T: Majority protein IDs	Entry Name	Protein names	Gene Names	Organism	Gene Ontology (biological process)	Gene Ontology (cellular component)	Gene Ontology (molecular function)	T: Peptide sequences	N: Q-value	Intensity No infection_1	Intensity No infection_2	Intensity No infection_3	Intensity HIV-HBV-NF+F_1	Intensity HIV-HBV-NF+F_2	Intensity HIV-HBV-NF+F_3	Intensity HIV-HCV-NF+F_1	Intensity HIV-HCV-NF+F_2	Intensity HIV-HCV-NF+F_3	Intensity HIV-NF+F_1	Intensity HIV-NF+F_2	Intensity HIV-NF+F_3
P0DOX5	IGG1_HUMAN	Immunoglobulin gamma-1 heavy chain (Immunoglobulin gamma-1 heavy chain NIE)		Homo sapiens (Human)	adaptive immune response [GO:0002250]	extracellular region [GO:0005576]; immunoglobulin complex [GO:0019814]; plasma membrane [GO:0005886]		ALPAPIEK	0	15.496	14.7682	14.9813	14.858	14.8753	14.6849	15.147	15.2477	14.5218	14.1616	14.8659	14.965
P01876	IGHA1_HUMAN	Immunoglobulin heavy constant alpha 1 (Ig alpha-1 chain C region) (Ig alpha-1 chain C region BUR) (Ig alpha-1 chain C region TRO)	IGHA1	Homo sapiens (Human)	"adaptive immune response [GO:0002250]; antibacterial humoral response [GO:0019731]; B cell receptor signaling pathway [GO:0050853]; complement activation, classical pathway [GO:0006958]; defense response to bacterium [GO:0042742]; glomerular filtration [GO:0003094]; immune response [GO:0006955]; innate immune response [GO:0045087]; phagocytosis, engulfment [GO:0006911]; phagocytosis, recognition [GO:0006910]; positive regulation of B cell activation [GO:0050871]; positive regulation of respiratory burst [GO:0060267]; retina homeostasis [GO:0001895]"	"blood microparticle [GO:0072562]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; IgA immunoglobulin complex [GO:0071745]; IgG immunoglobulin complex [GO:0071735]; immunoglobulin complex, circulating [GO:0042571]; monomeric IgA immunoglobulin complex [GO:0071748]; plasma membrane [GO:0005886]; secretory dimeric IgA immunoglobulin complex [GO:0071752]; secretory IgA immunoglobulin complex [GO:0071751]"	antigen binding [GO:0003823]	DASGVTFTWTPSSGK	0	13.6917	12.5816	12.9912	12.8913	12.7906	12.6524	13.5957	13.0806	12.9353	12.8667	12.9606	12.9562
P02787	TRFE_HUMAN	Serotransferrin (Transferrin) (Beta-1 metal-binding globulin) (Siderophilin)	TF PRO1400	Homo sapiens (Human)	actin filament organization [GO:0007015]; antibacterial humoral response [GO:0019731]; cellular iron ion homeostasis [GO:0006879]; cellular response to iron ion [GO:0071281]; ERK1 and ERK2 cascade [GO:0070371]; iron ion homeostasis [GO:0055072]; iron ion transport [GO:0006826]; osteoclast differentiation [GO:0030316]; positive regulation of bone resorption [GO:0045780]; positive regulation of cell motility [GO:2000147]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of phosphorylation [GO:0042327]; positive regulation of receptor-mediated endocytosis [GO:0048260]; regulation of iron ion transport [GO:0034756]; regulation of protein stability [GO:0031647]; retina homeostasis [GO:0001895]; SMAD protein signal transduction [GO:0060395]	apical plasma membrane [GO:0016324]; basal part of cell [GO:0045178]; basal plasma membrane [GO:0009925]; blood microparticle [GO:0072562]; cell surface [GO:0009986]; clathrin-coated endocytic vesicle membrane [GO:0030669]; clathrin-coated pit [GO:0005905]; cytoplasmic vesicle [GO:0031410]; early endosome [GO:0005769]; endocytic vesicle [GO:0030139]; endoplasmic reticulum lumen [GO:0005788]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; extrinsic component of external side of plasma membrane [GO:0031232]; HFE-transferrin receptor complex [GO:1990712]; late endosome [GO:0005770]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]; secretory granule lumen [GO:0034774]; vesicle [GO:0031982]	ferric iron binding [GO:0008199]; ferrous iron binding [GO:0008198]; iron chaperone activity [GO:0034986]; transferrin receptor binding [GO:1990459]	APNHAVVTR	0	14.3737	13.2994	13.0129	12.4191	12.4915	12.1258	12.8611	12.2557	12.3727	12.3563	12.3969	12.4969
P01859	IGHG2_HUMAN	Immunoglobulin heavy constant gamma 2 (Ig gamma-2 chain C region) (Ig gamma-2 chain C region DOT) (Ig gamma-2 chain C region TIL) (Ig gamma-2 chain C region ZIE)	IGHG2	Homo sapiens (Human)	"adaptive immune response [GO:0002250]; B cell receptor signaling pathway [GO:0050853]; complement activation, classical pathway [GO:0006958]; defense response to bacterium [GO:0042742]; innate immune response [GO:0045087]; phagocytosis, engulfment [GO:0006911]; phagocytosis, recognition [GO:0006910]; positive regulation of B cell activation [GO:0050871]"	"blood microparticle [GO:0072562]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; IgG immunoglobulin complex [GO:0071735]; immunoglobulin complex, circulating [GO:0042571]; plasma membrane [GO:0005886]"	antigen binding [GO:0003823]; immunoglobulin receptor binding [GO:0034987]	CCVECPPCPAPPVAGPSVFLFPPKPK	0	12.6595	12.3375	12.2983	11.9429	12.0078	11.9029	11.5329	11.9407	12.1313	12.002	12.0949	12.1316
P0DOX7	IGK_HUMAN	Immunoglobulin kappa light chain (Immunoglobulin kappa light chain EU)		Homo sapiens (Human)	adaptive immune response [GO:0002250]	extracellular region [GO:0005576]; immunoglobulin complex [GO:0019814]; plasma membrane [GO:0005886]		ASSLESGVPSR	0	12.6031	10.7961	11.638	12.0713	12.1895	11.8631	12.6877	11.9869	11.9537	11.4325	11.6136	11.8169
Q86UK0	ABCAC_HUMAN	Glucosylceramide transporter ABCA12 (EC 7.6.2.1) (ATP-binding cassette sub-family A member 12) (ATP-binding cassette transporter 12) (ATP-binding cassette 12)	ABCA12 ABC12	Homo sapiens (Human)	cellular homeostasis [GO:0019725]; ceramide metabolic process [GO:0006672]; ceramide transport [GO:0035627]; cholesterol efflux [GO:0033344]; corneocyte desquamation [GO:0003336]; establishment of skin barrier [GO:0061436]; intracellular protein transport [GO:0006886]; keratinization [GO:0031424]; lipid homeostasis [GO:0055088]; lipid transport [GO:0006869]; lung alveolus development [GO:0048286]; phospholipid efflux [GO:0033700]; positive regulation of cholesterol efflux [GO:0010875]; positive regulation of intracellular lipid transport [GO:0032379]; positive regulation of protein localization to cell surface [GO:2000010]; protein localization to plasma membrane [GO:0072659]; regulated exocytosis [GO:0045055]; regulation of insulin secretion involved in cellular response to glucose stimulus [GO:0061178]; regulation of keratinocyte differentiation [GO:0045616]; secretion by cell [GO:0032940]; surfactant homeostasis [GO:0043129]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; epidermal lamellar body [GO:0097209]; epidermal lamellar body membrane [GO:0097234]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; plasma membrane [GO:0005886]; transport vesicle membrane [GO:0030658]	ABC-type transporter activity [GO:0140359]; apolipoprotein A-I receptor binding [GO:0034191]; ATP binding [GO:0005524]; ATPase-coupled intramembrane lipid transporter activity [GO:0140326]; ATPase-coupled lipid transmembrane transporter activity [GO:0034040]; ATPase-coupled transmembrane transporter activity [GO:0042626]; lipid transporter activity [GO:0005319]; signaling receptor binding [GO:0005102]	LVYEKDLR	0.9353	0	13.0616	12.9765	12.6821	12.7313	12.7299	13.1046	12.5447	12.5589	13.0278	13.0562	13.0742
P01860	IGHG3_HUMAN	Immunoglobulin heavy constant gamma 3 (HDC) (Heavy chain disease protein) (Ig gamma-3 chain C region)	IGHG3	Homo sapiens (Human)	"adaptive immune response [GO:0002250]; B cell receptor signaling pathway [GO:0050853]; complement activation, classical pathway [GO:0006958]; defense response to bacterium [GO:0042742]; innate immune response [GO:0045087]; phagocytosis, engulfment [GO:0006911]; phagocytosis, recognition [GO:0006910]; positive regulation of B cell activation [GO:0050871]; retina homeostasis [GO:0001895]"	"blood microparticle [GO:0072562]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; IgG immunoglobulin complex [GO:0071735]; immunoglobulin complex, circulating [GO:0042571]; plasma membrane [GO:0005886]"	antigen binding [GO:0003823]; immunoglobulin receptor binding [GO:0034987]	ALPAPIEK	0	12.7575	12.0232	11.9954	11.7269	11.9413	11.6082	10.2595	12.0991	11.7119	11.6642	11.7352	11.7022
P01023	A2MG_HUMAN	Alpha-2-macroglobulin (Alpha-2-M) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5)	A2M CPAMD5 FWP007	Homo sapiens (Human)	"acute inflammatory response to antigenic stimulus [GO:0002438]; acute-phase response [GO:0006953]; embryonic liver development [GO:1990402]; luteinization [GO:0001553]; negative regulation of complement activation, lectin pathway [GO:0001869]; response to carbon dioxide [GO:0010037]; response to glucocorticoid [GO:0051384]; response to nutrient [GO:0007584]; response to prostaglandin E [GO:0034695]; stem cell differentiation [GO:0048863]"	blood microparticle [GO:0072562]; collagen-containing extracellular matrix [GO:0062023]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; platelet alpha granule lumen [GO:0031093]	brain-derived neurotrophic factor binding [GO:0048403]; calcium-dependent protein binding [GO:0048306]; endopeptidase inhibitor activity [GO:0004866]; enzyme binding [GO:0019899]; growth factor binding [GO:0019838]; identical protein binding [GO:0042802]; interleukin-1 binding [GO:0019966]; interleukin-8 binding [GO:0019959]; nerve growth factor binding [GO:0048406]; protease binding [GO:0002020]; serine-type endopeptidase inhibitor activity [GO:0004867]; signaling receptor binding [GO:0005102]; tumor necrosis factor binding [GO:0043120]	AAQVTIQSSGTFSSK	0	12.8693	11.1893	10.7736	12.5629	12.7433	11.7834	12.566	12.5341	12.3478	10.4273	10.8052	10.4797
P14091	CATE_HUMAN	Cathepsin E (EC 3.4.23.34) [Cleaved into: Cathepsin E form I; Cathepsin E form II]	CTSE	Homo sapiens (Human)	antigen processing and presentation of exogenous peptide antigen via MHC class II [GO:0019886]; protein autoprocessing [GO:0016540]; proteolysis [GO:0006508]	endosome [GO:0005768]; intracellular membrane-bounded organelle [GO:0043231]	aspartic-type endopeptidase activity [GO:0004190]; identical protein binding [GO:0042802]; peptidase activity [GO:0008233]	VGLAPAVP	0.86283	13.845	0	0	13.6633	13.6629	13.6338	13.6745	13.6536	13.7335	14.5331	13.0598	14.5985
Q9NUZ1	ACOXL_HUMAN	Acyl-coenzyme A oxidase-like protein (Acyl-CoA oxidase-like protein) (EC 1.3.3.-)	ACOXL	Homo sapiens (Human)	fatty acid beta-oxidation using acyl-CoA oxidase [GO:0033540]; lipid homeostasis [GO:0055088]	peroxisomal matrix [GO:0005782]; peroxisome [GO:0005777]	acyl-CoA oxidase activity [GO:0003997]; FAD binding [GO:0071949]; fatty acid binding [GO:0005504]; flavin adenine dinucleotide binding [GO:0050660]	ECTGGMGYMMENR	0.82265	12.8243	9.31796	11.9339	10.4438	10.4162	10.5488	12.2558	11.0505	10.8216	11.8564	11.9864	12.1404
P02647	APOA1_HUMAN	Apolipoprotein A-I (Apo-AI) (ApoA-I) (Apolipoprotein A1) [Cleaved into: Proapolipoprotein A-I (ProapoA-I); Truncated apolipoprotein A-I (Apolipoprotein A-I(1-242))]	APOA1	Homo sapiens (Human)	adrenal gland development [GO:0030325]; blood vessel endothelial cell migration [GO:0043534]; cholesterol biosynthetic process [GO:0006695]; cholesterol efflux [GO:0033344]; cholesterol homeostasis [GO:0042632]; cholesterol import [GO:0070508]; cholesterol metabolic process [GO:0008203]; cholesterol transport [GO:0030301]; endothelial cell proliferation [GO:0001935]; G protein-coupled receptor signaling pathway [GO:0007186]; glucocorticoid metabolic process [GO:0008211]; high-density lipoprotein particle assembly [GO:0034380]; high-density lipoprotein particle clearance [GO:0034384]; high-density lipoprotein particle remodeling [GO:0034375]; integrin-mediated signaling pathway [GO:0007229]; lipid storage [GO:0019915]; lipoprotein biosynthetic process [GO:0042158]; lipoprotein metabolic process [GO:0042157]; negative chemotaxis [GO:0050919]; negative regulation of cell adhesion molecule production [GO:0060354]; negative regulation of cytokine production involved in immune response [GO:0002719]; negative regulation of heterotypic cell-cell adhesion [GO:0034115]; negative regulation of hydrolase activity [GO:0051346]; negative regulation of inflammatory response [GO:0050728]; negative regulation of interleukin-1 beta production [GO:0032691]; negative regulation of response to cytokine stimulus [GO:0060761]; negative regulation of tumor necrosis factor-mediated signaling pathway [GO:0010804]; negative regulation of very-low-density lipoprotein particle remodeling [GO:0010903]; peptidyl-methionine modification [GO:0018206]; phosphatidylcholine biosynthetic process [GO:0006656]; phosphatidylcholine metabolic process [GO:0046470]; phospholipid efflux [GO:0033700]; phospholipid homeostasis [GO:0055091]; positive regulation of cholesterol efflux [GO:0010875]; positive regulation of cholesterol esterification [GO:0010873]; positive regulation of cholesterol metabolic process [GO:0090205]; positive regulation of CoA-transferase activity [GO:1905920]; positive regulation of fatty acid biosynthetic process [GO:0045723]; positive regulation of hydrolase activity [GO:0051345]; positive regulation of lipid biosynthetic process [GO:0046889]; positive regulation of lipoprotein lipase activity [GO:0051006]; positive regulation of phagocytosis [GO:0050766]; positive regulation of phospholipid efflux [GO:1902995]; positive regulation of Rho protein signal transduction [GO:0035025]; positive regulation of stress fiber assembly [GO:0051496]; positive regulation of substrate adhesion-dependent cell spreading [GO:1900026]; positive regulation of triglyceride catabolic process [GO:0010898]; protein oxidation [GO:0018158]; protein stabilization [GO:0050821]; regulation of Cdc42 protein signal transduction [GO:0032489]; regulation of intestinal cholesterol absorption [GO:0030300]; regulation of protein phosphorylation [GO:0001932]; reverse cholesterol transport [GO:0043691]; triglyceride homeostasis [GO:0070328]; very-low-density lipoprotein particle remodeling [GO:0034372]; vitamin transport [GO:0051180]	blood microparticle [GO:0072562]; chylomicron [GO:0042627]; collagen-containing extracellular matrix [GO:0062023]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; early endosome [GO:0005769]; endocytic vesicle [GO:0030139]; endocytic vesicle lumen [GO:0071682]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; extracellular vesicle [GO:1903561]; high-density lipoprotein particle [GO:0034364]; plasma membrane [GO:0005886]; secretory granule lumen [GO:0034774]; spherical high-density lipoprotein particle [GO:0034366]; very-low-density lipoprotein particle [GO:0034361]	amyloid-beta binding [GO:0001540]; apolipoprotein A-I receptor binding [GO:0034191]; apolipoprotein receptor binding [GO:0034190]; chemorepellent activity [GO:0045499]; cholesterol binding [GO:0015485]; cholesterol transfer activity [GO:0120020]; enzyme binding [GO:0019899]; heat shock protein binding [GO:0031072]; high-density lipoprotein particle binding [GO:0008035]; high-density lipoprotein particle receptor binding [GO:0070653]; identical protein binding [GO:0042802]; phosphatidylcholine binding [GO:0031210]; phosphatidylcholine-sterol O-acyltransferase activator activity [GO:0060228]; phospholipid binding [GO:0005543]; protein homodimerization activity [GO:0042803]; signaling receptor binding [GO:0005102]	AHVDALR	0	12.8175	11.2866	11.4497	11.5053	11.4972	11.2979	10.8553	10.9259	10.864	10.9158	10.6558	11.1119
Q96JD6	AKCL2_HUMAN	"1,5-anhydro-D-fructose reductase (AF reductase) (EC 1.1.1.263) (Aldo-keto reductase family 1 member C-like protein 2) (Aldo-keto reductase family 1 member E2) (LoopADR) (Testis aldo-keto reductase) (htAKR) (Testis-specific protein) (hTSP)"	AKR1E2 AKR1CL2 AKRDC1	Homo sapiens (Human)		cytosol [GO:0005829]	"1,5-anhydro-D-fructose reductase activity [GO:0050571]; alditol:NADP+ 1-oxidoreductase activity [GO:0004032]; oxidoreductase activity [GO:0016491]"	EVGAGIR	0.5202	9.70603	10.301	15.457	13.8824	14.0061	13.8126	14.0234	13.9761	14.1498	14.6496	0	0
Q5T7N2	LITD1_HUMAN	LINE-1 type transposase domain-containing protein 1 (ES cell-associated protein 11)	L1TD1 ECAT11	Homo sapiens (Human)	"transposition, RNA-mediated [GO:0032197]"	intracellular membrane-bounded organelle [GO:0043231]; ribonucleoprotein complex [GO:1990904]	single-stranded RNA binding [GO:0003727]	DIAPVLDLK	0.036145	11.3714	10.9028	10.8981	10.7148	10.6907	10.8387	11.0623	10.7755	10.7893	11.0572	11.0983	11.1485
P0DOY3	IGLC3_HUMAN	Immunoglobulin lambda constant 3 (Ig lambda chain C region DOT) (Ig lambda chain C region NEWM) (Ig lambda-3 chain C regions)	IGLC3	Homo sapiens (Human)	"adaptive immune response [GO:0002250]; B cell receptor signaling pathway [GO:0050853]; complement activation, classical pathway [GO:0006958]; defense response to bacterium [GO:0042742]; innate immune response [GO:0045087]; phagocytosis, engulfment [GO:0006911]; phagocytosis, recognition [GO:0006910]; positive regulation of B cell activation [GO:0050871]"	"blood microparticle [GO:0072562]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; IgA immunoglobulin complex [GO:0071745]; IgD immunoglobulin complex [GO:0071738]; IgE immunoglobulin complex [GO:0071742]; IgG immunoglobulin complex [GO:0071735]; IgM immunoglobulin complex [GO:0071753]; immunoglobulin complex, circulating [GO:0042571]; plasma membrane [GO:0005886]"	antigen binding [GO:0003823]; immunoglobulin receptor binding [GO:0034987]	AAPSVTLFPPSSEELQANK	0	11.7554	10.5574	10.5083	11.242	10.237	10.1758	11.597	11.7002	11.5055	10.2465	10.625	10.9355
P00738	HPT_HUMAN	Haptoglobin (Zonulin) [Cleaved into: Haptoglobin alpha chain; Haptoglobin beta chain]	HP	Homo sapiens (Human)	acute inflammatory response [GO:0002526]; acute-phase response [GO:0006953]; defense response [GO:0006952]; defense response to bacterium [GO:0042742]; immune system process [GO:0002376]; negative regulation of hydrogen peroxide catabolic process [GO:2000296]; negative regulation of oxidoreductase activity [GO:0051354]; positive regulation of cell death [GO:0010942]; response to hydrogen peroxide [GO:0042542]; zymogen activation [GO:0031638]	blood microparticle [GO:0072562]; endocytic vesicle lumen [GO:0071682]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; haptoglobin-hemoglobin complex [GO:0031838]; specific granule lumen [GO:0035580]; tertiary granule lumen [GO:1904724]	antioxidant activity [GO:0016209]; hemoglobin binding [GO:0030492]; serine-type endopeptidase activity [GO:0004252]	DIAPTLTLYVGK	0	13.429	12.755	12.1518	10.7343	11.3456	10.7582	10.9583	10.2166	10.5705	8.44079	9.81429	9.8402
P01009	A1AT_HUMAN	Alpha-1-antitrypsin (Alpha-1 protease inhibitor) (Alpha-1-antiproteinase) (Serpin A1) [Cleaved into: Short peptide from AAT (SPAAT)]	SERPINA1 AAT PI PRO0684 PRO2209	Homo sapiens (Human)	acute-phase response [GO:0006953]; blood coagulation [GO:0007596]; negative regulation of endopeptidase activity [GO:0010951]	collagen-containing extracellular matrix [GO:0062023]; COPII-coated ER to Golgi transport vesicle [GO:0030134]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; platelet alpha granule lumen [GO:0031093]	identical protein binding [GO:0042802]; protease binding [GO:0002020]; serine-type endopeptidase inhibitor activity [GO:0004867]	AVLTIDEK	0	12.1946	11.0924	10.8598	10.9316	11.1538	10.6827	11.7028	10.4393	10.8576	9.56779	10.1707	10.6968
Q96RL1	UIMC1_HUMAN	BRCA1-A complex subunit RAP80 (Receptor-associated protein 80) (Retinoid X receptor-interacting protein 110) (Ubiquitin interaction motif-containing protein 1)	UIMC1 RAP80 RXRIP110	Homo sapiens (Human)	chromatin organization [GO:0006325]; double-strand break repair [GO:0006302]; histone H2A K63-linked deubiquitination [GO:0070537]; mitotic G2 DNA damage checkpoint signaling [GO:0007095]; mitotic G2/M transition checkpoint [GO:0044818]; negative regulation of DNA-templated transcription [GO:0045892]; positive regulation of DNA repair [GO:0045739]; regulation of DNA repair [GO:0006282]; response to ionizing radiation [GO:0010212]	BRCA1-A complex [GO:0070531]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	DNA binding [GO:0003677]; histone binding [GO:0042393]; K63-linked polyubiquitin modification-dependent protein binding [GO:0070530]; metal ion binding [GO:0046872]	NECISEDMGDEDK	0.74699	11.8972	11.7911	11.5923	10.3517	10.4803	10.238	10.196	10.41	10.346	10.9895	10.9427	10.9431
P04264	K2C1_HUMAN	"Keratin, type II cytoskeletal 1 (67 kDa cytokeratin) (Cytokeratin-1) (CK-1) (Hair alpha protein) (Keratin-1) (K1) (Type-II keratin Kb1)"	KRT1 KRTA	Homo sapiens (Human)	"complement activation, lectin pathway [GO:0001867]; establishment of skin barrier [GO:0061436]; fibrinolysis [GO:0042730]; intermediate filament organization [GO:0045109]; keratinization [GO:0031424]; negative regulation of inflammatory response [GO:0050728]; peptide cross-linking [GO:0018149]; protein heterotetramerization [GO:0051290]; regulation of angiogenesis [GO:0045765]; response to oxidative stress [GO:0006979]; retina homeostasis [GO:0001895]"	blood microparticle [GO:0072562]; collagen-containing extracellular matrix [GO:0062023]; cornified envelope [GO:0001533]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; keratin filament [GO:0045095]; membrane [GO:0016020]; nucleus [GO:0005634]	carbohydrate binding [GO:0030246]; protein heterodimerization activity [GO:0046982]; signaling receptor activity [GO:0038023]; structural constituent of skin epidermis [GO:0030280]	AEAESLYQSK	0	12.9456	10.8034	11.1143	10.7715	9.85577	9.64506	11.3227	8.76065	9.88606	11.2679	11.4469	11.7657
