKDR	0.96105	-0.14737	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	610.29
Q863D8	Q863D8_HORSE	Smoothened	SMO	Equus caballus (Horse)	cell surface receptor signaling pathway [GO:0007166]	membrane [GO:0016020]		KPIPDCEIK	0.98403	-1.2961	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	831.52	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q8HZM8	Q8HZM8_HORSE	Metalloproteinase	ADAMTS-1	Equus caballus (Horse)	extracellular matrix organization [GO:0030198]; proteolysis [GO:0006508]	extracellular region [GO:0005576]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	TCGGGVQYTMR	0.76444	0.51741	0	0	0	0	0	0	690.34	758.29	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1476.7	0	0	0	0	0	0	0	0	0	0	0	1601.4	1571.1	0	0	0	1727.6	0	1828.2	0	0	2117.8	0	0	0
Q8MJ96	Q8MJ96_HORSE	Cullin 4B	CUL4B	Equus caballus (Horse)	ubiquitin-dependent protein catabolic process [GO:0006511]		ubiquitin protein ligase binding [GO:0031625]	GLNNLLDENR	0.96989	0.20111	985.57	0	483.18	459.06	537.03	590.52	1444.6	1412.3	1326.2	1564.4	1700.6	1882.9	2928.4	2640.6	2789.3	6898.7	6356.7	6402.1	399.7	1204.1	1059.5	677.54	836.21	1472.4	1104.4	1215.2	1665.9	1686.9	1912.2	1867.1	2425.6	2523.4	2446.8	1310.7	1485.6	1232.7	1233.3	3214.4	3330.1	2080.6	1970.3	2035	2413.4	2363.9	2152.6	1299.9	3122.4	2947.4	2553.9	2746.7	2699.3	1825.3	2659.4	2395.4	699.55	0	788.57	2218.4	2149	2266.6	548.91	1477.5	1592.6	1449.5	1132.2	913.22	2300.2	2226.8	2032.1	1439.9	3162.3	2812.3	1263.1	1200.8	1048.2
Q8MKB8	Q8MKB8_HORSE	Glucose-regulated protein	GRP94	Equus caballus (Horse)			ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent protein folding chaperone [GO:0140662]; unfolded protein binding [GO:0051082]	LFETATLR	0.99074	-1.1895	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2037.4	0	0	0	0	0	0	0	0	0	0	0	2674.9	0	1753.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q8MKD9	Q8MKD9_HORSE	LPS-induced TNF-alpha factor	LITAF	Equus caballus (Horse)	positive regulation of canonical NF-kappaB signal transduction [GO:0043123]	Golgi apparatus [GO:0005794]; lysosomal membrane [GO:0005765]	metal ion binding [GO:0046872]; WW domain binding [GO:0050699]	VTPLRTPK	0.98838	-1.7691	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	872.35	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q95KZ7	Q95KZ7_HORSE	Alpha-S1-casein		Equus caballus (Horse)		extracellular region [GO:0005576]		VFILACLVAVALAR	0.89193	0.43119	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1980	0	0	0	0	0	0	0	0	0	0	0	0
Q95M34	Q95M34_HORSE	Immunoglobulin gamma 1 heavy chain constant region	IGHC1	Equus caballus (Horse)				CPAPELLGGPSVFIFPPNPK	0	22.105	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	941.29	727.18	780.83	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	463.56	0	0	0	0	748.37	598.63	643.4	0	0	0	0	0	0	0	0	0	0	1305.8	961.31	0	0	0	0	688.86	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q95MD1	Q95MD1_HORSE	Microphthalmia transcription factor		Equus caballus (Horse)	regulation of DNA-templated transcription [GO:0006355]	nucleus [GO:0005634]	protein dimerization activity [GO:0046983]	ASVDYIRK	0.98154	-0.54647	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	624.05	0	0	0	0	0	0	0	0	0	0
Q9TQV1	Q9TQV1_HORSE	Transferrin		Equus caballus (Horse)		extracellular region [GO:0005576]		KNSNFQLNQLQGK	0	7.7967	0	0	0	0	0	0	643.67	656.14	685.4	0	581.9	759.54	797.51	782.23	755.94	3642.8	3929.5	3228.7	0	1204.7	1298.5	617.56	670.52	498.7	0	0	0	1280	1279.7	1585.4	1666.6	1410.9	1486.3	1713.8	1705.1	1447.7	636.26	951.84	842.43	1978.3	2141.4	2024.6	1221.8	1195.3	613.6	1443.8	1952.7	1829.4	785.1	862.95	844.96	705.28	1650.6	1481.1	834.5	1043.5	1038.6	1255.5	1296.9	0	0	990.35	1142.4	639.93	613.99	554.31	1209.8	1356.9	1535.7	0	630.52	520.18	538.46	523.79	543.84
Q9TQW8	Q9TQW8_HORSE	Transferrin		Equus caballus (Horse)		extracellular region [GO:0005576]		SCHTGVDR	0	46.164	2335.5	2845.7	2372.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1600.6	1732.3	1481.6	1150.1	1192	1389.2	7655.4	6900.3	7488.7	0	0	0	10105	9983	7301.4	0	0	0	11362	8519.2	7831.8	0	0	0	0	0	0	0	0	0	1757.7	6526.4	5607	0	0	0	0	0	0	0	0	0	1977.4	1898.3	1795.5	0	0	0	0	0	0	0	0	0
Q9TSX1	Q9TSX1_HORSE	Thymidylate synthase (EC 2.1.1.45)	TS	Equus caballus (Horse)	dTMP biosynthetic process [GO:0006231]; dTTP biosynthetic process [GO:0006235]; methylation [GO:0032259]	membrane [GO:0016020]	thymidylate synthase activity [GO:0004799]	LSCQLYQR	0.936	0.24787	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3031.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
Q9XS39	PHOS_HORSE	Phosducin (PHD)	PDC	Equus caballus (Horse)	regulation of G protein-coupled receptor signaling pathway [GO:0008277]; response to stimulus [GO:0050896]; visual perception [GO:0007601]	cytosol [GO:0005829]; nucleus [GO:0005634]; photoreceptor inner segment [GO:0001917]; photoreceptor outer segment [GO:0001750]		GVINDWRK	0.98297	-0.73761	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1664.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0