P02671	FIBA_HUMAN	Fibrinogen alpha chain [Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain]	FGA	Homo sapiens (Human)	"adaptive immune response [GO:0002250]; blood coagulation, common pathway [GO:0072377]; blood coagulation, fibrin clot formation [GO:0072378]; cell-matrix adhesion [GO:0007160]; fibrinolysis [GO:0042730]; induction of bacterial agglutination [GO:0043152]; innate immune response [GO:0045087]; negative regulation of blood coagulation, common pathway [GO:2000261]; negative regulation of endothelial cell apoptotic process [GO:2000352]; negative regulation of extrinsic apoptotic signaling pathway via death domain receptors [GO:1902042]; plasminogen activation [GO:0031639]; platelet aggregation [GO:0070527]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of exocytosis [GO:0045921]; positive regulation of heterotypic cell-cell adhesion [GO:0034116]; positive regulation of peptide hormone secretion [GO:0090277]; positive regulation of protein secretion [GO:0050714]; positive regulation of substrate adhesion-dependent cell spreading [GO:1900026]; positive regulation of vasoconstriction [GO:0045907]; protein polymerization [GO:0051258]; protein-containing complex assembly [GO:0065003]; response to calcium ion [GO:0051592]"	blood microparticle [GO:0072562]; cell surface [GO:0009986]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; extracellular vesicle [GO:1903561]; fibrinogen complex [GO:0005577]; plasma membrane [GO:0005886]; platelet alpha granule [GO:0031091]; platelet alpha granule lumen [GO:0031093]	extracellular matrix structural constituent [GO:0005201]; metal ion binding [GO:0046872]; signaling receptor binding [GO:0005102]; structural molecule activity [GO:0005198]	ALTDMPQMR	0	12.8034	10.909	11.2949	9.90244	10.592	9.35242	11.6978	10.9043	11.4291	9.23881	9.32796	10.1343
P01834	IGKC_HUMAN	Immunoglobulin kappa constant (Ig kappa chain C region) (Ig kappa chain C region AG) (Ig kappa chain C region CUM) (Ig kappa chain C region EU) (Ig kappa chain C region OU) (Ig kappa chain C region ROY) (Ig kappa chain C region TI)	IGKC	Homo sapiens (Human)	"adaptive immune response [GO:0002250]; B cell receptor signaling pathway [GO:0050853]; complement activation, classical pathway [GO:0006958]; defense response to bacterium [GO:0042742]; immune response [GO:0006955]; innate immune response [GO:0045087]; phagocytosis, engulfment [GO:0006911]; phagocytosis, recognition [GO:0006910]; positive regulation of B cell activation [GO:0050871]; retina homeostasis [GO:0001895]"	"blood microparticle [GO:0072562]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; IgA immunoglobulin complex [GO:0071745]; IgD immunoglobulin complex [GO:0071738]; IgE immunoglobulin complex [GO:0071742]; IgG immunoglobulin complex [GO:0071735]; IgM immunoglobulin complex [GO:0071753]; immunoglobulin complex, circulating [GO:0042571]; plasma membrane [GO:0005886]"	antigen binding [GO:0003823]; immunoglobulin receptor binding [GO:0034987]	DSTYSLSSTLTLSK	0	0	12.5811	12.4711	12.7759	12.8071	12.7203	12.8175	13.0378	13.0366	12.2849	0	12.3413
Q96LZ3	CANB2_HUMAN	Calcineurin subunit B type 2 (Calcineurin B-like protein) (CBLP) (Calcineurin BII) (CNBII) (PPP3R1-like) (Protein phosphatase 2B regulatory subunit 2) (Protein phosphatase 3 regulatory subunit B beta isoform)	PPP3R2 CBLP PPP3RL	Homo sapiens (Human)	calcineurin-mediated signaling [GO:0097720]; negative regulation of calcium ion import across plasma membrane [GO:1905949]; negative regulation of voltage-gated calcium channel activity [GO:1901386]; penetration of zona pellucida [GO:0007341]; positive regulation of calcineurin-NFAT signaling cascade [GO:0070886]; positive regulation of calcium ion import across plasma membrane [GO:1905665]; positive regulation of voltage-gated calcium channel activity [GO:1901387]; protein dephosphorylation [GO:0006470]	calcineurin complex [GO:0005955]; cytosol [GO:0005829]; mitochondrion [GO:0005739]; protein serine/threonine phosphatase complex [GO:0008287]; sperm mitochondrial sheath [GO:0097226]	calcium ion binding [GO:0005509]; calcium-dependent protein serine/threonine phosphatase regulator activity [GO:0008597]; phosphatase binding [GO:0019902]	DLEIHKK	0.67434	11.2527	10.6757	10.6883	10.3194	10.4476	10.4449	10.632	10.2351	10.2113	10.5851	10.673	10.6355
P01024	CO3_HUMAN	Complement C3 (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1) [Cleaved into: Complement C3 beta chain; C3-beta-c (C3bc); Complement C3 alpha chain; C3a anaphylatoxin; Acylation stimulating protein (ASP) (C3adesArg); Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3dg fragment; Complement C3g fragment; Complement C3d fragment; Complement C3f fragment; Complement C3c alpha' chain fragment 2]	C3 CPAMD1	Homo sapiens (Human)	"amyloid-beta clearance [GO:0097242]; cell surface receptor signaling pathway involved in cell-cell signaling [GO:1905114]; complement activation [GO:0006956]; complement activation, alternative pathway [GO:0006957]; complement activation, classical pathway [GO:0006958]; complement-dependent cytotoxicity [GO:0097278]; complement-mediated synapse pruning [GO:0150062]; fatty acid metabolic process [GO:0006631]; G protein-coupled receptor signaling pathway [GO:0007186]; immune response [GO:0006955]; inflammatory response [GO:0006954]; neuron remodeling [GO:0016322]; opsonization [GO:0008228]; oviduct epithelium development [GO:0035846]; positive regulation of activation of membrane attack complex [GO:0001970]; positive regulation of angiogenesis [GO:0045766]; positive regulation of apoptotic cell clearance [GO:2000427]; positive regulation of apoptotic process in another organism [GO:0044533]; positive regulation of G protein-coupled receptor signaling pathway [GO:0045745]; positive regulation of glucose transmembrane transport [GO:0010828]; positive regulation of immune response [GO:0050778]; positive regulation of lipid storage [GO:0010884]; positive regulation of opsonization [GO:1903028]; positive regulation of phagocytosis [GO:0050766]; positive regulation of phagocytosis, engulfment [GO:0060100]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of receptor-mediated endocytosis [GO:0048260]; positive regulation of type IIa hypersensitivity [GO:0001798]; positive regulation of vascular endothelial growth factor production [GO:0010575]; proteolysis [GO:0006508]; regulation of complement activation [GO:0030449]; regulation of complement activation, alternative pathway [GO:0030451]; regulation of triglyceride biosynthetic process [GO:0010866]; response to bacterium [GO:0009617]; signal transduction [GO:0007165]; vertebrate eye-specific patterning [GO:0150064]"	azurophil granule lumen [GO:0035578]; blood microparticle [GO:0072562]; cell surface [GO:0009986]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; secretory granule lumen [GO:0034774]; serine-type endopeptidase complex [GO:1905370]	C5L2 anaphylatoxin chemotactic receptor binding [GO:0031715]; endopeptidase inhibitor activity [GO:0004866]; signaling receptor binding [GO:0005102]	ACEPGVDYVYK	0	12.5517	10.651	10.7138	10.1009	10.1041	11.0484	11.1396	10.0599	10.666	9.17195	9.90991	10.0423
P36269	GGT5_HUMAN	Glutathione hydrolase 5 proenzyme (EC 3.4.19.13) (Gamma-glutamyl transpeptidase-related enzyme) (GGT-rel) (Gamma-glutamyltransferase 5) (GGT 5) (EC 2.3.2.2) (Gamma-glutamyltransferase-like activity 1) (Gamma-glutamyltranspeptidase 5) (Leukotriene-C4 hydrolase) (EC 3.4.19.14) [Cleaved into: Glutathione hydrolase 5 heavy chain; Glutathione hydrolase 5 light chain]	GGT5 GGTLA1	Homo sapiens (Human)	cellular amino acid metabolic process [GO:0006520]; fatty acid metabolic process [GO:0006631]; glutathione biosynthetic process [GO:0006750]; glutathione catabolic process [GO:0006751]; inflammatory response [GO:0006954]; leukotriene D4 biosynthetic process [GO:1901750]; proteolysis [GO:0006508]	integral component of membrane [GO:0016021]; intrinsic component of plasma membrane [GO:0031226]; plasma membrane [GO:0005886]	glutathione hydrolase activity [GO:0036374]; hypoglycin A gamma-glutamyl transpeptidase activity [GO:0102953]; leukotriene C4 gamma-glutamyl transferase activity [GO:0103068]; leukotriene-C(4) hydrolase [GO:0002951]; peptidyltransferase activity [GO:0000048]	VGGAPGR	0.8318	11.1853	16.6784	9.81676	9.73981	9.95232	9.72209	9.51816	9.69995	9.82053	10.2489	10.2863	9.26826
Q12912	IRAG2_HUMAN	"Inositol 1,4,5-triphosphate receptor associated 2 (Lymphoid-restricted membrane protein) (Protein Jaw1) [Cleaved into: Processed inositol 1,4,5-triphosphate receptor associated 2]"	IRAG2 JAW1 LRMP	Homo sapiens (Human)	immune system process [GO:0002376]; nucleus organization [GO:0006997]; single fertilization [GO:0007338]; vesicle fusion [GO:0006906]; vesicle targeting [GO:0006903]	azurophil granule membrane [GO:0035577]; chromosome [GO:0005694]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; microtubule organizing center [GO:0005815]; nuclear envelope [GO:0005635]; plasma membrane [GO:0005886]; spindle pole [GO:0000922]	microtubule binding [GO:0008017]	VTIASLPR	0.078652	12.2629	0	10.5231	10.3314	10.3165	10.2289	11.7305	10.3797	10.4609	10.8374	10.9912	11.1232
O00418	EF2K_HUMAN	Eukaryotic elongation factor 2 kinase (eEF-2 kinase) (eEF-2K) (EC 2.7.11.20) (Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase)	EEF2K	Homo sapiens (Human)	cellular response to anoxia [GO:0071454]; cellular response to brain-derived neurotrophic factor stimulus [GO:1990416]; cellular response to calcium ion [GO:0071277]; cellular response to cAMP [GO:0071320]; cellular response to insulin stimulus [GO:0032869]; negative regulation of apoptotic process [GO:0043066]; positive regulation of dendritic spine morphogenesis [GO:0061003]; positive regulation of endocytosis [GO:0045807]; positive regulation of synapse assembly [GO:0051965]; protein autophosphorylation [GO:0046777]; regulation of protein autophosphorylation [GO:0031952]; response to ischemia [GO:0002931]; response to prolactin [GO:1990637]; translational elongation [GO:0006414]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendritic spine [GO:0043197]; postsynaptic density [GO:0014069]	"ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; calmodulin binding [GO:0005516]; elongation factor-2 kinase activity [GO:0004686]; protein kinase activity [GO:0004672]; protein serine/threonine kinase activity [GO:0004674]; translation factor activity, RNA binding [GO:0008135]"	AAEAGDR	0.61053	12.4182	0	12.1318	11.2055	11.2271	11.2454	11.9114	11.6566	11.6278	11.7784	11.7544	0
Q5XKP0	MIC13_HUMAN	MICOS complex subunit MIC13 (Protein P117)	MICOS13 C19orf70 MIC13 QIL1	Homo sapiens (Human)	cristae formation [GO:0042407]; inner mitochondrial membrane organization [GO:0007007]	MIB complex [GO:0140275]; MICOS complex [GO:0061617]; mitochondrial crista junction [GO:0044284]; mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; SAM complex [GO:0001401]		SQAALQK	0.93301	12.4351	12.3645	12.1671	10.747	0	10.7559	10.7995	10.842	10.8593	11.5932	11.6424	0
Q8NGC1	O11G2_HUMAN	Olfactory receptor 11G2 (Olfactory receptor OR14-34)	OR11G2	Homo sapiens (Human)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	VPSAAGR	0.74006	11.4742	11.6968	11.6524	9.64368	9.74581	9.70504	9.06843	0	9.21468	11.4445	10.711	9.40884
P01871	IGHM_HUMAN	Immunoglobulin heavy constant mu (Ig mu chain C region) (Ig mu chain C region BOT) (Ig mu chain C region GAL) (Ig mu chain C region OU)	IGHM	Homo sapiens (Human)	"adaptive immune response [GO:0002250]; antibacterial humoral response [GO:0019731]; B cell receptor signaling pathway [GO:0050853]; complement activation, classical pathway [GO:0006958]; defense response to bacterium [GO:0042742]; defense response to Gram-negative bacterium [GO:0050829]; innate immune response [GO:0045087]; phagocytosis, engulfment [GO:0006911]; phagocytosis, recognition [GO:0006910]; positive regulation of B cell activation [GO:0050871]"	"blood microparticle [GO:0072562]; cell surface [GO:0009986]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; hexameric IgM immunoglobulin complex [GO:0071757]; IgM immunoglobulin complex [GO:0071753]; immunoglobulin complex, circulating [GO:0042571]; integral component of membrane [GO:0016021]; pentameric IgM immunoglobulin complex [GO:0071756]; plasma membrane [GO:0005886]"	antigen binding [GO:0003823]	DGFFGNPR	0	12.2918	10.6918	10.0024	9.81721	9.68898	9.1352	10.2016	10.1294	9.96881	9.75193	0	9.82024
P02675	FIBB_HUMAN	Fibrinogen beta chain [Cleaved into: Fibrinopeptide B; Fibrinogen beta chain]	FGB	Homo sapiens (Human)	"adaptive immune response [GO:0002250]; blood coagulation, fibrin clot formation [GO:0072378]; cell adhesion [GO:0007155]; cell-matrix adhesion [GO:0007160]; cellular response to interleukin-1 [GO:0071347]; cellular response to leptin stimulus [GO:0044320]; fibrinolysis [GO:0042730]; induction of bacterial agglutination [GO:0043152]; innate immune response [GO:0045087]; negative regulation of endothelial cell apoptotic process [GO:2000352]; negative regulation of extrinsic apoptotic signaling pathway via death domain receptors [GO:1902042]; plasminogen activation [GO:0031639]; platelet aggregation [GO:0070527]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of exocytosis [GO:0045921]; positive regulation of heterotypic cell-cell adhesion [GO:0034116]; positive regulation of peptide hormone secretion [GO:0090277]; positive regulation of protein secretion [GO:0050714]; positive regulation of substrate adhesion-dependent cell spreading [GO:1900026]; positive regulation of vasoconstriction [GO:0045907]; protein polymerization [GO:0051258]; protein-containing complex assembly [GO:0065003]; response to calcium ion [GO:0051592]"	blood microparticle [GO:0072562]; cell cortex [GO:0005938]; cell surface [GO:0009986]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum [GO:0005783]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; extracellular vesicle [GO:1903561]; fibrinogen complex [GO:0005577]; plasma membrane [GO:0005886]; platelet alpha granule [GO:0031091]; platelet alpha granule lumen [GO:0031093]; synapse [GO:0045202]	chaperone binding [GO:0051087]; extracellular matrix structural constituent [GO:0005201]; signaling receptor binding [GO:0005102]; structural molecule activity [GO:0005198]	DNDGWLTSDPR	0	12.66	10.814	10.8519	9.16159	0	9.14919	10.6724	8.99639	10.0623	9.04917	9.20269	9.32674
P02679	FIBG_HUMAN	Fibrinogen gamma chain	FGG PRO2061	Homo sapiens (Human)	"blood coagulation, fibrin clot formation [GO:0072378]; cell-matrix adhesion [GO:0007160]; cellular response to interleukin-1 [GO:0071347]; cellular response to interleukin-6 [GO:0071354]; fibrinolysis [GO:0042730]; negative regulation of endothelial cell apoptotic process [GO:2000352]; negative regulation of extrinsic apoptotic signaling pathway via death domain receptors [GO:1902042]; negative regulation of platelet aggregation [GO:0090331]; plasminogen activation [GO:0031639]; platelet aggregation [GO:0070527]; platelet maturation [GO:0036345]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of exocytosis [GO:0045921]; positive regulation of heterotypic cell-cell adhesion [GO:0034116]; positive regulation of peptide hormone secretion [GO:0090277]; positive regulation of protein secretion [GO:0050714]; positive regulation of substrate adhesion-dependent cell spreading [GO:1900026]; positive regulation of vasoconstriction [GO:0045907]; protein polymerization [GO:0051258]; protein secretion [GO:0009306]; protein-containing complex assembly [GO:0065003]; response to calcium ion [GO:0051592]"	blood microparticle [GO:0072562]; cell surface [GO:0009986]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum lumen [GO:0005788]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; fibrinogen complex [GO:0005577]; plasma membrane [GO:0005886]; platelet alpha granule [GO:0031091]; platelet alpha granule lumen [GO:0031093]	cell adhesion molecule binding [GO:0050839]; extracellular matrix structural constituent [GO:0005201]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; signaling receptor binding [GO:0005102]; structural molecule activity [GO:0005198]	AIQLTYNPDESSKPNMIDAATLK	0	11.8399	10.5643	10.5366	9.25654	8.16053	0	10.8926	10.7078	10.352	9.72392	8.7021	9.11985
O14979	HNRDL_HUMAN	Heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like) (hnRNP DL) (AU-rich element RNA-binding factor) (JKT41-binding protein) (Protein laAUF1)	HNRNPDL HNRPDL JKTBP	Homo sapiens (Human)	regulation of gene expression [GO:0010468]; RNA processing [GO:0006396]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; spliceosomal complex [GO:0005681]	DNA binding [GO:0003677]; double-stranded DNA binding [GO:0003690]; poly(A) binding [GO:0008143]; poly(G) binding [GO:0034046]; RNA binding [GO:0003723]; single-stranded DNA binding [GO:0003697]	GAAAGGR	0.41611	0	11.013	11.0704	0	10.8307	10.7083	11.059	10.6574	10.6705	11.0294	11.0226	10.9577
P20396	TRH_HUMAN	Pro-thyrotropin-releasing hormone (Pro-TRH) (Prothyroliberin) [Cleaved into: Thyrotropin-releasing hormone (TRH) (Protirelin) (TSH-releasing factor) (Thyroliberin) (Thyrotropin-releasing factor) (TRF)]	TRH	Homo sapiens (Human)	adult walking behavior [GO:0007628]; cell-cell signaling [GO:0007267]; eating behavior [GO:0042755]; histamine metabolic process [GO:0001692]; hormone-mediated signaling pathway [GO:0009755]; negative regulation of glutamate secretion [GO:0014050]; positive regulation of gamma-aminobutyric acid secretion [GO:0014054]; positive regulation of insulin secretion [GO:0032024]; signal transduction [GO:0007165]	extracellular region [GO:0005576]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; secretory granule [GO:0030141]	thyrotropin-releasing hormone activity [GO:0008437]	SWEEEEEEEER	0.92105	10.5595	10.2642	10.1957	9.44781	9.2534	9.31488	9.96506	9.68155	9.66494	0	9.95297	10.0149
P68871	HBB_HUMAN	Hemoglobin subunit beta (Beta-globin) (Hemoglobin beta chain) [Cleaved into: LVV-hemorphin-7; Spinorphin]	HBB	Homo sapiens (Human)	blood vessel diameter maintenance [GO:0097746]; carbon dioxide transport [GO:0015670]; cellular oxidant detoxification [GO:0098869]; hydrogen peroxide catabolic process [GO:0042744]; nitric oxide transport [GO:0030185]; oxygen transport [GO:0015671]; platelet aggregation [GO:0070527]; positive regulation of cell death [GO:0010942]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; regulation of blood pressure [GO:0008217]; renal absorption [GO:0070293]; response to hydrogen peroxide [GO:0042542]	blood microparticle [GO:0072562]; cytosol [GO:0005829]; endocytic vesicle lumen [GO:0071682]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; haptoglobin-hemoglobin complex [GO:0031838]; hemoglobin complex [GO:0005833]; tertiary granule lumen [GO:1904724]	heme binding [GO:0020037]; hemoglobin alpha binding [GO:0031721]; hemoglobin binding [GO:0030492]; metal ion binding [GO:0046872]; organic acid binding [GO:0043177]; oxygen binding [GO:0019825]; oxygen carrier activity [GO:0005344]	EFTPPVQAAYQK	0	10.41	8.75342	8.55394	9.15823	9.51426	9.4564	9.1736	8.39746	8.35531	8.40654	8.70777	8.74702
P69905	HBA_HUMAN	Hemoglobin subunit alpha (Alpha-globin) (Hemoglobin alpha chain) [Cleaved into: Hemopressin]	HBA1; HBA2	Homo sapiens (Human)	carbon dioxide transport [GO:0015670]; cellular oxidant detoxification [GO:0098869]; hydrogen peroxide catabolic process [GO:0042744]; nitric oxide transport [GO:0030185]; oxygen transport [GO:0015671]; positive regulation of cell death [GO:0010942]; response to hydrogen peroxide [GO:0042542]	blood microparticle [GO:0072562]; cytosol [GO:0005829]; cytosolic small ribosomal subunit [GO:0022627]; endocytic vesicle lumen [GO:0071682]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; haptoglobin-hemoglobin complex [GO:0031838]; hemoglobin complex [GO:0005833]; membrane [GO:0016020]	G protein-coupled receptor binding [GO:0001664]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; organic acid binding [GO:0043177]; oxygen binding [GO:0019825]; oxygen carrier activity [GO:0005344]	MFLSFPTTK	0	9.98442	10.7725	8.93372	9.96102	9.82259	9.92107	9.87925	10.1128	9.14631	8.92671	0	9.28575
Q76NI1	KNDC1_HUMAN	Kinase non-catalytic C-lobe domain-containing protein 1 (KIND domain-containing protein 1) (Cerebral protein 9) (Protein very KIND) (v-KIND) (Ras-GEF domain-containing family member 2)	KNDC1 C10orf23 KIAA1768 RASGEF2 VKIND hucep-9	Homo sapiens (Human)	cerebellar granule cell differentiation [GO:0021707]; positive regulation of protein phosphorylation [GO:0001934]; regulation of dendrite development [GO:0050773]; regulation of dendrite morphogenesis [GO:0048814]; small GTPase mediated signal transduction [GO:0007264]	dendrite [GO:0030425]; guanyl-nucleotide exchange factor complex [GO:0032045]; neuronal cell body [GO:0043025]; perikaryon [GO:0043204]	guanyl-nucleotide exchange factor activity [GO:0005085]	ALLSTPVR	0.29323	0	10.5092	10.5231	10.3314	10.3165	10.2289	11.7305	10.3797	10.4609	10.8374	0	11.1232
Q6ZNB6	NFXL1_HUMAN	NF-X1-type zinc finger protein NFXL1 (Ovarian zinc finger protein) (hOZFP)	NFXL1 OZFP	Homo sapiens (Human)	regulation of DNA-templated transcription [GO:0006355]	chromatin [GO:0000785]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; zinc ion binding [GO:0008270]"	CNCGNTK	0.87421	0	10.8848	10.7105	10.1614	10.1261	10.013	11.507	0	10.3272	10.6057	10.5335	10.7202
Q8IVL5	P3H2_HUMAN	Prolyl 3-hydroxylase 2 (EC 1.14.11.7) (Leprecan-like protein 1) (Myxoid liposarcoma-associated protein 4)	P3H2 LEPREL1 MLAT4	Homo sapiens (Human)	collagen metabolic process [GO:0032963]; negative regulation of cell population proliferation [GO:0008285]; peptidyl-proline hydroxylation [GO:0019511]	basement membrane [GO:0005604]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; nucleoplasm [GO:0005654]; sarcoplasmic reticulum [GO:0016529]	iron ion binding [GO:0005506]; L-ascorbic acid binding [GO:0031418]; procollagen-proline 3-dioxygenase activity [GO:0019797]	LGGPASR	0.83707	0	0	0	14.7935	14.7608	14.7377	14.6306	14.9106	14.9778	0	0	15.4254
P02790	HEMO_HUMAN	Hemopexin (Beta-1B-glycoprotein)	HPX	Homo sapiens (Human)	cellular iron ion homeostasis [GO:0006879]; heme metabolic process [GO:0042168]; heme transport [GO:0015886]; hemoglobin metabolic process [GO:0020027]; interferon-gamma-mediated signaling pathway [GO:0060333]; positive regulation of humoral immune response mediated by circulating immunoglobulin [GO:0002925]; positive regulation of immunoglobulin production [GO:0002639]; positive regulation of interferon-gamma-mediated signaling pathway [GO:0060335]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]; tyrosine phosphorylation of STAT protein [GO:0007260]	blood microparticle [GO:0072562]; collagen-containing extracellular matrix [GO:0062023]; endocytic vesicle lumen [GO:0071682]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]	heme transmembrane transporter activity [GO:0015232]; metal ion binding [GO:0046872]	DVRDYFMPCPGR	0	11.1863	10.4544	10.5296	0	8.94971	8.86536	9.39688	8.84392	9.54263	8.27347	8.32679	8.28133
Q96PY5	FMNL2_HUMAN	Formin-like protein 2 (Formin homology 2 domain-containing protein 2)	FMNL2 FHOD2 KIAA1902	Homo sapiens (Human)	cell migration [GO:0016477]; cortical actin cytoskeleton organization [GO:0030866]; cytoskeleton organization [GO:0007010]; regulation of cell morphogenesis [GO:0022604]; regulation of cell shape [GO:0008360]	cytosol [GO:0005829]	actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; small GTPase binding [GO:0031267]	QSTLEKK	0.99976	0	12.1396	11.9382	10.7242	10.7277	10.6748	10.548	0	10.7505	11.5128	11.613	0
P42166	LAP2A_HUMAN	"Lamina-associated polypeptide 2, isoform alpha (Thymopoietin isoform alpha) (TP alpha) (Thymopoietin-related peptide isoform alpha) (TPRP isoform alpha) [Cleaved into: Thymopoietin (TP) (Splenin); Thymopentin (TP5)]"	TMPO LAP2	Homo sapiens (Human)		chromatin [GO:0000785]; nuclear envelope [GO:0005635]; nucleus [GO:0005634]	cadherin binding [GO:0045296]; DNA binding [GO:0003677]; lamin binding [GO:0005521]	LYEKKLLK	0.95012	0	11.6186	11.5068	10.6775	10.708	0	10.7824	10.8477	0	11.1062	11.3365	11.3583
Q8WY91	THAP4_HUMAN	Peroxynitrite isomerase THAP4 (EC 5.99.-.-) (Ferric Homo sapiens nitrobindin) (Hs-Nb(III)) (THAP domain-containing protein 4)	THAP4 CGI-36 PP238	Homo sapiens (Human)	nitrate metabolic process [GO:0042126]; tyrosine metabolic process [GO:0006570]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	DNA binding [GO:0003677]; heme binding [GO:0020037]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; nitric oxide binding [GO:0070026]; peroxynitrite isomerase activity [GO:0062213]	MVICCAAVNCSNR	0.99745	13.4058	0	12.9868	11.6387	11.7997	0	11.8882	0	12.0267	0	12.5656	12.5007
Q99435	NELL2_HUMAN	Protein kinase C-binding protein NELL2 (NEL-like protein 2) (Nel-related protein 2)	NELL2 NRP2	Homo sapiens (Human)	fertilization [GO:0009566]; neuron cellular homeostasis [GO:0070050]	cytoplasm [GO:0005737]; extracellular region [GO:0005576]	calcium ion binding [GO:0005509]; heparin binding [GO:0008201]; protein kinase C binding [GO:0005080]	LDQCYCER	0.91864	0	10.1697	0	9.44147	9.51846	9.50456	10.1713	9.76295	9.77993	10.0222	10.072	10.1841
O15417	TNC18_HUMAN	Trinucleotide repeat-containing gene 18 protein (Long CAG trinucleotide repeat-containing gene 79 protein)	TNRC18 CAGL79 KIAA1856	Homo sapiens (Human)		cytosol [GO:0005829]; mitochondrion [GO:0005739]; nuclear membrane [GO:0031965]; nucleoplasm [GO:0005654]	chromatin binding [GO:0003682]	GPGRPRK	0.99836	0	13.2107	0	11.7611	11.7097	11.6706	11.4334	11.6914	11.738	12.599	0	0
Q9UPN3	MACF1_HUMAN	"Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4/5 (620 kDa actin-binding protein) (ABP620) (Actin cross-linking family protein 7) (Macrophin-1) (Trabeculin-alpha)"	MACF1 ABP620 ACF7 KIAA0465 KIAA0754 KIAA1251	Homo sapiens (Human)	Golgi to plasma membrane protein transport [GO:0043001]; intermediate filament cytoskeleton organization [GO:0045104]; positive regulation of axon extension [GO:0045773]; positive regulation of Wnt signaling pathway [GO:0030177]; regulation of cell migration [GO:0030334]; regulation of epithelial cell migration [GO:0010632]; regulation of focal adhesion assembly [GO:0051893]; regulation of microtubule-based process [GO:0032886]; regulation of neuron projection arborization [GO:0150011]; Wnt signaling pathway [GO:0016055]; wound healing [GO:0042060]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]; microtubule [GO:0005874]; plasma membrane [GO:0005886]; ruffle membrane [GO:0032587]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; calcium ion binding [GO:0005509]; microtubule minus-end binding [GO:0051011]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198]	RGLNKPSK	0.99856	0	12.6304	0	0	11.4973	11.3561	11.2921	0	11.3457	12.2212	12.2694	12.3165
O15015	ZN646_HUMAN	Zinc finger protein 646	ZNF646 KIAA0296	Homo sapiens (Human)	regulation of DNA-templated transcription [GO:0006355]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	GPGESVERAR	0.98436	11.5161	10.9283	0	0	0	0	11.8388	12.4004	11.5023	11.3896	11.4728	11.5313
Q96KK4	O10C1_HUMAN	Olfactory receptor 10C1 (Hs6M1-17) (Olfactory receptor 10C2)	OR10C1 OR10C2	Homo sapiens (Human)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	IPSVAGRR	0.99778	0	0	13.3008	11.8444	11.8779	11.7966	11.7456	0	11.7304	0	0	12.684
Q01064	PDE1B_HUMAN	"Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B (Cam-PDE 1B) (EC 3.1.4.17) (63 kDa Cam-PDE)"	PDE1B PDES1B	Homo sapiens (Human)	cellular response to granulocyte macrophage colony-stimulating factor stimulus [GO:0097011]; cellular response to macrophage colony-stimulating factor stimulus [GO:0036006]; locomotory behavior [GO:0007626]; monocyte differentiation [GO:0030224]; regulation of dopamine metabolic process [GO:0042053]; regulation of neurotransmitter levels [GO:0001505]; response to amphetamine [GO:0001975]; serotonin metabolic process [GO:0042428]; signal transduction [GO:0007165]; visual learning [GO:0008542]	cytosol [GO:0005829]; neuronal cell body [GO:0043025]	"3',5'-cyclic-AMP phosphodiesterase activity [GO:0004115]; 3',5'-cyclic-GMP phosphodiesterase activity [GO:0047555]; 3',5'-cyclic-nucleotide phosphodiesterase activity [GO:0004114]; calmodulin binding [GO:0005516]; calmodulin-activated 3',5'-cyclic-GMP phosphodiesterase activity [GO:0048101]; calmodulin-activated dual specificity 3',5'-cyclic-GMP, 3',5'-cyclic-AMP phosphodiesterase activity [GO:0004117]; metal ion binding [GO:0046872]"	SECAIVYNDR	0.87545	10.1936	9.41792	9.20731	0	0	0	9.39025	8.35724	9.42861	8.92615	9.04437	9.05512
P21359	NF1_HUMAN	Neurofibromin (Neurofibromatosis-related protein NF-1) [Cleaved into: Neurofibromin truncated]	NF1	Homo sapiens (Human)	"actin cytoskeleton organization [GO:0030036]; adrenal gland development [GO:0030325]; amygdala development [GO:0021764]; angiogenesis [GO:0001525]; artery morphogenesis [GO:0048844]; brain development [GO:0007420]; camera-type eye morphogenesis [GO:0048593]; cell communication [GO:0007154]; cellular response to heat [GO:0034605]; cerebral cortex development [GO:0021987]; cognition [GO:0050890]; collagen fibril organization [GO:0030199]; endothelial cell proliferation [GO:0001935]; extracellular matrix organization [GO:0030198]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; extrinsic apoptotic signaling pathway via death domain receptors [GO:0008625]; fibroblast proliferation [GO:0048144]; forebrain astrocyte development [GO:0021897]; forebrain morphogenesis [GO:0048853]; gamma-aminobutyric acid secretion, neurotransmission [GO:0061534]; glutamate secretion, neurotransmission [GO:0061535]; hair follicle maturation [GO:0048820]; heart development [GO:0007507]; liver development [GO:0001889]; MAPK cascade [GO:0000165]; mast cell apoptotic process [GO:0033024]; mast cell proliferation [GO:0070662]; metanephros development [GO:0001656]; myelination in peripheral nervous system [GO:0022011]; myeloid leukocyte migration [GO:0097529]; negative regulation of angiogenesis [GO:0016525]; negative regulation of astrocyte differentiation [GO:0048712]; negative regulation of cell migration [GO:0030336]; negative regulation of cell-matrix adhesion [GO:0001953]; negative regulation of endothelial cell proliferation [GO:0001937]; negative regulation of fibroblast proliferation [GO:0048147]; negative regulation of leukocyte migration [GO:0002686]; negative regulation of MAP kinase activity [GO:0043407]; negative regulation of MAPK cascade [GO:0043409]; negative regulation of mast cell proliferation [GO:0070667]; negative regulation of neuroblast proliferation [GO:0007406]; negative regulation of neurotransmitter secretion [GO:0046929]; negative regulation of oligodendrocyte differentiation [GO:0048715]; negative regulation of osteoclast differentiation [GO:0045671]; negative regulation of protein import into nucleus [GO:0042308]; negative regulation of protein kinase activity [GO:0006469]; negative regulation of Rac protein signal transduction [GO:0035021]; negative regulation of Schwann cell migration [GO:1900148]; negative regulation of Schwann cell proliferation [GO:0010626]; negative regulation of stem cell proliferation [GO:2000647]; negative regulation of vascular associated smooth muscle cell migration [GO:1904753]; neural tube development [GO:0021915]; neuroblast proliferation [GO:0007405]; neuron apoptotic process [GO:0051402]; observational learning [GO:0098597]; oligodendrocyte differentiation [GO:0048709]; osteoblast differentiation [GO:0001649]; osteoclast differentiation [GO:0030316]; peripheral nervous system development [GO:0007422]; phosphatidylinositol 3-kinase signaling [GO:0014065]; pigmentation [GO:0043473]; positive regulation of adenylate cyclase activity [GO:0045762]; positive regulation of apoptotic process [GO:0043065]; positive regulation of endothelial cell proliferation [GO:0001938]; positive regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001241]; positive regulation of GTPase activity [GO:0043547]; positive regulation of mast cell apoptotic process [GO:0033027]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of vascular associated smooth muscle cell proliferation [GO:1904707]; protein import into nucleus [GO:0006606]; Rac protein signal transduction [GO:0016601]; Ras protein signal transduction [GO:0007265]; regulation of angiogenesis [GO:0045765]; regulation of blood vessel endothelial cell migration [GO:0043535]; regulation of bone resorption [GO:0045124]; regulation of cell-matrix adhesion [GO:0001952]; regulation of gene expression [GO:0010468]; regulation of glial cell differentiation [GO:0045685]; regulation of GTPase activity [GO:0043087]; regulation of long-term neuronal synaptic plasticity [GO:0048169]; regulation of long-term synaptic potentiation [GO:1900271]; regulation of synaptic transmission, GABAergic [GO:0032228]; response to hypoxia [GO:0001666]; Schwann cell development [GO:0014044]; Schwann cell migration [GO:0036135]; Schwann cell proliferation [GO:0014010]; skeletal muscle tissue development [GO:0007519]; smooth muscle tissue development [GO:0048745]; spinal cord development [GO:0021510]; stem cell proliferation [GO:0072089]; sympathetic nervous system development [GO:0048485]; vascular associated smooth muscle cell migration [GO:1904738]; vascular associated smooth muscle cell proliferation [GO:1990874]; visual learning [GO:0008542]; wound healing [GO:0042060]"	axon [GO:0030424]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; membrane [GO:0016020]; nucleolus [GO:0005730]; nucleus [GO:0005634]; presynapse [GO:0098793]	GTPase activator activity [GO:0005096]; phosphatidylcholine binding [GO:0031210]; phosphatidylethanolamine binding [GO:0008429]	QLTESAAIACVK	0.47027	11.5495	0	10.2033	9.58257	10.1371	10.156	10.9636	0	0	8.6738	0	10.5017
P20929	NEBU_HUMAN	Nebulin	NEB	Homo sapiens (Human)	cardiac muscle thin filament assembly [GO:0071691]; muscle organ development [GO:0007517]; regulation of actin filament length [GO:0030832]; somatic muscle development [GO:0007525]	actin cytoskeleton [GO:0015629]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; Z disc [GO:0030018]	actin filament binding [GO:0051015]; structural constituent of muscle [GO:0008307]	AAEILSDNIYR	0.99744	0	12.9985	9.23269	12.4629	0	12.5071	12.8483	9.09645	12.2998	0	0	0
Q96NL6	SCLT1_HUMAN	Sodium channel and clathrin linker 1 (Sodium channel-associated protein 1)	SCLT1 SAP1	Homo sapiens (Human)	cilium assembly [GO:0060271]; clustering of voltage-gated sodium channels [GO:0045162]	centriole [GO:0005814]; centrosome [GO:0005813]; ciliary transition fiber [GO:0097539]; clathrin complex [GO:0071439]; cytosol [GO:0005829]	clathrin binding [GO:0030276]; protein C-terminus binding [GO:0008022]; sodium channel regulator activity [GO:0017080]	ENCGLVSEQRLK	0.18261	0	9.05534	0	0	10.9884	11.0477	0	11.9435	12.0739	11.7902	0	12.0427
Q9H930	SP14L_HUMAN	Nuclear body protein SP140-like protein	SP140L	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nuclear body [GO:0016604]; nucleus [GO:0005634]	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]"	GILHKEK	0.96431	12.3477	0	0	10.1872	0	10.2419	11.6672	0	10.9617	0	11.0656	11.0757
Q70EL1	UBP54_HUMAN	Inactive ubiquitin carboxyl-terminal hydrolase 54 (Inactive ubiquitin-specific peptidase 54)	USP54 C10orf29	Homo sapiens (Human)	protein deubiquitination [GO:0016579]		cysteine-type deubiquitinase activity [GO:0004843]	VDMPPDDDWRQSSYASHSGHRR	0.4129	11.1258	10.6876	0	10.9603	10.598	10.6572	11.1265	0	10.7164	0	0	0
Q13085	ACACA_HUMAN	Acetyl-CoA carboxylase 1 (ACC1) (EC 6.4.1.2) (Acetyl-Coenzyme A carboxylase alpha) (ACC-alpha)	ACACA ACAC ACC1 ACCA	Homo sapiens (Human)	acetyl-CoA metabolic process [GO:0006084]; cellular response to prostaglandin E stimulus [GO:0071380]; fatty acid biosynthetic process [GO:0006633]; fatty-acyl-CoA biosynthetic process [GO:0046949]; lipid homeostasis [GO:0055088]; malonyl-CoA biosynthetic process [GO:2001295]; protein homotetramerization [GO:0051289]; protein metabolic process [GO:0019538]; tissue homeostasis [GO:0001894]	actin cytoskeleton [GO:0015629]; cytosol [GO:0005829]; fibrillar center [GO:0001650]; mitochondrion [GO:0005739]	acetyl-CoA carboxylase activity [GO:0003989]; ATP binding [GO:0005524]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]	FGAYIVDGLR	0.99619	0	0	0	10.5757	10.598	10.6572	0	10.6415	10.7164	11.2293	0	11.327
Q5VV17	OTUD1_HUMAN	OTU domain-containing protein 1 (EC 3.4.19.12) (DUBA-7)	OTUD1 DUBA7 OTDC1	Homo sapiens (Human)	protein deubiquitination [GO:0016579]; protein K63-linked deubiquitination [GO:0070536]		cysteine-type deubiquitinase activity [GO:0004843]	QALAAAK	0.67219	0	0	0	0	10.2909	0	11.4462	10.0926	10.1746	10.627	10.9384	10.8112
Q9UKU7	ACAD8_HUMAN	"Isobutyryl-CoA dehydrogenase, mitochondrial (IBDH) (EC 1.3.8.-) (Activator-recruited cofactor 42 kDa component) (ARC42) (Acyl-CoA dehydrogenase family member 8) (ACAD-8)"	ACAD8 ARC42 IBD	Homo sapiens (Human)	lipid metabolic process [GO:0006629]; valine catabolic process [GO:0006574]	mitochondrial matrix [GO:0005759]	acyl-CoA dehydrogenase activity [GO:0003995]; flavin adenine dinucleotide binding [GO:0050660]	TGGPGPK	0.76944	11.3005	0	11.03	10.1595	0	0	9.88425	0	10.0094	10.4387	0	10.5858
P38935	SMBP2_HUMAN	DNA-binding protein SMUBP-2 (EC 3.6.4.12) (EC 3.6.4.13) (ATP-dependent helicase IGHMBP2) (Glial factor 1) (GF-1) (Immunoglobulin mu-binding protein 2)	IGHMBP2 SMBP2 SMUBP2	Homo sapiens (Human)	DNA duplex unwinding [GO:0032508]; RNA secondary structure unwinding [GO:0010501]	axon [GO:0030424]; cytoplasm [GO:0005737]; growth cone [GO:0030426]; membrane [GO:0016020]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]	"5'-3' DNA helicase activity [GO:0043139]; 5'-3' RNA helicase activity [GO:0032574]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent activity, acting on DNA [GO:0008094]; ATP-dependent activity, acting on RNA [GO:0008186]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; double-stranded DNA helicase activity [GO:0036121]; identical protein binding [GO:0042802]; ribosome binding [GO:0043022]; RNA binding [GO:0003723]; single-stranded DNA binding [GO:0003697]; single-stranded RNA binding [GO:0003727]; transcription factor binding [GO:0008134]; tRNA binding [GO:0000049]; zinc ion binding [GO:0008270]"	ARAHARQR	0.97118	11.3017	0	10.977	0	9.75636	0	9.82486	9.8888	0	10.5875	10.8248	0
Q01813	PFKAP_HUMAN	"ATP-dependent 6-phosphofructokinase, platelet type (ATP-PFK) (PFK-P) (EC 2.7.1.11) (6-phosphofructokinase type C) (Phosphofructo-1-kinase isozyme C) (PFK-C) (Phosphohexokinase)"	PFKP PFKF	Homo sapiens (Human)	"canonical glycolysis [GO:0061621]; cellular response to leukemia inhibitory factor [GO:1990830]; fructose 1,6-bisphosphate metabolic process [GO:0030388]; fructose 6-phosphate metabolic process [GO:0006002]"	6-phosphofructokinase complex [GO:0005945]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; membrane [GO:0016020]; nucleus [GO:0005634]	6-phosphofructokinase activity [GO:0003872]; AMP binding [GO:0016208]; ATP binding [GO:0005524]; cadherin binding [GO:0045296]; fructose-6-phosphate binding [GO:0070095]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; monosaccharide binding [GO:0048029]; protein-containing complex binding [GO:0044877]	MDADDSR	0.93306	0	10.6015	10.6517	10.1143	10.0046	10.0557	0	0	10.427	0	10.4458	0
Q9Y2I7	FYV1_HUMAN	1-phosphatidylinositol 3-phosphate 5-kinase (Phosphatidylinositol 3-phosphate 5-kinase) (EC 2.7.1.150) (FYVE finger-containing phosphoinositide kinase) (PIKfyve) (Phosphatidylinositol 3-phosphate 5-kinase type III) (PIPkin-III) (Type III PIP kinase) (Serine-protein kinase PIKFYVE) (EC 2.7.11.1)	PIKFYVE KIAA0981 PIP5K3	Homo sapiens (Human)	"1-phosphatidyl-1D-myo-inositol 3,5-bisphosphate metabolic process [GO:1903100]; antigen processing and presentation of exogenous peptide antigen via MHC class II [GO:0019886]; intracellular signal transduction [GO:0035556]; melanosome organization [GO:0032438]; myelin assembly [GO:0032288]; neutrophil chemotaxis [GO:0030593]; peptidyl-serine autophosphorylation [GO:0036289]; phagosome maturation [GO:0090382]; phagosome-lysosome fusion [GO:0090385]; phosphatidylinositol 5-phosphate metabolic process [GO:1904562]; phosphatidylinositol biosynthetic process [GO:0006661]; protein localization to nucleus [GO:0034504]; protein targeting to membrane [GO:0006612]; receptor-mediated endocytosis of virus by host cell [GO:0019065]; regulation of autophagosome assembly [GO:2000785]; regulation of reactive oxygen species biosynthetic process [GO:1903426]; retrograde transport, endosome to Golgi [GO:0042147]"	cell-cell junction [GO:0005911]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; early endosome membrane [GO:0031901]; endosome membrane [GO:0010008]; Golgi membrane [GO:0000139]; late endosome membrane [GO:0031902]; membrane raft [GO:0045121]; perinuclear region of cytoplasm [GO:0048471]; phagocytic vesicle membrane [GO:0030670]; vesicle membrane [GO:0012506]	"1-phosphatidylinositol-3-phosphate 5-kinase activity [GO:0000285]; 1-phosphatidylinositol-4-phosphate 5-kinase activity [GO:0016308]; 1-phosphatidylinositol-5-kinase activity [GO:0052810]; ATP binding [GO:0005524]; phosphatidylinositol-3,5-bisphosphate 5-phosphatase activity [GO:0043813]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; zinc ion binding [GO:0008270]"	ARGGRIQPK	0.99855	0	0	0	9.98342	0	9.95072	10.0991	9.91243	10.0625	10.8929	11.3189	0
Q9NRC6	SPTN5_HUMAN	"Spectrin beta chain, non-erythrocytic 5 (Beta-V spectrin)"	SPTBN5 BSPECV HUBSPECV HUSPECV	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; actin filament capping [GO:0051693]; Golgi organization [GO:0007030]; lysosomal transport [GO:0007041]	apical cortex [GO:0045179]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; microtubule associated complex [GO:0005875]; photoreceptor connecting cilium [GO:0032391]; photoreceptor disc membrane [GO:0097381]; spectrin [GO:0008091]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; dynactin binding [GO:0034452]; dynein intermediate chain binding [GO:0045505]; identical protein binding [GO:0042802]; kinesin binding [GO:0019894]; myosin tail binding [GO:0032029]; opsin binding [GO:0002046]; protein C-terminus binding [GO:0008022]; protein self-association [GO:0043621]; spectrin binding [GO:0030507]	LLSTLGPR	0.83333	0	0	12.681	0	12.0245	11.3561	0	11.3048	11.3457	12.2212	0	0
P04217	A1BG_HUMAN	Alpha-1B-glycoprotein (Alpha-1-B glycoprotein)	A1BG	Homo sapiens (Human)		blood microparticle [GO:0072562]; collagen-containing extracellular matrix [GO:0062023]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; platelet alpha granule lumen [GO:0031093]; secretory granule lumen [GO:0034774]		ATWSGAVLAGR	0	9.27622	12.1569	12.175	9.67624	9.65814	9.43296	0	0	0	8.40224	0	0
Q8WZ74	CTTB2_HUMAN	Cortactin-binding protein 2 (CortBP2)	CTTNBP2 C7orf8 CORTBP2 KIAA1758	Homo sapiens (Human)	brain development [GO:0007420]; regulation of modification of postsynaptic actin cytoskeleton [GO:1905274]; regulation of synapse organization [GO:0050807]	anchoring junction [GO:0070161]; cell cortex [GO:0005938]; dendritic spine [GO:0043197]; glutamatergic synapse [GO:0098978]; postsynaptic actin cytoskeleton [GO:0098871]; synaptic vesicle [GO:0008021]	SH3 domain binding [GO:0017124]	VIIDSSR	0.91706	12.4784	0	12.3608	0	11.1638	11.0757	10.91	0	0	0	11.8813	0
P02652	APOA2_HUMAN	Apolipoprotein A-II (Apo-AII) (ApoA-II) (Apolipoprotein A2) [Cleaved into: Proapolipoprotein A-II (ProapoA-II); Truncated apolipoprotein A-II (Apolipoprotein A-II(1-76))]	APOA2	Homo sapiens (Human)	acute inflammatory response [GO:0002526]; animal organ regeneration [GO:0031100]; cholesterol efflux [GO:0033344]; cholesterol homeostasis [GO:0042632]; cholesterol metabolic process [GO:0008203]; cholesterol transport [GO:0030301]; diacylglycerol catabolic process [GO:0046340]; high-density lipoprotein particle assembly [GO:0034380]; high-density lipoprotein particle clearance [GO:0034384]; high-density lipoprotein particle remodeling [GO:0034375]; lipoprotein metabolic process [GO:0042157]; low-density lipoprotein particle remodeling [GO:0034374]; negative regulation of cholesterol import [GO:0060621]; negative regulation of cholesterol transport [GO:0032375]; negative regulation of cholesterol transporter activity [GO:0060695]; negative regulation of cytokine production involved in immune response [GO:0002719]; negative regulation of lipase activity [GO:0060192]; negative regulation of lipid catabolic process [GO:0050995]; negative regulation of very-low-density lipoprotein particle remodeling [GO:0010903]; peptidyl-methionine modification [GO:0018206]; phosphatidylcholine biosynthetic process [GO:0006656]; phospholipid catabolic process [GO:0009395]; phospholipid efflux [GO:0033700]; positive regulation of CoA-transferase activity [GO:1905920]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of lipid catabolic process [GO:0050996]; positive regulation of phagocytosis [GO:0050766]; protein oxidation [GO:0018158]; protein stabilization [GO:0050821]; regulation of intestinal cholesterol absorption [GO:0030300]; regulation of protein stability [GO:0031647]; response to estrogen [GO:0043627]; response to glucocorticoid [GO:0051384]; response to glucose [GO:0009749]; response to xenobiotic stimulus [GO:0009410]; reverse cholesterol transport [GO:0043691]; triglyceride metabolic process [GO:0006641]; triglyceride-rich lipoprotein particle remodeling [GO:0034370]	blood microparticle [GO:0072562]; chylomicron [GO:0042627]; cytosol [GO:0005829]; early endosome [GO:0005769]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; high-density lipoprotein particle [GO:0034364]; spherical high-density lipoprotein particle [GO:0034366]; very-low-density lipoprotein particle [GO:0034361]	apolipoprotein receptor binding [GO:0034190]; cholesterol binding [GO:0015485]; cholesterol transfer activity [GO:0120020]; enzyme binding [GO:0019899]; heat shock protein binding [GO:0031072]; high-density lipoprotein particle binding [GO:0008035]; high-density lipoprotein particle receptor binding [GO:0070653]; lipase inhibitor activity [GO:0055102]; lipid binding [GO:0008289]; lipid transporter activity [GO:0005319]; phosphatidylcholine binding [GO:0031210]; phosphatidylcholine-sterol O-acyltransferase activator activity [GO:0060228]; phospholipid binding [GO:0005543]; protein heterodimerization activity [GO:0046982]; protein homodimerization activity [GO:0042803]; signaling receptor binding [GO:0005102]	EQLTPLIK	0	10.637	9.28817	9.44162	0	0	0	9.33555	0	0	9.60805	9.60073	9.78683
A8MUP6	GS1L2_HUMAN	Germ cell-specific gene 1-like protein 2 (GSG1-like protein 2)	GSG1L2	Homo sapiens (Human)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]		DNSSNGR	0.82675	10.1809	10.187	10.0028	0	0	0	9.22795	0	9.07668	0	9.48061	9.48464
P01861	IGHG4_HUMAN	Immunoglobulin heavy constant gamma 4 (Ig gamma-4 chain C region)	IGHG4	Homo sapiens (Human)	"adaptive immune response [GO:0002250]; B cell receptor signaling pathway [GO:0050853]; complement activation, classical pathway [GO:0006958]; defense response to bacterium [GO:0042742]; innate immune response [GO:0045087]; phagocytosis, engulfment [GO:0006911]; phagocytosis, recognition [GO:0006910]; positive regulation of B cell activation [GO:0050871]"	"blood microparticle [GO:0072562]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; IgG immunoglobulin complex [GO:0071735]; immunoglobulin complex, circulating [GO:0042571]; plasma membrane [GO:0005886]"	antigen binding [GO:0003823]; immunoglobulin receptor binding [GO:0034987]	DTLMISR	0	8.64872	0	0	10.1727	9.27966	9.84392	9.71553	10.0402	9.92193	0	0	0
Q8WVV9	HNRLL_HUMAN	Heterogeneous nuclear ribonucleoprotein L-like (hnRNPLL) (Stromal RNA-regulating factor)	HNRNPLL HNRPLL SRRF BLOCK24	Homo sapiens (Human)	mRNA processing [GO:0006397]; positive regulation of RNA splicing [GO:0033120]; regulation of RNA splicing [GO:0043484]	membrane [GO:0016020]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]	mRNA binding [GO:0003729]; RNA binding [GO:0003723]	ETYEEDR	0.93357	11.9496	11.6186	0	0	10.708	10.7277	0	0	0	11.1062	11.3365	0
P17787	ACHB2_HUMAN	Neuronal acetylcholine receptor subunit beta-2	CHRNB2	Homo sapiens (Human)	"acetylcholine receptor signaling pathway [GO:0095500]; associative learning [GO:0008306]; B cell activation [GO:0042113]; behavioral response to nicotine [GO:0035095]; calcium ion transport [GO:0006816]; central nervous system projection neuron axonogenesis [GO:0021952]; chemical synaptic transmission [GO:0007268]; cognition [GO:0050890]; ion transmembrane transport [GO:0034220]; ion transport [GO:0006811]; lateral geniculate nucleus development [GO:0021771]; learning [GO:0007612]; locomotory behavior [GO:0007626]; membrane depolarization [GO:0051899]; memory [GO:0007613]; negative regulation of action potential [GO:0045759]; nervous system process [GO:0050877]; optic nerve morphogenesis [GO:0021631]; positive regulation of B cell proliferation [GO:0030890]; positive regulation of dopamine secretion [GO:0033603]; regulation of circadian sleep/wake cycle, REM sleep [GO:0042320]; regulation of dendrite morphogenesis [GO:0048814]; regulation of dopamine metabolic process [GO:0042053]; regulation of dopamine secretion [GO:0014059]; regulation of membrane potential [GO:0042391]; regulation of synapse assembly [GO:0051963]; regulation of synaptic transmission, dopaminergic [GO:0032225]; response to acetylcholine [GO:1905144]; response to cocaine [GO:0042220]; response to ethanol [GO:0045471]; response to hypoxia [GO:0001666]; response to nicotine [GO:0035094]; sensory perception of pain [GO:0019233]; sensory perception of sound [GO:0007605]; signal transduction [GO:0007165]; smooth muscle contraction [GO:0006939]; social behavior [GO:0035176]; synaptic transmission involved in micturition [GO:0060084]; synaptic transmission, cholinergic [GO:0007271]; vestibulocochlear nerve development [GO:0021562]; visual learning [GO:0008542]; visual perception [GO:0007601]"	acetylcholine-gated channel complex [GO:0005892]; anchoring junction [GO:0070161]; cholinergic synapse [GO:0098981]; external side of plasma membrane [GO:0009897]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; integral component of postsynaptic specialization membrane [GO:0099060]; integral component of presynaptic membrane [GO:0099056]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]; plasma membrane raft [GO:0044853]; synapse [GO:0045202]	acetylcholine binding [GO:0042166]; acetylcholine receptor activity [GO:0015464]; acetylcholine-gated cation-selective channel activity [GO:0022848]; excitatory extracellular ligand-gated ion channel activity [GO:0005231]; heterocyclic compound binding [GO:1901363]; ligand-gated ion channel activity [GO:0015276]; neurotransmitter receptor activity [GO:0030594]; protein-containing complex binding [GO:0044877]; quaternary ammonium group binding [GO:0050997]; transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential [GO:1904315]	HFPFDQQNCTMK	0.88532	11.6918	0	11.2212	0	0	0	11.4154	0	11.069	0	10.7594	10.6995
Q9H6Q4	CIAO3_HUMAN	Cytosolic iron-sulfur assembly component 3 (Cytosolic Fe-S cluster assembly factor NARFL) (Iron-only hydrogenase-like protein 1) (IOP1) (Nuclear prelamin A recognition factor-like protein) (Protein related to Narf)	CIAO3 NARFL PRN	Homo sapiens (Human)	hematopoietic progenitor cell differentiation [GO:0002244]; iron-sulfur cluster assembly [GO:0016226]; oxygen homeostasis [GO:0032364]; regulation of gene expression [GO:0010468]; response to hypoxia [GO:0001666]	CIA complex [GO:0097361]	"4 iron, 4 sulfur cluster binding [GO:0051539]; metal ion binding [GO:0046872]"	AGSGVAK	0.14141	8.87335	0	9.72532	9.50815	9.64636	9.55424	0	9.56834	9.3897	0	0	0
P02656	APOC3_HUMAN	Apolipoprotein C-III (Apo-CIII) (ApoC-III) (Apolipoprotein C3)	APOC3	Homo sapiens (Human)	cholesterol efflux [GO:0033344]; cholesterol homeostasis [GO:0042632]; chylomicron remnant clearance [GO:0034382]; G protein-coupled receptor signaling pathway [GO:0007186]; high-density lipoprotein particle remodeling [GO:0034375]; lipoprotein metabolic process [GO:0042157]; negative regulation of cholesterol import [GO:0060621]; negative regulation of fatty acid biosynthetic process [GO:0045717]; negative regulation of high-density lipoprotein particle clearance [GO:0010987]; negative regulation of lipid catabolic process [GO:0050995]; negative regulation of lipid metabolic process [GO:0045833]; negative regulation of lipoprotein lipase activity [GO:0051005]; negative regulation of low-density lipoprotein particle clearance [GO:0010989]; negative regulation of receptor-mediated endocytosis [GO:0048261]; negative regulation of triglyceride catabolic process [GO:0010897]; negative regulation of very-low-density lipoprotein particle clearance [GO:0010916]; negative regulation of very-low-density lipoprotein particle remodeling [GO:0010903]; phospholipid efflux [GO:0033700]; regulation of Cdc42 protein signal transduction [GO:0032489]; reverse cholesterol transport [GO:0043691]; triglyceride catabolic process [GO:0019433]; triglyceride homeostasis [GO:0070328]; triglyceride metabolic process [GO:0006641]; very-low-density lipoprotein particle assembly [GO:0034379]	chylomicron [GO:0042627]; collagen-containing extracellular matrix [GO:0062023]; early endosome [GO:0005769]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; intermediate-density lipoprotein particle [GO:0034363]; spherical high-density lipoprotein particle [GO:0034366]; very-low-density lipoprotein particle [GO:0034361]	cholesterol binding [GO:0015485]; enzyme regulator activity [GO:0030234]; high-density lipoprotein particle receptor binding [GO:0070653]; lipase inhibitor activity [GO:0055102]; phospholipid binding [GO:0005543]	DALSSVQESQVAQQAR	0	9.95787	9.37197	9.00388	0	0	0	9.17038	0	0	8.78129	8.72629	9.00439
Q96E39	RMXL1_HUMAN	"RNA binding motif protein, X-linked-like-1 (Heterogeneous nuclear ribonucleoprotein G-like 1)"	RBMXL1	Homo sapiens (Human)	"mRNA processing [GO:0006397]; positive regulation of mRNA splicing, via spliceosome [GO:0048026]; RNA splicing [GO:0008380]"	spliceosomal complex [GO:0005681]	RNA binding [GO:0003723]	GAGPGGSR	0.76099	9.77184	9.85384	9.93589	0	0	8.13822	0	8.59085	9.26747	0	8.22023	0
Q6IE36	OVOS2_HUMAN	Ovostatin homolog 2	OVOS2	Homo sapiens (Human)		extracellular space [GO:0005615]	serine-type endopeptidase inhibitor activity [GO:0004867]	SDPLAFITFSAK	0.86556	9.20154	8.66892	8.83292	8.42605	0	0	9.38679	8.99625	9.10284	0	0	0
P02766	TTHY_HUMAN	Transthyretin (ATTR) (Prealbumin) (TBPA)	TTR PALB	Homo sapiens (Human)	purine nucleobase metabolic process [GO:0006144]; retinol metabolic process [GO:0042572]; thyroid hormone transport [GO:0070327]	azurophil granule lumen [GO:0035578]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; protein-containing complex [GO:0032991]	hormone activity [GO:0005179]; identical protein binding [GO:0042802]; protein-containing complex binding [GO:0044877]; thyroid hormone binding [GO:0070324]	AADDTWEPFASGK	0	9.38258	9.12143	8.87378	0	0	0	8.45381	8.53508	0	8.2293	8.20979	0
P54278	PMS2_HUMAN	Mismatch repair endonuclease PMS2 (EC 3.1.-.-) (DNA mismatch repair protein PMS2) (PMS1 protein homolog 2)	PMS2 PMSL2	Homo sapiens (Human)	mismatch repair [GO:0006298]; response to xenobiotic stimulus [GO:0009410]; somatic hypermutation of immunoglobulin genes [GO:0016446]	cytoplasmic ribonucleoprotein granule [GO:0036464]; cytosol [GO:0005829]; mismatch repair complex [GO:0032300]; MutLalpha complex [GO:0032389]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent DNA damage sensor activity [GO:0140664]; DNA binding [GO:0003677]; endonuclease activity [GO:0004519]; single base insertion or deletion binding [GO:0032138]	LMFDHNGK	0.87466	0	10.2123	10.1299	0	0	0	10.0705	10.0772	0	0	9.82818	9.82375
P31749	AKT1_HUMAN	RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha)	AKT1 PKB RAC	Homo sapiens (Human)	activation-induced cell death of T cells [GO:0006924]; anoikis [GO:0043276]; apoptotic mitochondrial changes [GO:0008637]; behavioral response to pain [GO:0048266]; carbohydrate transport [GO:0008643]; cell differentiation [GO:0030154]; cell migration involved in sprouting angiogenesis [GO:0002042]; cell population proliferation [GO:0008283]; cellular response to cadmium ion [GO:0071276]; cellular response to decreased oxygen levels [GO:0036294]; cellular response to epidermal growth factor stimulus [GO:0071364]; cellular response to granulocyte macrophage colony-stimulating factor stimulus [GO:0097011]; cellular response to insulin stimulus [GO:0032869]; cellular response to nerve growth factor stimulus [GO:1990090]; cellular response to oxidised low-density lipoprotein particle stimulus [GO:0140052]; cellular response to prostaglandin E stimulus [GO:0071380]; cellular response to reactive oxygen species [GO:0034614]; cellular response to tumor necrosis factor [GO:0071356]; cellular response to vascular endothelial growth factor stimulus [GO:0035924]; cytokine-mediated signaling pathway [GO:0019221]; epidermal growth factor receptor signaling pathway [GO:0007173]; establishment of protein localization to mitochondrion [GO:0072655]; excitatory postsynaptic potential [GO:0060079]; execution phase of apoptosis [GO:0097194]; fibroblast migration [GO:0010761]; G protein-coupled receptor signaling pathway [GO:0007186]; gene expression [GO:0010467]; germ cell development [GO:0007281]; glucose homeostasis [GO:0042593]; glucose metabolic process [GO:0006006]; glycogen biosynthetic process [GO:0005978]; glycogen cell differentiation involved in embryonic placenta development [GO:0060709]; I-kappaB kinase/NF-kappaB signaling [GO:0007249]; inflammatory response [GO:0006954]; insulin receptor signaling pathway [GO:0008286]; insulin-like growth factor receptor signaling pathway [GO:0048009]; interleukin-18-mediated signaling pathway [GO:0035655]; intracellular signal transduction [GO:0035556]; labyrinthine layer blood vessel development [GO:0060716]; lipopolysaccharide-mediated signaling pathway [GO:0031663]; maintenance of protein location in mitochondrion [GO:0072656]; mammary gland epithelial cell differentiation [GO:0060644]; maternal placenta development [GO:0001893]; negative regulation of apoptotic process [GO:0043066]; negative regulation of autophagy [GO:0010507]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of endopeptidase activity [GO:0010951]; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001240]; negative regulation of fatty acid beta-oxidation [GO:0031999]; negative regulation of gene expression [GO:0010629]; negative regulation of leukocyte cell-cell adhesion [GO:1903038]; negative regulation of long-chain fatty acid import across plasma membrane [GO:0010748]; negative regulation of lymphocyte migration [GO:2000402]; negative regulation of macroautophagy [GO:0016242]; negative regulation of neuron death [GO:1901215]; negative regulation of Notch signaling pathway [GO:0045746]; negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [GO:1902176]; negative regulation of protein binding [GO:0032091]; negative regulation of protein kinase activity [GO:0006469]; negative regulation of protein kinase activity by protein phosphorylation [GO:0100002]; negative regulation of protein serine/threonine kinase activity [GO:0071901]; negative regulation of protein ubiquitination [GO:0031397]; negative regulation of proteolysis [GO:0045861]; negative regulation of release of cytochrome c from mitochondria [GO:0090201]; NIK/NF-kappaB signaling [GO:0038061]; nitric oxide biosynthetic process [GO:0006809]; osteoblast differentiation [GO:0001649]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; peripheral nervous system myelin maintenance [GO:0032287]; phosphatidylinositol 3-kinase signaling [GO:0014065]; phosphorylation [GO:0016310]; positive regulation of blood vessel endothelial cell migration [GO:0043536]; positive regulation of cell growth [GO:0030307]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0045737]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of endodeoxyribonuclease activity [GO:0032079]; positive regulation of endothelial cell migration [GO:0010595]; positive regulation of endothelial cell proliferation [GO:0001938]; positive regulation of fat cell differentiation [GO:0045600]; positive regulation of fibroblast migration [GO:0010763]; positive regulation of G1/S transition of mitotic cell cycle [GO:1900087]; positive regulation of gene expression [GO:0010628]; positive regulation of glucose import [GO:0046326]; positive regulation of glucose metabolic process [GO:0010907]; positive regulation of glycogen biosynthetic process [GO:0045725]; positive regulation of I-kappaB phosphorylation [GO:1903721]; positive regulation of lipid biosynthetic process [GO:0046889]; positive regulation of mitochondrial membrane potential [GO:0010918]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of nitric-oxide synthase activity [GO:0051000]; positive regulation of organ growth [GO:0046622]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein localization to cell surface [GO:2000010]; positive regulation of protein localization to nucleus [GO:1900182]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of protein metabolic process [GO:0051247]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of sodium ion transport [GO:0010765]; positive regulation of transcription by RNA polymerase II [GO:0045944]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein autophosphorylation [GO:0046777]; protein import into nucleus [GO:0006606]; protein kinase B signaling [GO:0043491]; protein phosphorylation [GO:0006468]; protein ubiquitination [GO:0016567]; regulation of apoptotic process [GO:0042981]; regulation of cell migration [GO:0030334]; regulation of glycogen biosynthetic process [GO:0005979]; regulation of mRNA stability [GO:0043488]; regulation of myelination [GO:0031641]; regulation of neuron projection development [GO:0010975]; regulation of signal transduction by p53 class mediator [GO:1901796]; regulation of translation [GO:0006417]; regulation of type B pancreatic cell development [GO:2000074]; response to fluid shear stress [GO:0034405]; response to food [GO:0032094]; response to growth factor [GO:0070848]; response to growth hormone [GO:0060416]; response to heat [GO:0009408]; response to insulin-like growth factor stimulus [GO:1990418]; response to oxidative stress [GO:0006979]; response to UV-A [GO:0070141]; signal transduction [GO:0007165]; sphingosine-1-phosphate receptor signaling pathway [GO:0003376]; striated muscle cell differentiation [GO:0051146]; T cell costimulation [GO:0031295]; TOR signaling [GO:0031929]	cell-cell junction [GO:0005911]; ciliary basal body [GO:0036064]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]; lamellipodium [GO:0030027]; microtubule cytoskeleton [GO:0015630]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; protein-containing complex [GO:0032991]; spindle [GO:0005819]; vesicle [GO:0031982]	"14-3-3 protein binding [GO:0071889]; ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; enzyme binding [GO:0019899]; identical protein binding [GO:0042802]; kinase activity [GO:0016301]; nitric-oxide synthase regulator activity [GO:0030235]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547]; phosphatidylinositol-3,4-bisphosphate binding [GO:0043325]; potassium channel activator activity [GO:0099104]; protein homodimerization activity [GO:0042803]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; protein serine/threonine/tyrosine kinase activity [GO:0004712]"	DLKLENLMLDKDGHIK	0.87	0	0	9.66021	9.69822	9.72615	9.80853	0	10.3957	10.4464	0	0	0
Q5VU97	CAHD1_HUMAN	VWFA and cache domain-containing protein 1 (Cache domain-containing protein 1)	CACHD1 KIAA1573 VWCD1	Homo sapiens (Human)		voltage-gated calcium channel complex [GO:0005891]	voltage-gated calcium channel activity [GO:0005245]	DLAEQNSGK	0.5815	0	0	0	0	9.94228	9.93322	0	10.0772	9.95104	9.79372	0	9.82375
P0DOX8	IGL1_HUMAN	Immunoglobulin lambda-1 light chain (Immunoglobulin lambda-1 light chain MCG)		Homo sapiens (Human)	adaptive immune response [GO:0002250]	extracellular region [GO:0005576]; immunoglobulin complex [GO:0019814]; plasma membrane [GO:0005886]		ANPTVTLFPPSSEELQANK	0	10.0817	0	9.13317	0	0	0	9.15702	9.20704	9.13504	0	0	8.54828
O60282	KIF5C_HUMAN	Kinesin heavy chain isoform 5C (EC 3.6.4.-) (Kinesin heavy chain neuron-specific 2) (Kinesin-1)	KIF5C KIAA0531 NKHC2	Homo sapiens (Human)	anterograde axonal protein transport [GO:0099641]; anterograde dendritic transport of neurotransmitter receptor complex [GO:0098971]; axon guidance [GO:0007411]; cytoskeleton-dependent intracellular transport [GO:0030705]; microtubule-based movement [GO:0007018]; motor neuron axon guidance [GO:0008045]; mRNA transport [GO:0051028]; organelle organization [GO:0006996]; synaptic vesicle transport [GO:0048489]	axon cytoplasm [GO:1904115]; axonal growth cone [GO:0044295]; ciliary rootlet [GO:0035253]; dendrite cytoplasm [GO:0032839]; distal axon [GO:0150034]; kinesin complex [GO:0005871]; microtubule [GO:0005874]; neuronal cell body [GO:0043025]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777]; plus-end-directed microtubule motor activity [GO:0008574]	ADPAECSIKVMCR	0.99853	10.1713	0	9.18066	0	0	0	9.43356	0	8.70522	0	8.36308	8.66825
Q9HBW9	AGRL4_HUMAN	"Adhesion G protein-coupled receptor L4 (EGF, latrophilin and seven transmembrane domain-containing protein 1) (EGF-TM7-latrophilin-related protein) (ETL protein)"	ADGRL4 ELTD1 ETL UNQ202/PRO228	Homo sapiens (Human)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; cell surface receptor signaling pathway [GO:0007166]; G protein-coupled receptor signaling pathway [GO:0007186]; protein-containing complex assembly [GO:0065003]	cytoplasmic vesicle [GO:0031410]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]; G protein-coupled receptor activity [GO:0004930]	TVNNFVQRDTFVVWDK	0.8472	0	0	0	10.4005	10.6615	10.4291	0	10.8743	10.8574	0	0	0
O95969	SG1D2_HUMAN	Secretoglobin family 1D member 2 (Lipophilin-B)	SCGB1D2 LIPHB LPNB	Homo sapiens (Human)		extracellular space [GO:0005615]		RSLIAEVLVK	0.99624	0	0	0	13.1852	13.191	12.9091	0	0	13.1488	0	0	0
Q86YA3	ZGRF1_HUMAN	Protein ZGRF1 (GRF-type zinc finger domain-containing protein 1)	ZGRF1 C4orf21	Homo sapiens (Human)	replication fork reversal [GO:0071932]	cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]	5'-flap endonuclease activity [GO:0017108]; helicase activity [GO:0004386]; RNA binding [GO:0003723]; zinc ion binding [GO:0008270]	DLQEISGSELCFPSGQK	0.086957	12.797	0	0	0	0	0	10.3663	0	0	9.6706	9.68201	9.86324
Q99418	CYH2_HUMAN	"Cytohesin-2 (ARF exchange factor) (ARF nucleotide-binding site opener) (Protein ARNO) (PH, SEC7 and coiled-coil domain-containing protein 2)"	CYTH2 ARNO PSCD2 PSCD2L	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; endocytosis [GO:0006897]; regulation of ARF protein signal transduction [GO:0032012]	adherens junction [GO:0005912]; bicellular tight junction [GO:0005923]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; Golgi membrane [GO:0000139]; growth cone [GO:0030426]; membrane [GO:0016020]; plasma membrane [GO:0005886]	"guanyl-nucleotide exchange factor activity [GO:0005085]; inositol 1,4,5 trisphosphate binding [GO:0070679]; lipid binding [GO:0008289]"	EELSEAMSEVEGLEANEGSKTLQR	0.15534	0	10.3674	0	10.4005	0	0	0	10.8743	0	9.88669	0	9.96508
Q2TBA0	KLH40_HUMAN	Kelch-like protein 40 (Kelch repeat and BTB domain-containing protein 5) (Sarcosynapsin)	KLHL40 KBTBD5 SRYP	Homo sapiens (Human)	negative regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032435]; negative regulation of protein ubiquitination [GO:0031397]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein ubiquitination [GO:0031398]; skeletal muscle fiber development [GO:0048741]; skeletal muscle fiber differentiation [GO:0098528]	A band [GO:0031672]; Cul3-RING ubiquitin ligase complex [GO:0031463]; cytoplasm [GO:0005737]; I band [GO:0031674]		DGAGAKEADK	0.92096	11.5376	0	0	0	9.94228	9.93322	0	10.0772	9.95104	0	0	0
P23327	SRCH_HUMAN	Sarcoplasmic reticulum histidine-rich calcium-binding protein	HRC HCP	Homo sapiens (Human)	muscle contraction [GO:0006936]; positive regulation of heart contraction [GO:0045823]; positive regulation of heart rate [GO:0010460]; positive regulation of relaxation of cardiac muscle [GO:1901899]; regulation of calcium ion transmembrane transport [GO:1903169]; regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion [GO:0010881]; regulation of cell communication by electrical coupling involved in cardiac conduction [GO:1901844]; regulation of cytosolic calcium ion concentration [GO:0051480]; regulation of heart rate [GO:0002027]; regulation of peptidyl-serine phosphorylation [GO:0033135]; regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum [GO:0010880]; regulation of ryanodine-sensitive calcium-release channel activity [GO:0060314]	endoplasmic reticulum lumen [GO:0005788]; sarcoplasmic reticulum lumen [GO:0033018]; Z disc [GO:0030018]	ATPase binding [GO:0051117]; calcium ion binding [GO:0005509]; transmembrane transporter binding [GO:0044325]	DHPDENKDVSTENGHHFWSHPDREK	0.87474	9.71696	0	0	10.5209	0	10.0477	0	10.0631	10.0154	0	0	0
P47710	CASA1_HUMAN	Alpha-S1-casein [Cleaved into: Casoxin-D]	CSN1S1 CASA CSN1	Homo sapiens (Human)	response to 11-deoxycorticosterone [GO:1903496]; response to dehydroepiandrosterone [GO:1903494]; response to estradiol [GO:0032355]; response to progesterone [GO:0032570]	extracellular region [GO:0005576]; extracellular space [GO:0005615]		EEYMNGMNR	0.91799	10.4443	0	0	9.44147	9.51846	0	10.1713	0	9.77993	0	0	0
Q8IVT2	MISP_HUMAN	Mitotic interactor and substrate of PLK1 (Mitotic spindle positioning protein)	MISP C19orf21	Homo sapiens (Human)	cell division [GO:0051301]; cell migration [GO:0016477]; establishment of centrosome localization [GO:0051660]; establishment of mitotic spindle orientation [GO:0000132]; mitotic spindle assembly [GO:0090307]; organelle localization [GO:0051640]; regulation of protein localization to cell cortex [GO:1904776]	actin filament [GO:0005884]; cell cortex [GO:0005938]; focal adhesion [GO:0005925]; intracellular membrane-bounded organelle [GO:0043231]; plasma membrane [GO:0005886]; spindle pole centrosome [GO:0031616]	actin filament binding [GO:0051015]	LSLITAPR	0.57993	0	0	0	12.0077	0	11.9704	0	0	0	0	12.5456	12.6618
Q01664	TFAP4_HUMAN	Transcription factor AP-4 (Activating enhancer-binding protein 4) (Class C basic helix-loop-helix protein 41) (bHLHc41)	TFAP4 BHLHC41	Homo sapiens (Human)	"cellular response to dexamethasone stimulus [GO:0071549]; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator [GO:0006978]; negative regulation by host of viral transcription [GO:0043922]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0045736]; negative regulation of DNA binding [GO:0043392]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of gene expression [GO:0010629]; positive regulation by host of viral transcription [GO:0043923]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway [GO:2001269]; positive regulation of DNA-templated transcription [GO:0045893]; protein-containing complex assembly [GO:0065003]; regulation of mitotic cell cycle phase transition [GO:1901990]; regulation of transcription by RNA polymerase II [GO:0006357]"	chromatin [GO:0000785]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription repressor complex [GO:0017053]	"DNA binding [GO:0003677]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; E-box binding [GO:0070888]; histone deacetylase binding [GO:0042826]; protein homodimerization activity [GO:0042803]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]; sequence-specific double-stranded DNA binding [GO:1990837]; transcription cis-regulatory region binding [GO:0000976]"	EEPSGDGELP	0.94351	0	0	10.3533	9.14652	0	9.23033	9.38679	0	0	0	0	9.97327
Q7RTY9	PRS41_HUMAN	Serine protease 41 (EC 3.4.21.-) (Testis serine protease 1) (TESSP-1)	PRSS41 TESSP1	Homo sapiens (Human)	proteolysis [GO:0006508]	anchored component of membrane [GO:0031225]; extracellular region [GO:0005576]; intracellular organelle [GO:0043229]; plasma membrane [GO:0005886]	serine-type endopeptidase activity [GO:0004252]; sodium channel regulator activity [GO:0017080]	VQDIIVNPDALGVLR	0.66775	0	0	9.40827	0	10.7063	0	8.46752	10.5602	0	0	0	8.78944
Q15652	JHD2C_HUMAN	Probable JmjC domain-containing histone demethylation protein 2C (EC 1.14.11.-) (Jumonji domain-containing protein 1C) (Thyroid receptor-interacting protein 8) (TR-interacting protein 8) (TRIP-8)	JMJD1C JHDM2C KIAA1380 TRIP8	Homo sapiens (Human)	blood coagulation [GO:0007596]; chromatin organization [GO:0006325]; histone H3-K9 demethylation [GO:0033169]; regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]; histone deacetylase complex [GO:0000118]; nucleoplasm [GO:0005654]	chromatin DNA binding [GO:0031490]; dioxygenase activity [GO:0051213]; histone H3-methyl-lysine-9 demethylase activity [GO:0032454]; metal ion binding [GO:0046872]; nuclear thyroid hormone receptor binding [GO:0046966]; transcription coregulator activity [GO:0003712]	EKTEWHVEK	0.87252	12.8912	0	0	11.5987	0	11.4706	0	0	11.6468	0	0	0
Q9UFF9	CNOT8_HUMAN	CCR4-NOT transcription complex subunit 8 (EC 3.1.13.4) (CAF1-like protein) (CALIFp) (CAF2) (CCR4-associated factor 8) (Caf1b)	CNOT8 CALIF POP2	Homo sapiens (Human)	DNA-templated transcription [GO:0006351]; exonucleolytic catabolism of deadenylated mRNA [GO:0043928]; miRNA-mediated gene silencing [GO:0035195]; nuclear-transcribed mRNA poly(A) tail shortening [GO:0000289]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of mRNA catabolic process [GO:0061014]	CCR4-NOT complex [GO:0030014]; CCR4-NOT core complex [GO:0030015]; cytosol [GO:0005829]; nucleus [GO:0005634]; P-body [GO:0000932]	3'-5'-exoribonuclease activity [GO:0000175]; metal ion binding [GO:0046872]; poly(A)-specific ribonuclease activity [GO:0004535]; RNA binding [GO:0003723]	NLKGGLQEVADQLDLQR	0.76731	9.94068	0	0	0	0	0	9.65571	0	9.5751	0	9.23957	9.09355
Q9H9E3	COG4_HUMAN	Conserved oligomeric Golgi complex subunit 4 (COG complex subunit 4) (Component of oligomeric Golgi complex 4)	COG4	Homo sapiens (Human)	"glycosylation [GO:0070085]; Golgi organization [GO:0007030]; Golgi vesicle prefusion complex stabilization [GO:0048213]; protein transport [GO:0015031]; retrograde transport, vesicle recycling within Golgi [GO:0000301]; retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum [GO:0006890]"	cytosol [GO:0005829]; Golgi membrane [GO:0000139]; Golgi transport complex [GO:0017119]; trans-Golgi network membrane [GO:0032588]	identical protein binding [GO:0042802]	SEDYEQAAAHTHR	0.94225	0	9.64596	0	9.32724	9.42534	9.24027	0	0	9.34307	0	0	0
Q9UBW7	ZMYM2_HUMAN	Zinc finger MYM-type protein 2 (Fused in myeloproliferative disorders protein) (Rearranged in atypical myeloproliferative disorder protein) (Zinc finger protein 198)	ZMYM2 FIM RAMP ZNF198	Homo sapiens (Human)	negative regulation of DNA-templated transcription [GO:0045892]	cytosol [GO:0005829]; nucleus [GO:0005634]; PML body [GO:0016605]	ubiquitin conjugating enzyme binding [GO:0031624]; zinc ion binding [GO:0008270]	LCVMCKK	0.99592	0	0	9.53039	0	0	0	8.9289	9.03348	0	0	9.38759	9.52007
Q12899	TRI26_HUMAN	Tripartite motif-containing protein 26 (EC 2.3.2.27) (Acid finger protein) (AFP) (RING finger protein 95) (Zinc finger protein 173)	TRIM26 RNF95 ZNF173	Homo sapiens (Human)	innate immune response [GO:0045087]; negative regulation of viral entry into host cell [GO:0046597]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; protein ubiquitination [GO:0016567]; regulation of gene expression [GO:0010468]; suppression of viral release by host [GO:0044790]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleus [GO:0005634]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]	GVGELAR	0.6734	9.86403	9.64879	0	9.23699	0	0	0	8.97396	8.65893	0	0	0
A4UGR9	XIRP2_HUMAN	Xin actin-binding repeat-containing protein 2 (Beta-xin) (Cardiomyopathy-associated protein 3) (Xeplin)	XIRP2 CMYA3	Homo sapiens (Human)	actin filament organization [GO:0007015]; cardiac muscle tissue morphogenesis [GO:0055008]; cell-cell junction organization [GO:0045216]; ventricular septum development [GO:0003281]	anchoring junction [GO:0070161]; Z disc [GO:0030018]	actin filament binding [GO:0051015]; alpha-actinin binding [GO:0051393]	EIIGGDVEGTK	0.89626	0	0	0	0	11.765	0	11.6945	10.842	0	0	11.6424	0
Q9Y2J8	PADI2_HUMAN	Protein-arginine deiminase type-2 (EC 3.5.3.15) (PAD-H19) (Peptidylarginine deiminase II) (Protein-arginine deiminase type II)	PADI2 KIAA0994 PAD2 PDI2	Homo sapiens (Human)	cellular response to leukemia inhibitory factor [GO:1990830]; epigenetic maintenance of chromatin in transcription-competent conformation [GO:0045815]; intracellular estrogen receptor signaling pathway [GO:0030520]; negative regulation of chemokine-mediated signaling pathway [GO:0070100]; negative regulation of lymphocyte chemotaxis [GO:1901624]; substantia nigra development [GO:0021762]	azurophil granule lumen [GO:0035578]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; euchromatin [GO:0000791]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; nucleus [GO:0005634]	calcium ion binding [GO:0005509]; histone-arginine deiminase activity (H3-R26 specific) [GO:0140798]; nuclear estrogen receptor binding [GO:0030331]; protein homodimerization activity [GO:0042803]; protein-arginine deiminase activity [GO:0004668]	DNYLFLKEVK	0.88405	11.6248	0	11.0895	10.9388	0	0	0	0	0	0	12.1423	0
Q8IWA4	MFN1_HUMAN	Mitofusin-1 (EC 3.6.5.-) (Fzo homolog) (Transmembrane GTPase MFN1)	MFN1	Homo sapiens (Human)	GTP metabolic process [GO:0046039]; mitochondrial fusion [GO:0008053]; mitochondrion localization [GO:0051646]; positive regulation of mitochondrial membrane potential [GO:0010918]	integral component of membrane [GO:0016021]; integral component of mitochondrial outer membrane [GO:0031307]; intrinsic component of mitochondrial outer membrane [GO:0031306]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; outer mitochondrial membrane protein complex [GO:0098799]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]; identical protein binding [GO:0042802]	IYKSELNKHIEDGMGR	0.8626	8.59287	0	0	9.46142	9.17038	9.09408	8.81689	0	0	0	0	0
P18825	ADA2C_HUMAN	Alpha-2C adrenergic receptor (Alpha-2 adrenergic receptor subtype C4) (Alpha-2C adrenoreceptor) (Alpha-2C adrenoceptor) (Alpha-2CAR)	ADRA2C ADRA2L2 ADRA2RL2	Homo sapiens (Human)	activation of protein kinase B activity [GO:0032148]; adenylate cyclase-activating adrenergic receptor signaling pathway [GO:0071880]; adrenergic receptor signaling pathway [GO:0071875]; cell-cell signaling [GO:0007267]; G protein-coupled receptor signaling pathway [GO:0007186]; negative regulation of epinephrine secretion [GO:0032811]; negative regulation of norepinephrine secretion [GO:0010700]; platelet activation [GO:0030168]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of neuron differentiation [GO:0045666]; receptor transactivation [GO:0035624]; regulation of smooth muscle contraction [GO:0006940]; regulation of vasoconstriction [GO:0019229]	cytoplasm [GO:0005737]; endosome [GO:0005768]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]	alpha-2A adrenergic receptor binding [GO:0031694]; alpha2-adrenergic receptor activity [GO:0004938]; epinephrine binding [GO:0051379]; G protein-coupled receptor activity [GO:0004930]; protein heterodimerization activity [GO:0046982]; protein homodimerization activity [GO:0042803]	SPGPGGR	0.82737	8.95382	9.76109	8.93316	8.69387	0	0	0	8.78398	0	0	0	0
Q9P2D1	CHD7_HUMAN	Chromodomain-helicase-DNA-binding protein 7 (CHD-7) (EC 3.6.4.12) (ATP-dependent helicase CHD7)	CHD7 KIAA1416	Homo sapiens (Human)	adult heart development [GO:0007512]; adult walking behavior [GO:0007628]; aorta morphogenesis [GO:0035909]; atrioventricular canal development [GO:0036302]; blood circulation [GO:0008015]; blood vessel remodeling [GO:0001974]; cardiac septum morphogenesis [GO:0060411]; central nervous system development [GO:0007417]; chordate embryonic development [GO:0043009]; chromatin remodeling [GO:0006338]; cognition [GO:0050890]; cranial nerve development [GO:0021545]; embryonic hindlimb morphogenesis [GO:0035116]; epithelium development [GO:0060429]; face development [GO:0060324]; female genitalia development [GO:0030540]; genitalia development [GO:0048806]; heart morphogenesis [GO:0003007]; in utero embryonic development [GO:0001701]; inner ear morphogenesis [GO:0042472]; innervation [GO:0060384]; limb development [GO:0060173]; nose development [GO:0043584]; olfactory behavior [GO:0042048]; olfactory bulb development [GO:0021772]; olfactory nerve development [GO:0021553]; positive regulation of multicellular organism growth [GO:0040018]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of DNA-templated transcription [GO:0006355]; regulation of gene expression [GO:0010468]; regulation of growth hormone secretion [GO:0060123]; regulation of neurogenesis [GO:0050767]; regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum [GO:0010880]; response to bacterium [GO:0009617]; retina development in camera-type eye [GO:0060041]; right ventricular compact myocardium morphogenesis [GO:0003226]; rRNA processing [GO:0006364]; secondary palate development [GO:0062009]; semicircular canal morphogenesis [GO:0048752]; sensory perception of sound [GO:0007605]; skeletal system development [GO:0001501]; T cell differentiation [GO:0030217]; transcription by RNA polymerase II [GO:0006366]; ventricular trabecula myocardium morphogenesis [GO:0003222]	chromatin [GO:0000785]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent chromatin remodeler activity [GO:0140658]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; histone binding [GO:0042393]; promoter-specific chromatin binding [GO:1990841]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]	FSKPDSDR	0.76068	11.72	0	11.6453	0	10.4699	0	0	0	0	0	11.1535	0
P62937	PPIA_HUMAN	"Peptidyl-prolyl cis-trans isomerase A (PPIase A) (EC 5.2.1.8) (Cyclophilin A) (Cyclosporin A-binding protein) (Rotamase A) [Cleaved into: Peptidyl-prolyl cis-trans isomerase A, N-terminally processed]"	PPIA CYPA	Homo sapiens (Human)	activation of protein kinase B activity [GO:0032148]; apoptotic process [GO:0006915]; cell adhesion molecule production [GO:0060352]; cellular response to oxidative stress [GO:0034599]; endothelial cell activation [GO:0042118]; leukocyte chemotaxis [GO:0030595]; lipid droplet organization [GO:0034389]; negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [GO:1902176]; negative regulation of protein K48-linked ubiquitination [GO:0061944]; negative regulation of protein kinase activity [GO:0006469]; negative regulation of protein phosphorylation [GO:0001933]; negative regulation of stress-activated MAPK cascade [GO:0032873]; negative regulation of viral life cycle [GO:1903901]; neuron differentiation [GO:0030182]; neutrophil chemotaxis [GO:0030593]; platelet activation [GO:0030168]; platelet aggregation [GO:0070527]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of protein dephosphorylation [GO:0035307]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein secretion [GO:0050714]; positive regulation of viral genome replication [GO:0045070]; protein folding [GO:0006457]; protein peptidyl-prolyl isomerization [GO:0000413]; regulation of apoptotic signaling pathway [GO:2001233]; regulation of viral genome replication [GO:0045069]; viral release from host cell [GO:0019076]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; focal adhesion [GO:0005925]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]; secretory granule lumen [GO:0034774]; vesicle [GO:0031982]	cyclosporin A binding [GO:0016018]; heparan sulfate binding [GO:1904399]; integrin binding [GO:0005178]; peptidyl-prolyl cis-trans isomerase activity [GO:0003755]; RNA binding [GO:0003723]; unfolded protein binding [GO:0051082]; virion binding [GO:0046790]	HNGTGGK	0.99593	0	8.91645	8.63525	0	9.00408	0	0	9.11902	8.6295	0	0	0
P49418	AMPH_HUMAN	Amphiphysin	AMPH AMPH1	Homo sapiens (Human)	chemical synaptic transmission [GO:0007268]; endocytosis [GO:0006897]; synaptic vesicle endocytosis [GO:0048488]	actin cytoskeleton [GO:0015629]; anchoring junction [GO:0070161]; cytosol [GO:0005829]; leading edge membrane [GO:0031256]; plasma membrane [GO:0005886]; synaptic vesicle [GO:0008021]; synaptic vesicle membrane [GO:0030672]	phospholipid binding [GO:0005543]	AEEEFQKAQK	0.86465	0	0	0	0	8.64857	8.59171	0	0	8.80739	0	9.18834	9.0649
P50570	DYN2_HUMAN	Dynamin-2 (EC 3.6.5.5)	DNM2 DYN2	Homo sapiens (Human)	antigen processing and presentation of exogenous peptide antigen via MHC class II [GO:0019886]; cellular response to carbon monoxide [GO:0071245]; cellular response to dopamine [GO:1903351]; cellular response to nitric oxide [GO:0071732]; cellular response to X-ray [GO:0071481]; endocytosis [GO:0006897]; G protein-coupled receptor internalization [GO:0002031]; G2/M transition of mitotic cell cycle [GO:0000086]; Golgi to plasma membrane transport [GO:0006893]; macropinocytosis [GO:0044351]; membrane organization [GO:0061024]; negative regulation of membrane tubulation [GO:1903526]; negative regulation of non-motile cilium assembly [GO:1902856]; negative regulation of transforming growth factor beta receptor signaling pathway [GO:0030512]; neuron projection morphogenesis [GO:0048812]; phagocytosis [GO:0006909]; positive regulation of apoptotic process [GO:0043065]; positive regulation of clathrin-dependent endocytosis [GO:2000370]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of lamellipodium assembly [GO:0010592]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of P-type sodium:potassium-exchanging transporter activity [GO:1903408]; positive regulation of phagocytosis [GO:0050766]; positive regulation of substrate adhesion-dependent cell spreading [GO:1900026]; post-Golgi vesicle-mediated transport [GO:0006892]; receptor internalization [GO:0031623]; receptor-mediated endocytosis [GO:0006898]; regulation of axon extension [GO:0030516]; regulation of DNA-templated transcription [GO:0006355]; regulation of Golgi organization [GO:1903358]; regulation of Rac protein signal transduction [GO:0035020]; response to cocaine [GO:0042220]; response to light stimulus [GO:0009416]; signal transduction [GO:0007165]; spermatogenesis [GO:0007283]; synaptic vesicle endocytosis [GO:0048488]; synaptic vesicle transport [GO:0048489]; transferrin transport [GO:0033572]	"centrosome [GO:0005813]; clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated pit [GO:0005905]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endocytic vesicle membrane [GO:0030666]; endosome [GO:0005768]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; membrane [GO:0016020]; microtubule [GO:0005874]; midbody [GO:0030496]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; phagocytic cup [GO:0001891]; phagocytic vesicle membrane [GO:0030670]; plasma membrane [GO:0005886]; postsynaptic density, intracellular component [GO:0099092]; postsynaptic membrane [GO:0045211]; presynapse [GO:0098793]; protein-containing complex [GO:0032991]; ruffle membrane [GO:0032587]; synapse [GO:0045202]; trans-Golgi network [GO:0005802]"	D2 dopamine receptor binding [GO:0031749]; enzyme binding [GO:0019899]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; microtubule binding [GO:0008017]; nitric-oxide synthase binding [GO:0050998]; phosphatidylinositol 3-kinase regulatory subunit binding [GO:0036312]; protein kinase binding [GO:0019901]; protein-containing complex binding [GO:0044877]; SH3 domain binding [GO:0017124]; WW domain binding [GO:0050699]	AALAAER	0.4303	10.3406	0	9.23225	0	0	0	0	0	0	0	14.7496	9.86324
Q5VST9	OBSCN_HUMAN	Obscurin (EC 2.7.11.1) (Obscurin-RhoGEF) (Obscurin-myosin light chain kinase) (Obscurin-MLCK)	OBSCN KIAA1556 KIAA1639	Homo sapiens (Human)	cell-cell adhesion [GO:0098609]; protein localization to M-band [GO:0036309]; protein phosphorylation [GO:0006468]; regulation of small GTPase mediated signal transduction [GO:0051056]; sarcomere organization [GO:0045214]	cell-cell junction [GO:0005911]; cytosol [GO:0005829]; integral component of plasma membrane [GO:0005887]; M band [GO:0031430]; myofibril [GO:0030016]; nuclear body [GO:0016604]; plasma membrane [GO:0005886]; sarcolemma [GO:0042383]; Z disc [GO:0030018]	"ankyrin binding [GO:0030506]; ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; cell adhesion molecule binding [GO:0050839]; guanyl-nucleotide exchange factor activity [GO:0005085]; metal ion binding [GO:0046872]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547]; phosphatidylinositol-3,4-bisphosphate binding [GO:0043325]; phosphatidylinositol-3-phosphate binding [GO:0032266]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]; phosphatidylinositol-4-phosphate binding [GO:0070273]; phosphatidylinositol-5-phosphate binding [GO:0010314]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; structural constituent of muscle [GO:0008307]; titin binding [GO:0031432]"	GPPDSPSLGVAR	0.86619	0	9.89952	0	8.15487	8.43463	8.63883	0	8.50426	0	0	0	0
H7C350	CC188_HUMAN	Coiled-coil domain-containing protein 188	CCDC188	Homo sapiens (Human)		integral component of membrane [GO:0016021]		GVLDQMEDIQLEILRERAQCR	0.99644	0	0	0	10.3329	10.5586	10.3252	0	0	0	11.183	0	0
Q5SSJ5	HP1B3_HUMAN	Heterochromatin protein 1-binding protein 3 (Protein HP1-BP74)	HP1BP3	Homo sapiens (Human)	cellular response to hypoxia [GO:0071456]; heterochromatin organization [GO:0070828]; nucleosome assembly [GO:0006334]; regulation of cell population proliferation [GO:0042127]; regulation of DNA-templated transcription [GO:0006355]; regulation of nucleus size [GO:0097298]	chromosome [GO:0005694]; nuclear speck [GO:0016607]; nucleosome [GO:0000786]; nucleus [GO:0005634]	DNA binding [GO:0003677]; nucleosome binding [GO:0031491]	KEPDDSRDEDEDEDESSEEDSEDEEPPPK	0.58036	10.3023	0	10.4317	0	0	0	0	0	0	0	10.8465	10.5226
Q7L5D6	GET4_HUMAN	Golgi to ER traffic protein 4 homolog (Conserved edge-expressed protein) (Transmembrane domain recognition complex 35 kDa subunit) (TRC35)	GET4 C7orf20 CEE TRC35 CGI-20	Homo sapiens (Human)	cytoplasmic sequestering of protein [GO:0051220]; maintenance of unfolded protein involved in ERAD pathway [GO:1904378]; post-translational protein targeting to endoplasmic reticulum membrane [GO:0006620]; protein insertion into ER membrane [GO:0045048]; regulation of protein stability [GO:0031647]; tail-anchored membrane protein insertion into ER membrane [GO:0071816]; ubiquitin-dependent protein catabolic process [GO:0006511]	BAT3 complex [GO:0071818]; chromosome [GO:0005694]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	chaperone binding [GO:0051087]	YHFLHSADGEGCANMLVEYSTSRGFR	0.85656	0	0	0	10.7144	10.6761	10.4152	0	10.1154	0	0	0	0
O95239	KIF4A_HUMAN	Chromosome-associated kinesin KIF4A (Chromokinesin-A)	KIF4A KIF4	Homo sapiens (Human)	anterograde axonal transport [GO:0008089]; mitotic cytokinesis [GO:0000281]; mitotic spindle midzone assembly [GO:0051256]; mitotic spindle organization [GO:0007052]; organelle organization [GO:0006996]; spindle elongation [GO:0051231]	axon cytoplasm [GO:1904115]; chromosome [GO:0005694]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; microtubule associated complex [GO:0005875]; midbody [GO:0030496]; nuclear matrix [GO:0016363]; nucleoplasm [GO:0005654]; spindle microtubule [GO:0005876]	ATP binding [GO:0005524]; DNA binding [GO:0003677]; iron-sulfur cluster binding [GO:0051536]; metal ion binding [GO:0046872]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777]	LLKLKESTER	0.78042	14.4169	0	0	0	0	0	13.7783	0	0	13.1556	0	0
Q6NZI2	CAVN1_HUMAN	Caveolae-associated protein 1 (Cavin-1) (Polymerase I and transcript release factor)	CAVIN1 PTRF FKSG13	Homo sapiens (Human)	positive regulation of cell motility [GO:2000147]; protein secretion [GO:0009306]; rRNA transcription [GO:0009303]; termination of RNA polymerase I transcription [GO:0006363]; transcription initiation at RNA polymerase I promoter [GO:0006361]	caveola [GO:0005901]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; intracellular membrane-bounded organelle [GO:0043231]; membrane raft [GO:0045121]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]	identical protein binding [GO:0042802]; RNA binding [GO:0003723]; rRNA primary transcript binding [GO:0042134]	LGTRLVPAER	0.57806	10.9404	0	0	0	10.1371	10.156	0	0	10.0079	0	0	0
Q14676	MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 (Nuclear factor with BRCT domains 1)	MDC1 KIAA0170 NFBD1	Homo sapiens (Human)	DNA repair [GO:0006281]; mitotic intra-S DNA damage checkpoint signaling [GO:0031573]	chromosome [GO:0005694]; focal adhesion [GO:0005925]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	FHA domain binding [GO:0070975]; protein C-terminus binding [GO:0008022]	QTDVTGEEELTKGKQDR	0.88251	10.1723	10.0653	0	0	9.90644	10.4565	0	0	0	0	0	0
Q92802	N42L2_HUMAN	NEDD4-binding protein 2-like 2 (Phosphonoformate immuno-associated protein 5)	N4BP2L2 CG005 PFAAP5	Homo sapiens (Human)	blastocyst development [GO:0001824]; negative regulation of hematopoietic stem cell differentiation [GO:1902037]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of hematopoietic stem cell proliferation [GO:1902035]	extracellular exosome [GO:0070062]; nucleus [GO:0005634]; transcription repressor complex [GO:0017053]	enzyme binding [GO:0019899]; transcription corepressor activity [GO:0003714]	HGVSRKK	0.93857	0	13.7825	13.5894	0	0	0	0	0	0	0	13.2079	0
Q5XKL5	BTBD8_HUMAN	BTB/POZ domain-containing protein 8 (AP2-interacting clathrin-endocytosis) (APache)	BTBD8 KIAA1107	Homo sapiens (Human)		nucleoplasm [GO:0005654]; nucleus [GO:0005634]		GCSEPVPQAILKK	0.51905	10.6066	0	10.296	0	0	0	9.15977	0	0	0	0	9.89421
O60303	KATIP_HUMAN	Katanin-interacting protein	KATNIP KIAA0556	Homo sapiens (Human)	cerebrospinal fluid circulation [GO:0090660]	cell projection [GO:0042995]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; extracellular space [GO:0005615]		TCISEKETRR	0.94489	0	12.9487	13.0776	0	0	0	0	0	0	0	13.263	0
A4FU28	CTGE9_HUMAN	cTAGE family member 9 (Protein cTAGE-9)	CTAGE9	Homo sapiens (Human)	endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; protein secretion [GO:0009306]; vesicle cargo loading [GO:0035459]	endoplasmic reticulum exit site [GO:0070971]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]		VEEKISHATEELETYR	0.86495	10.1723	0	0	0	0	0	0	0	0	9.54624	9.79729	9.5847
Q9P275	UBP36_HUMAN	Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.4.19.12) (Deubiquitinating enzyme 36) (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36)	USP36 KIAA1453	Homo sapiens (Human)	histone deubiquitination [GO:0016578]; negative regulation of macroautophagy [GO:0016242]; nucleolus organization [GO:0007000]; positive regulation of protein targeting to mitochondrion [GO:1903955]; protein deubiquitination [GO:0016579]; protein stabilization [GO:0050821]; regulation of apoptotic process [GO:0042981]; regulation of autophagy of mitochondrion [GO:1903146]; regulation of protein stability [GO:0031647]; regulation of rRNA processing [GO:2000232]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nuclear speck [GO:0016607]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; RNA binding [GO:0003723]	MPIVDKLK	0.99853	13.2175	0	12.9794	0	0	0	0	0	0	0	0	12.7861
P42285	MTREX_HUMAN	Exosome RNA helicase MTR4 (EC 3.6.4.13) (ATP-dependent RNA helicase DOB1) (ATP-dependent RNA helicase SKIV2L2) (Superkiller viralicidic activity 2-like 2) (TRAMP-like complex helicase)	MTREX DOB1 KIAA0052 MTR4 SKIV2L2	Homo sapiens (Human)	"cellular response to DNA damage stimulus [GO:0006974]; maturation of 5.8S rRNA [GO:0000460]; mRNA splicing, via spliceosome [GO:0000398]; RNA catabolic process [GO:0006401]; rRNA processing [GO:0006364]; snRNA catabolic process [GO:0016076]"	catalytic step 2 spliceosome [GO:0071013]; nuclear speck [GO:0016607]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; TRAMP complex [GO:0031499]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724]	IVKMIMER	0.43023	13.6245	0	0	12.6821	0	0	0	0	12.5589	0	0	0
Q9NSC7	SIA7A_HUMAN	"Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 (EC 2.4.3.3) (GalNAc alpha-2,6-sialyltransferase I) (ST6GalNAc I) (ST6GalNAc-I) (ST6GalNAcI) (hST6GalNAc-I) (Sialyltransferase 7A) (SIAT7-A)"	ST6GALNAC1 SIAT7A UNQ543/PRO848	Homo sapiens (Human)	host-mediated regulation of intestinal microbiota composition [GO:0048874]; oligosaccharide biosynthetic process [GO:0009312]; protein glycosylation [GO:0006486]	Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	"alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity [GO:0001665]; sialyltransferase activity [GO:0008373]; transferase activity [GO:0016740]"	GVTTAVIPPK	0.93927	0	0	9.60951	0	0	9.96694	0	9.91243	0	9.30184	0	0
P55017	S12A3_HUMAN	Solute carrier family 12 member 3 (Na-Cl cotransporter) (NCC) (Na-Cl symporter) (Thiazide-sensitive sodium-chloride cotransporter)	SLC12A3 NCC TSC	Homo sapiens (Human)	cell volume homeostasis [GO:0006884]; cellular response to inorganic substance [GO:0071241]; chloride ion homeostasis [GO:0055064]; chloride transmembrane transport [GO:1902476]; ion transport [GO:0006811]; potassium ion homeostasis [GO:0055075]; potassium ion import across plasma membrane [GO:1990573]; protein phosphorylation [GO:0006468]; response to aldosterone [GO:1904044]; response to dietary excess [GO:0002021]; signal transduction [GO:0007165]; sodium ion homeostasis [GO:0055078]; sodium ion transmembrane transport [GO:0035725]; sodium ion transport [GO:0006814]	apical plasma membrane [GO:0016324]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; plasma membrane [GO:0005886]	potassium:chloride symporter activity [GO:0015379]; sodium ion transmembrane transporter activity [GO:0015081]; sodium:chloride symporter activity [GO:0015378]; sodium:potassium:chloride symporter activity [GO:0008511]	NRVKSLR	0.94062	9.45224	9.41848	10.4481	0	0	0	0	0	0	0	0	8.92991
A2RRP1	NBAS_HUMAN	NBAS subunit of NRZ tethering complex (Neuroblastoma-amplified gene protein) (Neuroblastoma-amplified sequence)	NBAS NAG	Homo sapiens (Human)	"negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:2000623]; nuclear-transcribed mRNA catabolic process [GO:0000956]; protein transport [GO:0015031]; retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum [GO:0006890]"	cytosol [GO:0005829]; Dsl1/NZR complex [GO:0070939]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; membrane [GO:0016020]	SNARE binding [GO:0000149]	KFKVVASGLNYK	0.84902	10.1782	0	0	9.16669	9.30015	9.26723	0	0	0	0	0	0
P78415	IRX3_HUMAN	Iroquois-class homeodomain protein IRX-3 (Homeodomain protein IRXB1) (Iroquois homeobox protein 3)	IRX3 IRXB1	Homo sapiens (Human)	atrioventricular bundle cell differentiation [GO:0003167]; cell development [GO:0048468]; energy homeostasis [GO:0097009]; His-Purkinje system cell differentiation [GO:0060932]; mesoderm development [GO:0007498]; metanephros development [GO:0001656]; negative regulation of neuron differentiation [GO:0045665]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neuron differentiation [GO:0030182]; positive regulation of gap junction assembly [GO:1903598]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of transcription by RNA polymerase II [GO:0045944]; Purkinje myocyte development [GO:0003165]; regulation of cell communication by electrical coupling involved in cardiac conduction [GO:1901844]; regulation of transcription by RNA polymerase II [GO:0006357]; specification of loop of Henle identity [GO:0072086]	axon [GO:0030424]; chromatin [GO:0000785]; cytoplasm [GO:0005737]; nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific double-stranded DNA binding [GO:1990837]"	LVSAPLGK	0.95761	9.8304	0	9.72874	0	0	0	0	0	0	9.11793	9.2097	0
Q8TCU6	PREX1_HUMAN	"Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein (P-Rex1) (PtdIns(3,4,5)-dependent Rac exchanger 1)"	PREX1 KIAA1415	Homo sapiens (Human)	actin filament polymerization [GO:0030041]; G protein-coupled receptor signaling pathway [GO:0007186]; intracellular signal transduction [GO:0035556]; neutrophil activation [GO:0042119]; neutrophil chemotaxis [GO:0030593]; positive regulation of GTPase activity [GO:0043547]; positive regulation of substrate adhesion-dependent cell spreading [GO:1900026]; regulation of small GTPase mediated signal transduction [GO:0051056]; superoxide metabolic process [GO:0006801]; T cell differentiation [GO:0030217]	cytosol [GO:0005829]; plasma membrane [GO:0005886]	enzyme binding [GO:0019899]; GTPase activator activity [GO:0005096]; guanyl-nucleotide exchange factor activity [GO:0005085]; phospholipid binding [GO:0005543]	DQMPQGAPR	0.40506	10.4921	0	0	0	0	0	0	0	8.54551	0	9.43256	9.40773
Q15370	ELOB_HUMAN	Elongin-B (EloB) (Elongin 18 kDa subunit) (RNA polymerase II transcription factor SIII subunit B) (SIII p18) (Transcription elongation factor B polypeptide 2)	ELOB TCEB2	Homo sapiens (Human)	positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; protein ubiquitination [GO:0016567]; protein-containing complex assembly [GO:0065003]; transcription elongation by RNA polymerase II promoter [GO:0006368]; transcription initiation at RNA polymerase II promoter [GO:0006367]	Cul2-RING ubiquitin ligase complex [GO:0031462]; Cul5-RING ubiquitin ligase complex [GO:0031466]; cytosol [GO:0005829]; elongin complex [GO:0070449]; nucleoplasm [GO:0005654]; VCB complex [GO:0030891]	transcription corepressor binding [GO:0001222]; ubiquitin protein ligase binding [GO:0031625]	ESSTVFELK	0.99852	0	0	0	0	0	0	12.964	0	12.6808	12.1876	0	0
Q9HBI0	PARVG_HUMAN	Gamma-parvin	PARVG	Homo sapiens (Human)	actin cytoskeleton reorganization [GO:0031532]; cell projection assembly [GO:0030031]; cell-matrix adhesion [GO:0007160]; establishment or maintenance of cell polarity [GO:0007163]; substrate adhesion-dependent cell spreading [GO:0034446]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; focal adhesion [GO:0005925]; plasma membrane [GO:0005886]	actin binding [GO:0003779]	EAIVNFVNQK	0.58781	0	0	0	0	0	0	12.964	0	12.6808	12.1876	0	0
Q7Z5P9	MUC19_HUMAN	Mucin-19 (MUC-19)	MUC19	Homo sapiens (Human)		extracellular region [GO:0005576]; Golgi lumen [GO:0005796]; plasma membrane [GO:0005886]		AWAVRKCEILR	0.84884	0	0	9.75549	0	0	0	9.40998	0	0	9.24308	0	9.2395
Q7L5A8	FA2H_HUMAN	Fatty acid 2-hydroxylase (EC 1.14.18.-) (Fatty acid alpha-hydroxylase) (Fatty acid hydroxylase domain-containing protein 1)	FA2H FAAH FAXDC1	Homo sapiens (Human)	central nervous system myelin maintenance [GO:0032286]; ceramide biosynthetic process [GO:0046513]; establishment of skin barrier [GO:0061436]; fatty acid biosynthetic process [GO:0006633]; fatty acid metabolic process [GO:0006631]; galactosylceramide biosynthetic process [GO:0006682]; glucosylceramide biosynthetic process [GO:0006679]; lipid modification [GO:0030258]; peripheral nervous system myelin maintenance [GO:0032287]; plasma membrane raft organization [GO:0044857]; regulation of acinar cell proliferation [GO:1904697]; regulation of hair cycle [GO:0042634]; regulation of sebum secreting cell proliferation [GO:1904002]; sebaceous gland cell differentiation [GO:0001949]; sphingolipid biosynthetic process [GO:0030148]	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; membrane [GO:0016020]	fatty acid alpha-hydroxylase activity [GO:0080132]; heme binding [GO:0020037]; iron ion binding [GO:0005506]	HSANARR	0.99877	0	12.7831	12.6368	0	0	0	0	0	0	12.1496	0	0
Q71UI9	H2AV_HUMAN	Histone H2A.V (H2A.F/Z) (H2A.Z variant histone 2)	H2AZ2 H2AFV H2AV	Homo sapiens (Human)		extracellular exosome [GO:0070062]; nucleosome [GO:0000786]; nucleus [GO:0005634]	DNA binding [GO:0003677]; molecular adaptor activity [GO:0060090]; protein heterodimerization activity [GO:0046982]; structural constituent of chromatin [GO:0030527]	AGGKAGK	0.82464	9.52666	8.91361	0	0	0	0	9.03582	0	0	0	0	9.19173
Q8N9W4	GG6L2_HUMAN	Golgin subfamily A member 6-like protein 2	GOLGA6L2	Homo sapiens (Human)				ALPPSLQSSL	0.8724	0	8.42017	0	9.55311	0	9.50019	0	0	9.10268	0	0	0
O60333	KIF1B_HUMAN	Kinesin-like protein KIF1B (Klp)	KIF1B KIAA0591 KIAA1448	Homo sapiens (Human)	anterograde axonal transport [GO:0008089]; apoptotic process [GO:0006915]; cytoskeleton-dependent intracellular transport [GO:0030705]; microtubule-based movement [GO:0007018]; neuromuscular synaptic transmission [GO:0007274]; neuron-neuron synaptic transmission [GO:0007270]; vesicle-mediated transport [GO:0016192]	anchoring junction [GO:0070161]; axon [GO:0030424]; axon cytoplasm [GO:1904115]; cytoplasmic vesicle [GO:0031410]; cytoplasmic vesicle membrane [GO:0030659]; dendrite [GO:0030425]; kinesin complex [GO:0005871]; microtubule [GO:0005874]; microtubule associated complex [GO:0005875]; mitochondrion [GO:0005739]; neuron projection [GO:0043005]; synaptic vesicle [GO:0008021]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; kinesin binding [GO:0019894]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777]; plus-end-directed microtubule motor activity [GO:0008574]	NGATHYWSLEK	0.93205	0	9.30118	0	9.08321	9.21279	0	0	0	0	8.97825	0	0
Q6ZQQ6	WDR87_HUMAN	WD repeat-containing protein 87 (Testis development protein NYD-SP11)	WDR87	Homo sapiens (Human)				AWKEEWEK	0.9986	8.76894	9.75727	0	9.07133	0	0	0	8.72731	0	0	0	0
Q15075	EEA1_HUMAN	Early endosome antigen 1 (Endosome-associated protein p162) (Zinc finger FYVE domain-containing protein 2)	EEA1 ZFYVE2	Homo sapiens (Human)	early endosome to late endosome transport [GO:0045022]; endocytosis [GO:0006897]; modulation by host of viral process [GO:0044788]; synaptic vesicle to endosome fusion [GO:0016189]; vesicle fusion [GO:0006906]	axonal spine [GO:0044308]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; early endosome [GO:0005769]; early endosome membrane [GO:0031901]; extracellular exosome [GO:0070062]; extrinsic component of plasma membrane [GO:0019897]; membrane [GO:0016020]; serine-pyruvate aminotransferase complex [GO:0005969]	1-phosphatidylinositol binding [GO:0005545]; calmodulin binding [GO:0005516]; GTP-dependent protein binding [GO:0030742]; protein homodimerization activity [GO:0042803]; zinc ion binding [GO:0008270]	EEQQLQGNINELK	0.86382	0	0	12.681	0	11.4973	0	11.4763	0	0	0	0	0
O14497	ARI1A_HUMAN	"AT-rich interactive domain-containing protein 1A (ARID domain-containing protein 1A) (B120) (BRG1-associated factor 250) (BAF250) (BRG1-associated factor 250a) (BAF250A) (Osa homolog 1) (hOSA1) (SWI-like protein) (SWI/SNF complex protein p270) (SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1) (hELD)"	ARID1A BAF250 BAF250A C1orf4 OSA1 SMARCF1	Homo sapiens (Human)	androgen receptor signaling pathway [GO:0030521]; chromatin remodeling [GO:0006338]; epigenetic maintenance of chromatin in transcription-competent conformation [GO:0045815]; glucocorticoid receptor signaling pathway [GO:0042921]; intracellular estrogen receptor signaling pathway [GO:0030520]; nervous system development [GO:0007399]; nucleosome disassembly [GO:0006337]; positive regulation of cell differentiation [GO:0045597]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of double-strand break repair [GO:2000781]; positive regulation of myoblast differentiation [GO:0045663]; positive regulation of stem cell population maintenance [GO:1902459]; positive regulation of T cell differentiation [GO:0045582]; regulation of G0 to G1 transition [GO:0070316]; regulation of G1/S transition of mitotic cell cycle [GO:2000045]; regulation of mitotic metaphase/anaphase transition [GO:0030071]; regulation of nucleotide-excision repair [GO:2000819]; regulation of transcription by RNA polymerase II [GO:0006357]	bBAF complex [GO:0140092]; brahma complex [GO:0035060]; chromatin [GO:0000785]; nBAF complex [GO:0071565]; npBAF complex [GO:0071564]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; SWI/SNF complex [GO:0016514]	DNA binding [GO:0003677]; nuclear receptor binding [GO:0016922]; transcription coactivator activity [GO:0003713]	LISKFDK	0.93936	10.2281	0	0	0	8.1982	8.6027	0	0	0	0	8.50621	0
Q9H8S5	CCNP_HUMAN	Cyclin-P (Cyclin N-terminal domain-containing protein 2)	CCNP CNTD2	Homo sapiens (Human)	mitotic cell cycle phase transition [GO:0044772]; regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]	cyclin A2-CDK2 complex [GO:0097124]; cyclin-dependent protein kinase holoenzyme complex [GO:0000307]; cytoplasm [GO:0005737]; nucleus [GO:0005634]	cyclin-dependent protein serine/threonine kinase regulator activity [GO:0016538]	AERRILSR	0.93898	0	8.40416	0	0	0	0	13.7783	0	0	13.1556	0	0
O75829	CNMD_HUMAN	Leukocyte cell-derived chemotaxin 1 (Chondromodulin) [Cleaved into: Chondrosurfactant protein (CH-SP); Chondromodulin-1 (Chondromodulin-I) (ChM-I)]	CNMD CHMI LECT1 MYETS1	Homo sapiens (Human)	cartilage development [GO:0051216]; cell differentiation [GO:0030154]; negative regulation of angiogenesis [GO:0016525]; negative regulation of endothelial cell proliferation [GO:0001937]; proteoglycan metabolic process [GO:0006029]; skeletal system development [GO:0001501]	endomembrane system [GO:0012505]; extracellular region [GO:0005576]; integral component of membrane [GO:0016021]		SNPGAGR	0.89882	0	0	0	0	0	8.38672	0	0	0	8.91456	8.87778	8.81781
O75150	BRE1B_HUMAN	E3 ubiquitin-protein ligase BRE1B (BRE1-B) (EC 2.3.2.27) (95 kDa retinoblastoma-associated protein) (RBP95) (RING finger protein 40) (RING-type E3 ubiquitin transferase BRE1B)	RNF40 BRE1B KIAA0661	Homo sapiens (Human)	chromatin organization [GO:0006325]; histone H2B conserved C-terminal lysine ubiquitination [GO:0071894]; histone H2B ubiquitination [GO:0033523]; histone monoubiquitination [GO:0010390]; positive regulation of proteasomal protein catabolic process [GO:1901800]; positive regulation of protein polyubiquitination [GO:1902916]; response to peptide hormone [GO:0043434]; ubiquitin-dependent protein catabolic process [GO:0006511]	axon terminus [GO:0043679]; cytosol [GO:0005829]; extrinsic component of membrane [GO:0019898]; HULC complex [GO:0033503]; membrane [GO:0016020]; neuron projection [GO:0043005]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; ubiquitin ligase complex [GO:0000151]	metal ion binding [GO:0046872]; mRNA 3'-UTR binding [GO:0003730]; protein homodimerization activity [GO:0042803]; protein-containing complex binding [GO:0044877]; syntaxin-1 binding [GO:0017075]; ubiquitin conjugating enzyme binding [GO:0031624]; ubiquitin protein ligase activity [GO:0061630]; ubiquitin protein ligase binding [GO:0031625]	ESFNLKRAQEDISR	0.18103	9.1219	0	0	0	0	0	9.08521	0	0	0	8.27081	8.38939
P43628	KI2L3_HUMAN	Killer cell immunoglobulin-like receptor 2DL3 (CD158 antigen-like family member B2) (KIR-023GB) (Killer inhibitory receptor cl 2-3) (NKAT2a) (NKAT2b) (Natural killer-associated transcript 2) (NKAT-2) (p58 natural killer cell receptor clone CL-6) (p58 NK receptor CL-6) (p58.2 MHC class-I-specific NK receptor) (CD antigen CD158b2)	KIR2DL3 CD158B2 KIRCL23 NKAT2	Homo sapiens (Human)	immune response [GO:0006955]	integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]	antigen binding [GO:0003823]; identical protein binding [GO:0042802]; signaling receptor activity [GO:0038023]	EGEAHERRFSAGPK	0.99565	9.01061	0	0	8.68783	8.59272	8.30788	0	0	0	0	0	0
Q96QH2	PRAM_HUMAN	PML-RARA-regulated adapter molecule 1 (PRAM) (PRAM-1)	PRAM1	Homo sapiens (Human)	integrin-mediated signaling pathway [GO:0007229]; protein localization to plasma membrane [GO:0072659]; regulation of neutrophil degranulation [GO:0043313]; T cell receptor signaling pathway [GO:0050852]	plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]	lipid binding [GO:0008289]; protein kinase binding [GO:0019901]	SGAFPRK	0.95467	9.01061	0	0	8.68783	8.59272	8.30788	0	0	0	0	0	0
P35580	MYH10_HUMAN	"Myosin-10 (Cellular myosin heavy chain, type B) (Myosin heavy chain 10) (Myosin heavy chain, non-muscle IIb) (Non-muscle myosin heavy chain B) (NMMHC-B) (Non-muscle myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB)"	MYH10	Homo sapiens (Human)	actin filament-based movement [GO:0030048]; actomyosin structure organization [GO:0031032]; cell adhesion [GO:0007155]; mitotic cytokinesis [GO:0000281]; positive regulation of protein secretion [GO:0050714]; regulation of cell shape [GO:0008360]	actomyosin [GO:0042641]; cell cortex [GO:0005938]; cleavage furrow [GO:0032154]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; lamellipodium [GO:0030027]; midbody [GO:0030496]; myosin complex [GO:0016459]; myosin filament [GO:0032982]; myosin II complex [GO:0016460]; myosin II filament [GO:0097513]; nucleus [GO:0005634]; polysome [GO:0005844]; stress fiber [GO:0001725]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; ADP binding [GO:0043531]; ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; microfilament motor activity [GO:0000146]; mRNA 5'-UTR binding [GO:0048027]; RNA stem-loop binding [GO:0035613]	ALAYDKLEKTK	0.86496	8.33262	0	0	0	0	0	0	8.56278	0	0	8.61787	8.76845
P82094	TMF1_HUMAN	TATA element modulatory factor (TMF) (Androgen receptor coactivator 160 kDa protein) (Androgen receptor-associated protein of 160 kDa)	TMF1 ARA160	Homo sapiens (Human)	acrosome assembly [GO:0001675]; androgen receptor signaling pathway [GO:0030521]; defense response to bacterium [GO:0042742]; epithelial cell apoptotic process [GO:1904019]; flagellated sperm motility [GO:0030317]; Leydig cell differentiation [GO:0033327]; luteinizing hormone secretion [GO:0032275]; negative regulation of epithelial cell apoptotic process [GO:1904036]; negative regulation of gene expression [GO:0010629]; positive regulation of cytokine production [GO:0001819]; positive regulation of testosterone secretion [GO:2000845]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of proteasomal protein catabolic process [GO:0061136]; spermatid nucleus differentiation [GO:0007289]	cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; nucleus [GO:0005634]	DNA binding [GO:0003677]; nuclear androgen receptor binding [GO:0050681]; nuclear receptor coactivator activity [GO:0030374]	DIALEPKEQK	0.99757	8.31293	0	0	0	0	0	8.06366	0	0	8.87144	0	8.48848
P42696	RBM34_HUMAN	RNA-binding protein 34 (RNA-binding motif protein 34)	RBM34 KIAA0117	Homo sapiens (Human)		chromosome [GO:0005694]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	RNA binding [GO:0003723]	FKQQNSNPR	0.99676	11.4884	11.03	10.9835	0	0	0	0	0	0	0	0	0
P49023	PAXI_HUMAN	Paxillin	PXN	Homo sapiens (Human)	cell adhesion [GO:0007155]; cell migration [GO:0016477]; cell-matrix adhesion [GO:0007160]; cellular response to reactive oxygen species [GO:0034614]; endothelial cell migration [GO:0043542]; growth hormone receptor signaling pathway [GO:0060396]; positive regulation of stress fiber assembly [GO:0051496]; signal complex assembly [GO:0007172]; signal transduction [GO:0007165]; substrate adhesion-dependent cell spreading [GO:0034446]; transforming growth factor beta receptor signaling pathway [GO:0007179]	cell cortex [GO:0005938]; cell-cell junction [GO:0005911]; cytosol [GO:0005829]; focal adhesion [GO:0005925]; lamellipodium [GO:0030027]; microtubule associated complex [GO:0005875]; plasma membrane [GO:0005886]; stress fiber [GO:0001725]	beta-catenin binding [GO:0008013]; metal ion binding [GO:0046872]; neuropilin binding [GO:0038191]; protein phosphatase binding [GO:0019903]; transcription coregulator activity [GO:0003712]; vinculin binding [GO:0017166]	SSPGGQDEGGFMAQGK	0.93764	11.6918	0	11.2212	0	0	0	0	0	0	10.5791	0	0
Q9UKE5	TNIK_HUMAN	TRAF2 and NCK-interacting protein kinase (EC 2.7.11.1)	TNIK KIAA0551	Homo sapiens (Human)	actin cytoskeleton reorganization [GO:0031532]; cytoskeleton organization [GO:0007010]; intracellular signal transduction [GO:0035556]; MAPK cascade [GO:0000165]; microvillus assembly [GO:0030033]; neuron projection morphogenesis [GO:0048812]; positive regulation of JNK cascade [GO:0046330]; positive regulation of protein phosphorylation [GO:0001934]; protein autophosphorylation [GO:0046777]; protein localization to plasma membrane [GO:0072659]; protein phosphorylation [GO:0006468]; regulation of dendrite morphogenesis [GO:0048814]; regulation of MAPK cascade [GO:0043408]; response to organonitrogen compound [GO:0010243]; Wnt signaling pathway [GO:0016055]	"apical plasma membrane [GO:0016324]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; glutamatergic synapse [GO:0098978]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; postsynaptic density, intracellular component [GO:0099092]; presynapse [GO:0098793]; recycling endosome [GO:0055037]"	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	TRVRANSK	0.31852	12.1189	0	0	0	0	0	0	10.5958	10.6399	0	0	0
P51817	PRKX_HUMAN	cAMP-dependent protein kinase catalytic subunit PRKX (PrKX) (Protein kinase X) (Protein kinase X-linked) (Serine/threonine-protein kinase PRKX) (EC 2.7.11.1) (Protein kinase PKX1)	PRKX PKX1	Homo sapiens (Human)	angiogenesis [GO:0001525]; cell adhesion [GO:0007155]; cell-substrate adhesion [GO:0031589]; endothelial cell migration [GO:0043542]; endothelial cell proliferation [GO:0001935]; epithelial tube morphogenesis [GO:0060562]; kidney morphogenesis [GO:0060993]; myeloid cell differentiation [GO:0030099]; peptidyl-serine phosphorylation [GO:0018105]; protein autophosphorylation [GO:0046777]; regulation of cell adhesion [GO:0030155]; regulation of cell migration [GO:0030334]; regulation of epithelial cell differentiation involved in kidney development [GO:2000696]; signal transduction [GO:0007165]	cAMP-dependent protein kinase complex [GO:0005952]; cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	ATP binding [GO:0005524]; cAMP-dependent protein kinase activity [GO:0004691]; protein serine kinase activity [GO:0106310]	LLVVDRTRR	0.91986	0	0	0	0	0	0	10.6495	0	10.7311	0	0	11.2866
A5PKW4	PSD1_HUMAN	PH and SEC7 domain-containing protein 1 (Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6) (Exchange factor for ARF6) (Exchange factor for ARF6 A) (Pleckstrin homology and SEC7 domain-containing protein 1)	PSD EFA6 EFA6A KIAA2011 PSD1 TYL	Homo sapiens (Human)	neuron projection development [GO:0031175]; regulation of ARF protein signal transduction [GO:0032012]; signal transduction [GO:0007165]	"cleavage furrow [GO:0032154]; dendritic spine [GO:0043197]; extrinsic component of postsynaptic endosome membrane [GO:0098999]; postsynaptic density, intracellular component [GO:0099092]; ruffle membrane [GO:0032587]"	guanyl-nucleotide exchange factor activity [GO:0005085]; phospholipid binding [GO:0005543]	GMILYLQK	0.94192	0	11.0592	10.977	0	0	0	0	0	0	10.5875	0	0
Q6ZRU5	YQ032_HUMAN	Putative uncharacterized protein FLJ46089		Homo sapiens (Human)		extracellular region [GO:0005576]		ITPSACL	0.92723	11.6396	0	0	0	0	0	10.3488	10.4077	0	0	0	0
O14786	NRP1_HUMAN	Neuropilin-1 (Vascular endothelial cell growth factor 165 receptor) (CD antigen CD304)	NRP1 NRP VEGF165R	Homo sapiens (Human)	"actin cytoskeleton reorganization [GO:0031532]; angiogenesis [GO:0001525]; angiogenesis involved in coronary vascular morphogenesis [GO:0060978]; animal organ morphogenesis [GO:0009887]; artery morphogenesis [GO:0048844]; axon extension involved in axon guidance [GO:0048846]; axon guidance [GO:0007411]; axonal fasciculation [GO:0007413]; axonogenesis involved in innervation [GO:0060385]; basal dendrite arborization [GO:0150020]; basal dendrite development [GO:0150018]; branching involved in blood vessel morphogenesis [GO:0001569]; branchiomotor neuron axon guidance [GO:0021785]; cell migration involved in sprouting angiogenesis [GO:0002042]; cell-cell signaling [GO:0007267]; cellular response to hepatocyte growth factor stimulus [GO:0035729]; cellular response to vascular endothelial growth factor stimulus [GO:0035924]; commissural neuron axon guidance [GO:0071679]; coronary artery morphogenesis [GO:0060982]; dichotomous subdivision of terminal units involved in salivary gland branching [GO:0060666]; dorsal root ganglion morphogenesis [GO:1904835]; endothelial cell chemotaxis [GO:0035767]; endothelial cell migration [GO:0043542]; endothelial tip cell fate specification [GO:0097102]; facial nerve structural organization [GO:0021612]; facioacoustic ganglion development [GO:1903375]; gonadotrophin-releasing hormone neuronal migration to the hypothalamus [GO:0021828]; hepatocyte growth factor receptor signaling pathway [GO:0048012]; integrin-mediated signaling pathway [GO:0007229]; motor neuron migration [GO:0097475]; negative regulation of axon extension involved in axon guidance [GO:0048843]; negative regulation of extrinsic apoptotic signaling pathway [GO:2001237]; negative regulation of neuron apoptotic process [GO:0043524]; nerve development [GO:0021675]; neural crest cell migration [GO:0001755]; neural crest cell migration involved in autonomic nervous system development [GO:1901166]; neuron migration [GO:0001764]; neuropilin signaling pathway [GO:0038189]; otic placode development [GO:1905040]; outflow tract septum morphogenesis [GO:0003148]; platelet-derived growth factor receptor signaling pathway [GO:0048008]; positive chemotaxis [GO:0050918]; positive regulation of actin cytoskeleton reorganization [GO:2000251]; positive regulation of angiogenesis [GO:0045766]; positive regulation of axon extension involved in axon guidance [GO:0048842]; positive regulation of cell migration involved in sprouting angiogenesis [GO:0090050]; positive regulation of cytokine activity [GO:0060301]; positive regulation of endothelial cell migration [GO:0010595]; positive regulation of endothelial cell proliferation [GO:0001938]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of filopodium assembly [GO:0051491]; positive regulation of focal adhesion assembly [GO:0051894]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of phosphorylation [GO:0042327]; positive regulation of retinal ganglion cell axon guidance [GO:1902336]; positive regulation of smooth muscle cell migration [GO:0014911]; positive regulation of stress fiber assembly [GO:0051496]; positive regulation of substrate adhesion-dependent cell spreading [GO:1900026]; postsynapse organization [GO:0099173]; protein localization to early endosome [GO:1902946]; regulation of Cdc42 protein signal transduction [GO:0032489]; regulation of retinal ganglion cell axon guidance [GO:0090259]; regulation of vascular endothelial growth factor receptor signaling pathway [GO:0030947]; regulation of vesicle-mediated transport [GO:0060627]; renal artery morphogenesis [GO:0061441]; response to wounding [GO:0009611]; retina vasculature morphogenesis in camera-type eye [GO:0061299]; retinal ganglion cell axon guidance [GO:0031290]; semaphorin-plexin signaling pathway [GO:0071526]; semaphorin-plexin signaling pathway involved in axon guidance [GO:1902287]; semaphorin-plexin signaling pathway involved in neuron projection guidance [GO:1902285]; sensory neuron axon guidance [GO:0097374]; signal transduction [GO:0007165]; sprouting angiogenesis [GO:0002040]; substrate adhesion-dependent cell spreading [GO:0034446]; substrate-dependent cell migration, cell extension [GO:0006930]; sympathetic ganglion development [GO:0061549]; sympathetic neuron projection extension [GO:0097490]; sympathetic neuron projection guidance [GO:0097491]; toxin transport [GO:1901998]; trigeminal ganglion development [GO:0061551]; trigeminal nerve structural organization [GO:0021637]; vascular endothelial growth factor receptor signaling pathway [GO:0048010]; vasculogenesis [GO:0001570]; VEGF-activated neuropilin signaling pathway [GO:0038190]; VEGF-activated neuropilin signaling pathway involved in axon guidance [GO:1902378]; ventral trunk neural crest cell migration [GO:0036486]; vestibulocochlear nerve structural organization [GO:0021649]; viral entry into host cell [GO:0046718]"	axon [GO:0030424]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; early endosome [GO:0005769]; extracellular space [GO:0005615]; focal adhesion [GO:0005925]; glutamatergic synapse [GO:0098978]; integral component of plasma membrane [GO:0005887]; integral component of postsynaptic membrane [GO:0099055]; mitochondrial membrane [GO:0031966]; neurofilament [GO:0005883]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]; semaphorin receptor complex [GO:0002116]; sorting endosome [GO:0097443]	coreceptor activity [GO:0015026]; cytokine binding [GO:0019955]; growth factor binding [GO:0019838]; GTPase activator activity [GO:0005096]; heparin binding [GO:0008201]; metal ion binding [GO:0046872]; protein kinase binding [GO:0019901]; semaphorin receptor activity [GO:0017154]; signaling receptor activity [GO:0038023]; vascular endothelial growth factor binding [GO:0038085]; vascular endothelial growth factor receptor activity [GO:0005021]	SPGFPEK	0.92718	0	0	0	0	0	0	0	10.4077	0	11.0167	0	10.8948
Q53F19	NCBP3_HUMAN	Nuclear cap-binding protein subunit 3 (Protein ELG)	NCBP3 C17orf85	Homo sapiens (Human)	7-methylguanosine mRNA capping [GO:0006370]; defense response to virus [GO:0051607]; mRNA export from nucleus [GO:0006406]; mRNA transcription by RNA polymerase II [GO:0042789]; snRNA export from nucleus [GO:0006408]	cytoplasm [GO:0005737]; mRNA cap binding complex [GO:0005845]; nuclear cap binding complex [GO:0005846]; nuclear speck [GO:0016607]; nucleus [GO:0005634]; RNA cap binding complex [GO:0034518]	mRNA binding [GO:0003729]; RNA 7-methylguanosine cap binding [GO:0000340]; RNA binding [GO:0003723]; RNA cap binding [GO:0000339]	IGNKLPPEK	0.96921	0	0	0	10.7738	10.8307	10.7083	0	0	0	0	0	0
Q9H3U1	UN45A_HUMAN	Protein unc-45 homolog A (Unc-45A) (GCUNC-45) (Smooth muscle cell-associated protein 1) (SMAP-1)	UNC45A SMAP1	Homo sapiens (Human)	cell differentiation [GO:0030154]; chaperone-mediated protein folding [GO:0061077]; muscle organ development [GO:0007517]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; nuclear speck [GO:0016607]; perinuclear region of cytoplasm [GO:0048471]	cadherin binding [GO:0045296]; Hsp90 protein binding [GO:0051879]	ASQNLVVLAR	0.86861	8.97272	13.858	0	0	0	0	0	0	0	0	8.47107	0
Q96MU7	YTDC1_HUMAN	YTH domain-containing protein 1 (Splicing factor YT521) (YT521-B)	YTHDC1 KIAA1966 YT521	Homo sapiens (Human)	"dosage compensation by inactivation of X chromosome [GO:0009048]; in utero embryonic development [GO:0001701]; mRNA alternative polyadenylation [GO:0110104]; mRNA export from nucleus [GO:0006406]; mRNA splice site selection [GO:0006376]; mRNA splicing, via spliceosome [GO:0000398]; post-transcriptional regulation of gene expression [GO:0010608]; primary follicle stage [GO:0048160]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]; regulation of mRNA splicing, via spliceosome [GO:0048024]; spermatogenesis [GO:0007283]"	nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	mRNA binding [GO:0003729]; N6-methyladenosine-containing RNA binding [GO:1990247]; RNA binding [GO:0003723]	NKRLDADR	0.94292	0	0	10.8401	0	0	0	9.6962	0	0	0	10.5631	0
Q9BXW4	MLP3C_HUMAN	Microtubule-associated proteins 1A/1B light chain 3C (Autophagy-related protein LC3 C) (Autophagy-related ubiquitin-like modifier LC3 C) (MAP1 light chain 3-like protein 3) (MAP1A/MAP1B light chain 3 C) (MAP1A/MAP1B LC3 C) (Microtubule-associated protein 1 light chain 3 gamma)	MAP1LC3C	Homo sapiens (Human)	aggrephagy [GO:0035973]; autophagosome assembly [GO:0000045]; autophagosome maturation [GO:0097352]; autophagy of mitochondrion [GO:0000422]; cellular response to nitrogen starvation [GO:0006995]; cellular response to starvation [GO:0009267]; macroautophagy [GO:0016236]; protein exit from endoplasmic reticulum [GO:0032527]	autophagosome [GO:0005776]; autophagosome membrane [GO:0000421]; cytoplasmic ribonucleoprotein granule [GO:0036464]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; endomembrane system [GO:0012505]; microtubule [GO:0005874]; organelle membrane [GO:0031090]	microtubule binding [GO:0008017]; ubiquitin protein ligase binding [GO:0031625]	IPSVRPFK	0.85696	0	9.85671	9.40827	0	0	0	11.6945	0	0	0	0	0
Q9BRZ2	TRI56_HUMAN	E3 ubiquitin-protein ligase TRIM56 (EC 2.3.2.27) (RING finger protein 109) (Tripartite motif-containing protein 56)	TRIM56 RNF109	Homo sapiens (Human)	defense response to virus [GO:0051607]; innate immune response [GO:0045087]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of interferon-beta production [GO:0032728]; positive regulation of type I interferon-mediated signaling pathway [GO:0060340]; protein K63-linked ubiquitination [GO:0070534]; protein monoubiquitination [GO:0006513]; regulation of type I interferon production [GO:0032479]; response to type I interferon [GO:0034340]	chromatin [GO:0000785]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]	RNA binding [GO:0003723]; ubiquitin protein ligase activity [GO:0061630]; ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]	ITGLCPFGPR	0.25197	10.6855	10.1453	10.1154	0	0	0	0	0	0	0	0	0
P51530	DNA2_HUMAN	DNA replication ATP-dependent helicase/nuclease DNA2 (hDNA2) (DNA replication ATP-dependent helicase-like homolog) [Includes: DNA replication nuclease DNA2 (EC 3.1.-.-); DNA replication ATP-dependent helicase DNA2 (EC 3.6.4.12)]	DNA2 DNA2L KIAA0083	Homo sapiens (Human)	"base-excision repair [GO:0006284]; DNA double-strand break processing [GO:0000729]; DNA replication [GO:0006260]; DNA replication checkpoint signaling [GO:0000076]; DNA replication, Okazaki fragment processing [GO:0033567]; DNA replication, removal of RNA primer [GO:0043137]; G-quadruplex DNA unwinding [GO:0044806]; mitochondrial DNA repair [GO:0043504]; mitochondrial DNA replication [GO:0006264]; mitotic telomere maintenance via semi-conservative replication [GO:1902990]; nucleic acid phosphodiester bond hydrolysis [GO:0090305]; positive regulation of DNA replication [GO:0045740]; replication fork reversal [GO:0071932]; t-circle formation [GO:0090656]; telomere maintenance [GO:0000723]; telomere maintenance via semi-conservative replication [GO:0032201]"	"chromosome, telomeric region [GO:0000781]; cytoplasm [GO:0005737]; mitochondrial nucleoid [GO:0042645]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]"	"4 iron, 4 sulfur cluster binding [GO:0051539]; 5'-3' DNA helicase activity [GO:0043139]; 5'-flap endonuclease activity [GO:0017108]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; helicase activity [GO:0004386]; metal ion binding [GO:0046872]; nuclease activity [GO:0004518]; RNA binding [GO:0003723]; single-stranded DNA helicase activity [GO:0017116]; site-specific endodeoxyribonuclease activity, specific for altered base [GO:0016890]"	AVLSETFR	0.88271	0	0	0	10.356	10.1861	10.2998	0	0	0	0	0	0
Q8WVZ9	KBTB7_HUMAN	Kelch repeat and BTB domain-containing protein 7	KBTBD7	Homo sapiens (Human)	negative regulation of signal transduction [GO:0009968]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein K48-linked ubiquitination [GO:0070936]; regulation of Rac protein signal transduction [GO:0035020]	Cul3-RING ubiquitin ligase complex [GO:0031463]; cytosol [GO:0005829]; nucleus [GO:0005634]		TVCHVAVQWLEAAAKER	0.58667	9.95251	0	0	0	10.6615	0	10.0841	0	0	0	0	0
P57773	CXA9_HUMAN	Gap junction alpha-9 protein (Connexin-58) (Cx58) (Connexin-59) (Cx59) (Gap junction alpha-10 protein)	GJA9 GJA10	Homo sapiens (Human)	cell-cell signaling [GO:0007267]	connexin complex [GO:0005922]; integral component of membrane [GO:0016021]	gap junction channel activity [GO:0005243]	VELEEVEFEMPRDRR	0.86814	0	0	9.96029	0	0	10.4565	10.2018	0	0	0	0	0
P28068	DMB_HUMAN	"HLA class II histocompatibility antigen, DM beta chain (MHC class II antigen DMB) (Really interesting new gene 7 protein)"	HLA-DMB DMB RING7	Homo sapiens (Human)	adaptive immune response [GO:0002250]; antigen processing and presentation of exogenous peptide antigen via MHC class II [GO:0019886]; MHC class II protein complex assembly [GO:0002399]; peptide antigen assembly with MHC class II protein complex [GO:0002503]; positive regulation of T cell activation [GO:0050870]; positive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell [GO:2001190]; positive regulation of T cell proliferation [GO:0042102]	integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; MHC class II protein complex [GO:0042613]	MHC class II protein complex binding [GO:0023026]	KNGKLVMPHSSAHK	0.93771	0	0	10.2033	0	0	0	10.3583	9.99322	0	0	0	0
Q8TDU5	VNRL4_HUMAN	Putative vomeronasal receptor-like protein 4 (G-protein coupled receptor GPCR23) (hGPCR23)	VN1R17P VNRL4	Homo sapiens (Human)	response to pheromone [GO:0019236]; sensory perception of chemical stimulus [GO:0007606]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	pheromone receptor activity [GO:0016503]	LFSYIVIK	0.8689	0	9.90136	10.4228	0	0	0	0	0	0	10.1852	0	0
Q96JM2	ZN462_HUMAN	Zinc finger protein 462 (Zinc finger PBX1-interacting protein) (ZFPIP)	ZNF462 KIAA1803	Homo sapiens (Human)	chromatin organization [GO:0006325]; negative regulation of DNA binding [GO:0043392]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of gene expression [GO:0010468]	nucleus [GO:0005634]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	GVLIHYQKKHR	0.99832	0	10.2123	10.1299	0	0	0	10.0705	0	0	0	0	0
Q15029	U5S1_HUMAN	"116 kDa U5 small nuclear ribonucleoprotein component (Elongation factor Tu GTP-binding domain-containing protein 2) (SNU114 homolog) (hSNU114) (U5 snRNP-specific protein, 116 kDa) (U5-116 kDa)"	EFTUD2 KIAA0031 SNRP116	Homo sapiens (Human)	"cellular response to xenobiotic stimulus [GO:0071466]; mRNA splicing, via spliceosome [GO:0000398]; response to cocaine [GO:0042220]"	Cajal body [GO:0015030]; catalytic step 2 spliceosome [GO:0071013]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]; U2-type catalytic step 2 spliceosome [GO:0071007]; U2-type precatalytic spliceosome [GO:0071005]; U4/U6 x U5 tri-snRNP complex [GO:0046540]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]; RNA binding [GO:0003723]; U5 snRNA binding [GO:0030623]	TCFVDCLIEQTHPEIRK	0.81013	0	0	0	10.8524	9.71887	9.72434	0	0	0	0	0	0
Q9BXU1	STK31_HUMAN	Serine/threonine-protein kinase 31 (EC 2.7.11.1) (Serine/threonine-protein kinase NYD-SPK) (Sugen kinase 396) (SgK396)	STK31 SGK396	Homo sapiens (Human)	protein phosphorylation [GO:0006468]	acrosomal vesicle [GO:0001669]; cytoplasm [GO:0005737]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	DLLDAEPMK	0.15	10.416	9.93338	9.93734	0	0	0	0	0	0	0	0	0
O14974	MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A (Myosin phosphatase-targeting subunit 1) (Myosin phosphatase target subunit 1) (Protein phosphatase myosin-binding subunit)	PPP1R12A MBS MYPT1	Homo sapiens (Human)	cellular response to xenobiotic stimulus [GO:0071466]; centrosome cycle [GO:0007098]; mitotic cell cycle [GO:0000278]; negative regulation of catalytic activity [GO:0043086]; positive regulation of myosin-light-chain-phosphatase activity [GO:0035508]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein dephosphorylation [GO:0006470]; regulation of cell adhesion [GO:0030155]; regulation of myosin-light-chain-phosphatase activity [GO:0035507]; regulation of nucleocytoplasmic transport [GO:0046822]; signal transduction [GO:0007165]	A band [GO:0031672]; actin cytoskeleton [GO:0015629]; centrosome [GO:0005813]; contractile fiber [GO:0043292]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; focal adhesion [GO:0005925]; kinetochore [GO:0000776]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; PTW/PP1 phosphatase complex [GO:0072357]; Z disc [GO:0030018]	14-3-3 protein binding [GO:0071889]; enzyme inhibitor activity [GO:0004857]; phosphatase regulator activity [GO:0019208]; protein kinase binding [GO:0019901]	SLLEMEK	0.9294	10.6066	10.4814	0	0	0	9.1809	0	0	0	0	0	0
P12111	CO6A3_HUMAN	Collagen alpha-3(VI) chain	COL6A3	Homo sapiens (Human)	cell adhesion [GO:0007155]; muscle organ development [GO:0007517]	collagen type VI trimer [GO:0005589]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; extracellular vesicle [GO:1903561]; sarcolemma [GO:0042383]	extracellular matrix structural constituent conferring tensile strength [GO:0030020]; serine-type endopeptidase inhibitor activity [GO:0004867]	DVVFLLDGSEGVR	0.85841	0	0	0	0	0	8.99013	11.1993	0	10.0598	0	0	0
P46934	NEDD4_HUMAN	E3 ubiquitin-protein ligase NEDD4 (EC 2.3.2.26) (Cell proliferation-inducing gene 53 protein) (HECT-type E3 ubiquitin transferase NEDD4) (Neural precursor cell expressed developmentally down-regulated protein 4) (NEDD-4)	NEDD4 KIAA0093 NEDD4-1 RPF1 PIG53	Homo sapiens (Human)	cellular response to UV [GO:0034644]; formation of structure involved in a symbiotic process [GO:0044111]; glucocorticoid receptor signaling pathway [GO:0042921]; lysosomal transport [GO:0007041]; negative regulation of sodium ion transmembrane transporter activity [GO:2000650]; negative regulation of sodium ion transport [GO:0010766]; negative regulation of transcription from RNA polymerase II promoter in response to UV-induced DNA damage [GO:0010768]; negative regulation of vascular endothelial growth factor receptor signaling pathway [GO:0030948]; neuromuscular junction development [GO:0007528]; neuron projection development [GO:0031175]; positive regulation of nucleocytoplasmic transport [GO:0046824]; positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; positive regulation of protein catabolic process [GO:0045732]; progesterone receptor signaling pathway [GO:0050847]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein K63-linked ubiquitination [GO:0070534]; protein polyubiquitination [GO:0000209]; protein targeting to lysosome [GO:0006622]; protein ubiquitination [GO:0016567]; receptor catabolic process [GO:0032801]; receptor internalization [GO:0031623]; regulation of dendrite morphogenesis [GO:0048814]; regulation of ion transmembrane transport [GO:0034765]; regulation of macroautophagy [GO:0016241]; regulation of membrane potential [GO:0042391]; regulation of potassium ion transmembrane transporter activity [GO:1901016]; regulation of synapse organization [GO:0050807]; response to calcium ion [GO:0051592]; ubiquitin-dependent protein catabolic process [GO:0006511]; ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway [GO:0043162]; viral budding [GO:0046755]	apicolateral plasma membrane [GO:0016327]; cell cortex [GO:0005938]; chromatin [GO:0000785]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendritic spine [GO:0043197]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; ubiquitin ligase complex [GO:0000151]	beta-2 adrenergic receptor binding [GO:0031698]; enzyme binding [GO:0019899]; phosphoserine residue binding [GO:0050815]; phosphothreonine residue binding [GO:0050816]; proline-rich region binding [GO:0070064]; protein domain specific binding [GO:0019904]; RNA polymerase binding [GO:0070063]; sodium channel inhibitor activity [GO:0019871]; ubiquitin binding [GO:0043130]; ubiquitin protein ligase activity [GO:0061630]	SYYVDHNSR	0.94175	0	10.3382	10.2192	0	0	0	0	0	0	0	9.50863	0
B1AJZ9	FHAD1_HUMAN	Forkhead-associated domain-containing protein 1 (FHA domain-containing protein 1)	FHAD1 KIAA1937	Homo sapiens (Human)				ETQLSNSK	0.82942	10.7192	9.65172	9.57864	0	0	0	0	0	0	0	0	0
Q13395	TARB1_HUMAN	Probable methyltransferase TARBP1 (EC 2.1.1.-) (TAR RNA-binding protein 1) (TAR RNA-binding protein of 185 kDa) (TRP-185)	TARBP1 TRM3 TRP185	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]; tRNA methylation [GO:0030488]	nucleus [GO:0005634]	RNA binding [GO:0003723]; tRNA (guanine) methyltransferase activity [GO:0016423]	RARYLLQR	0.94616	0	9.83536	0	0	0	0	0	9.35913	0	0	10.3659	0
Q96GX5	GWL_HUMAN	Serine/threonine-protein kinase greatwall (GW) (GWL) (hGWL) (EC 2.7.11.1) (Microtubule-associated serine/threonine-protein kinase-like) (MAST-L)	MASTL GW GWL THC2	Homo sapiens (Human)	cell division [GO:0051301]; cellular response to DNA damage stimulus [GO:0006974]; female meiosis II [GO:0007147]; G2/M transition of mitotic cell cycle [GO:0000086]; intracellular signal transduction [GO:0035556]; mitotic cell cycle [GO:0000278]; negative regulation of phosphoprotein phosphatase activity [GO:0032515]; peptidyl-serine phosphorylation [GO:0018105]; positive regulation of ubiquitin protein ligase activity [GO:1904668]; regulation of cell cycle [GO:0051726]	centrosome [GO:0005813]; cleavage furrow [GO:0032154]; cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	ATP binding [GO:0005524]; kinase activity [GO:0016301]; protein phosphatase 2A binding [GO:0051721]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	DINMMDILTTPSMAKPR	0.58661	0	0	0	0	0	0	10.2018	0	0	9.54624	9.79729	0
P02452	CO1A1_HUMAN	Collagen alpha-1(I) chain (Alpha-1 type I collagen)	COL1A1	Homo sapiens (Human)	blood vessel development [GO:0001568]; bone trabecula formation [GO:0060346]; cartilage development involved in endochondral bone morphogenesis [GO:0060351]; cellular response to amino acid stimulus [GO:0071230]; cellular response to epidermal growth factor stimulus [GO:0071364]; cellular response to fibroblast growth factor stimulus [GO:0044344]; cellular response to fluoride [GO:1902618]; cellular response to mechanical stimulus [GO:0071260]; cellular response to retinoic acid [GO:0071300]; cellular response to transforming growth factor beta stimulus [GO:0071560]; cellular response to tumor necrosis factor [GO:0071356]; cellular response to vitamin E [GO:0071306]; collagen biosynthetic process [GO:0032964]; collagen fibril organization [GO:0030199]; collagen-activated tyrosine kinase receptor signaling pathway [GO:0038063]; embryonic skeletal system development [GO:0048706]; endochondral ossification [GO:0001958]; extracellular matrix organization [GO:0030198]; face morphogenesis [GO:0060325]; intramembranous ossification [GO:0001957]; negative regulation of cell-substrate adhesion [GO:0010812]; ossification [GO:0001503]; osteoblast differentiation [GO:0001649]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of cell migration [GO:0030335]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of epithelial to mesenchymal transition [GO:0010718]; protein localization to nucleus [GO:0034504]; protein transport [GO:0015031]; response to cAMP [GO:0051591]; response to corticosteroid [GO:0031960]; response to estradiol [GO:0032355]; response to hydrogen peroxide [GO:0042542]; response to hyperoxia [GO:0055093]; response to insulin [GO:0032868]; response to mechanical stimulus [GO:0009612]; response to xenobiotic stimulus [GO:0009410]; sensory perception of sound [GO:0007605]; skeletal system development [GO:0001501]; skin development [GO:0043588]; skin morphogenesis [GO:0043589]; tooth eruption [GO:0044691]; tooth mineralization [GO:0034505]; visual perception [GO:0007601]; wound healing [GO:0042060]	collagen type I trimer [GO:0005584]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; endoplasmic reticulum lumen [GO:0005788]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; secretory granule [GO:0030141]	extracellular matrix structural constituent [GO:0005201]; extracellular matrix structural constituent conferring tensile strength [GO:0030020]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; platelet-derived growth factor binding [GO:0048407]; protease binding [GO:0002020]	DGSPGAK	0.18584	10.2136	0	9.80561	0	0	0	0	0	0	0	0	9.39463
Q3MIX3	ADCK5_HUMAN	Uncharacterized aarF domain-containing protein kinase 5 (EC 2.7.11.-)	ADCK5	Homo sapiens (Human)	phosphorylation [GO:0016310]	integral component of membrane [GO:0016021]	protein serine/threonine kinase activity [GO:0004674]	SQGLAVHDIAEKLIK	0.87674	10.0705	10.1288	0	0	0	0	0	9.16749	0	0	0	0
O95425	SVIL_HUMAN	Supervillin (Archvillin) (p205/p250)	SVIL	Homo sapiens (Human)	actin filament severing [GO:0051014]; actin polymerization or depolymerization [GO:0008154]; barbed-end actin filament capping [GO:0051016]; positive regulation of cytokinesis [GO:0032467]; skeletal muscle tissue development [GO:0007519]	actin cytoskeleton [GO:0015629]; cell projection [GO:0042995]; cleavage furrow [GO:0032154]; costamere [GO:0043034]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; focal adhesion [GO:0005925]; microtubule minus-end [GO:0036449]; midbody [GO:0030496]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; podosome [GO:0002102]	"actin filament binding [GO:0051015]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]"	GRRHVQTR	0.89702	10.1694	0	0	0	0	0	0	0	9.14754	0	0	9.97671
Q8N7H5	PAF1_HUMAN	RNA polymerase II-associated factor 1 homolog (hPAF1) (Pancreatic differentiation protein 2)	PAF1 PD2	Homo sapiens (Human)	cellular response to lipopolysaccharide [GO:0071222]; endodermal cell fate commitment [GO:0001711]; histone H2B ubiquitination [GO:0033523]; histone monoubiquitination [GO:0010390]; mRNA polyadenylation [GO:0006378]; negative regulation of myeloid cell differentiation [GO:0045638]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of cell cycle G1/S phase transition [GO:1902808]; positive regulation of histone methylation [GO:0031062]; positive regulation of mRNA 3'-end processing [GO:0031442]; protein localization to nucleus [GO:0034504]; stem cell population maintenance [GO:0019827]; transcription elongation by RNA polymerase II promoter [GO:0006368]; Wnt signaling pathway [GO:0016055]	Cdc73/Paf1 complex [GO:0016593]; cell junction [GO:0030054]; cytoplasm [GO:0005737]; membrane [GO:0016020]; nucleoplasm [GO:0005654]	chromatin binding [GO:0003682]; RNA polymerase II complex binding [GO:0000993]	EGSEDEHSGSESER	0.95792	0	0	9.73044	0	0	0	9.71507	0	0	0	0	9.80012
Q8N4Z0	RAB42_HUMAN	Ras-related protein Rab-42	RAB42	Homo sapiens (Human)	Ras protein signal transduction [GO:0007265]	plasma membrane [GO:0005886]	GDP binding [GO:0019003]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]	VALLGDAAVGK	0.92264	0	0	0	14.5846	0	14.5741	0	0	0	0	0	0
Q9NQV8	PRDM8_HUMAN	PR domain zinc finger protein 8 (EC 2.1.1.-) (PR domain-containing protein 8)	PRDM8 PFM5	Homo sapiens (Human)	methylation [GO:0032259]; oligodendrocyte development [GO:0014003]; regulation of DNA-templated transcription [GO:0006355]	nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]; methyltransferase activity [GO:0008168]	DEELLVWYGK	0.51777	0	9.84378	0	0	0	0	0	0	9.95787	0	9.10884	0
Q5VTB9	RN220_HUMAN	E3 ubiquitin-protein ligase RNF220 (EC 2.3.2.27) (RING finger protein 220) (RING-type E3 ubiquitin transferase RNF220)	RNF220 C1orf164	Homo sapiens (Human)	dorsal/ventral neural tube patterning [GO:0021904]; noradrenergic neuron development [GO:0003358]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; protein autoubiquitination [GO:0051865]; protein monoubiquitination [GO:0006513]; protein ubiquitination [GO:0016567]; regulation of transcription regulatory region DNA binding [GO:2000677]	cytoplasm [GO:0005737]; nuclear lamina [GO:0005652]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]	beta-catenin binding [GO:0008013]; metal ion binding [GO:0046872]; ubiquitin protein ligase activity [GO:0061630]; ubiquitin-protein transferase activity [GO:0004842]	QEAMQKTCK	0.99951	9.70361	9.47194	9.45802	0	0	0	0	0	0	0	0	0
Q8WYB5	KAT6B_HUMAN	"Histone acetyltransferase KAT6B (EC 2.3.1.48) (Histone acetyltransferase MOZ2) (MOZ, YBF2/SAS3, SAS2 and TIP60 protein 4) (MYST-4) (Monocytic leukemia zinc finger protein-related factor)"	KAT6B KIAA0383 MORF MOZ2 MYST4	Homo sapiens (Human)	histone acetylation [GO:0016573]; histone H3 acetylation [GO:0043966]; negative regulation of DNA-templated transcription [GO:0045892]; nucleosome assembly [GO:0006334]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of developmental process [GO:0050793]; regulation of DNA-templated transcription [GO:0006355]; regulation of hemopoiesis [GO:1903706]	MOZ/MORF histone acetyltransferase complex [GO:0070776]; nucleoplasm [GO:0005654]; nucleosome [GO:0000786]; nucleus [GO:0005634]	acetyltransferase activity [GO:0016407]; DNA binding [GO:0003677]; histone acetyltransferase activity [GO:0004402]; histone binding [GO:0042393]; metal ion binding [GO:0046872]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; transcription coregulator activity [GO:0003712]	KGHPSYAPPKR	0.83066	0	0	9.23225	0	0	0	0	0	0	9.6706	9.68201	0
Q99590	SCAFB_HUMAN	"Protein SCAF11 (CTD-associated SR protein 11) (Renal carcinoma antigen NY-REN-40) (SC35-interacting protein 1) (SR-related and CTD-associated factor 11) (SRSF2-interacting protein) (Serine/arginine-rich splicing factor 2-interacting protein) (Splicing factor, arginine/serine-rich 2-interacting protein) (Splicing regulatory protein 129) (SRrp129)"	SCAF11 CASP11 SFRS2IP SIP1 SRSF2IP	Homo sapiens (Human)	"mRNA processing [GO:0006397]; RNA splicing [GO:0008380]; RNA splicing, via transesterification reactions [GO:0000375]; spliceosomal complex assembly [GO:0000245]"	nuclear body [GO:0016604]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	metal ion binding [GO:0046872]; RNA binding [GO:0003723]	LAIKPFYQNK	0.87689	0	0	0	11.2874	0	0	0	8.90758	0	0	0	8.38759
Q9ULT8	HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 (EC 2.3.2.26) (E3 ligase for inhibin receptor) (EULIR) (HECT domain-containing protein 1)	HECTD1 KIAA1131	Homo sapiens (Human)	anatomical structure development [GO:0048856]; aorta development [GO:0035904]; heart valve development [GO:0003170]; natural killer cell differentiation [GO:0001779]; negative regulation of protein localization to plasma membrane [GO:1903077]; neural tube closure [GO:0001843]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein autoubiquitination [GO:0051865]; protein K63-linked ubiquitination [GO:0070534]; protein localization to plasma membrane [GO:0072659]; protein polyubiquitination [GO:0000209]; spongiotrophoblast differentiation [GO:0060708]; trophoblast giant cell differentiation [GO:0060707]; ventricular septum development [GO:0003281]	nuclear speck [GO:0016607]	metal ion binding [GO:0046872]; ubiquitin protein ligase activity [GO:0061630]	DWSIIRGR	0.99728	10.5849	8.71438	0	0	9.26026	0	0	0	0	0	0	0
Q6SA08	TSSK4_HUMAN	Testis-specific serine/threonine-protein kinase 4 (TSK-4) (TSSK-4) (Testis-specific kinase 4) (EC 2.7.11.1) (Serine/threonine-protein kinase 22E)	TSSK4 C14orf20 STK22E TSSK5	Homo sapiens (Human)	fertilization [GO:0009566]; flagellated sperm motility [GO:0030317]; intracellular signal transduction [GO:0035556]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine autophosphorylation [GO:1990443]; positive regulation of CREB transcription factor activity [GO:0032793]; protein phosphorylation [GO:0006468]; spermatid development [GO:0007286]	acrosomal vesicle [GO:0001669]; sperm flagellum [GO:0036126]	ATP binding [GO:0005524]; magnesium ion binding [GO:0000287]; protein homodimerization activity [GO:0042803]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; protein-containing complex binding [GO:0044877]	VLRHKYLINFYR	0.83539	0	9.85671	8.93902	0	0	0	9.74715	0	0	0	0	0
Q86V86	PIM3_HUMAN	Serine/threonine-protein kinase pim-3 (EC 2.7.11.1)	PIM3	Homo sapiens (Human)	apoptotic process [GO:0006915]; cell cycle [GO:0007049]; negative regulation of apoptotic process [GO:0043066]; negative regulation of insulin secretion involved in cellular response to glucose stimulus [GO:0061179]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of mitotic cell cycle [GO:0007346]	cytoplasm [GO:0005737]; cytosol [GO:0005829]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	IADGLPVAVK	0.99791	0	0	9.20833	0	0	0	0	9.91243	0	0	0	9.41901
Q8TDZ2	MICA1_HUMAN	[F-actin]-monooxygenase MICAL1 (EC 1.14.13.225) (EC 1.6.3.1) (Molecule interacting with CasL protein 1) (MICAL-1) (NEDD9-interacting protein with calponin homology and LIM domains)	MICAL1 MICAL NICAL	Homo sapiens (Human)	actin filament bundle assembly [GO:0051017]; actin filament depolymerization [GO:0030042]; cytoskeleton organization [GO:0007010]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of protein phosphorylation [GO:0001933]; regulation of regulated secretory pathway [GO:1903305]; signal transduction [GO:0007165]; sulfur oxidation [GO:0019417]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; hippocampal mossy fiber expansion [GO:1990026]; intercellular bridge [GO:0045171]; intermediate filament [GO:0005882]; midbody [GO:0030496]; plasma membrane [GO:0005886]	"actin binding [GO:0003779]; actin filament binding [GO:0051015]; FAD binding [GO:0071949]; metal ion binding [GO:0046872]; NAD(P)H oxidase H2O2-forming activity [GO:0016174]; NADPH oxidase H202-forming activity [GO:0106294]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen [GO:0016709]; protein kinase binding [GO:0019901]; SH3 domain binding [GO:0017124]; small GTPase binding [GO:0031267]"	LNEIEAALRELEAEGVK	0.40136	9.71041	9.48583	0	0	0	0	0	9.2923	0	0	0	0
Q6IMN6	CAPR2_HUMAN	Caprin-2 (C1q domain-containing protein 1) (Cytoplasmic activation/proliferation-associated protein 2) (Gastric cancer multidrug resistance-associated protein) (Protein EEG-1) (RNA granule protein 140)	CAPRIN2 C1QDC1 EEG1 KIAA1873 RNG140	Homo sapiens (Human)	cell differentiation [GO:0030154]; negative regulation of cell growth [GO:0030308]; negative regulation of translation [GO:0017148]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of dendrite morphogenesis [GO:0050775]; positive regulation of dendritic spine morphogenesis [GO:0061003]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of protein binding [GO:0032092]; positive regulation of transcription by RNA polymerase II [GO:0045944]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]	metal ion binding [GO:0046872]; RNA binding [GO:0003723]; signaling receptor binding [GO:0005102]	GGLNGAVYLPSK	0.9795	9.87286	0	0	0	0	9.17854	0	0	9.05872	0	0	0
Q9ULI1	NWD2_HUMAN	NACHT and WD repeat domain-containing protein 2 (Leucine-rich repeat and WD repeat-containing protein KIAA1239)	NWD2 KIAA1239	Homo sapiens (Human)				ESTEVFAR	0.86717	0	0	0	0	0	0	9.52499	0	9.19473	0	0	9.37306
Q9H0H3	KLH25_HUMAN	Kelch-like protein 25 (Ectoderm-neural cortex protein 2) (ENC-2)	KLHL25 ENC2	Homo sapiens (Human)	"negative regulation of fatty acid biosynthetic process [GO:0045717]; positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation [GO:0032831]; positive regulation of fatty acid oxidation [GO:0046321]; protein ubiquitination [GO:0016567]; regulation of translational initiation [GO:0006446]; ubiquitin-dependent protein catabolic process [GO:0006511]"	Cul3-RING ubiquitin ligase complex [GO:0031463]; cytoplasm [GO:0005737]; cytosol [GO:0005829]	ubiquitin ligase-substrate adaptor activity [GO:1990756]	LYEFSWR	0.87089	10.2281	0	0	0	0	0	9.00868	0	0	0	8.50621	0
Q8IYB7	DI3L2_HUMAN	DIS3-like exonuclease 2 (hDIS3L2) (EC 3.1.13.-)	DIS3L2 FAM6A	Homo sapiens (Human)	"cell division [GO:0051301]; miRNA catabolic process [GO:0010587]; mitotic cell cycle [GO:0000278]; mitotic sister chromatid separation [GO:0051306]; mRNA catabolic process [GO:0006402]; negative regulation of cell population proliferation [GO:0008285]; nuclear-transcribed mRNA catabolic process, exonucleolytic [GO:0000291]; nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5' [GO:0034427]; polyuridylation-dependent mRNA catabolic process [GO:1990074]; stem cell population maintenance [GO:0019827]"	cytoplasm [GO:0005737]; exosome (RNase complex) [GO:0000178]; P-body [GO:0000932]; polysome [GO:0005844]	3'-5'-exoribonuclease activity [GO:0000175]; magnesium ion binding [GO:0000287]; poly(U) RNA binding [GO:0008266]; ribonuclease activity [GO:0004540]	SLTQTFGDDK	0.93807	13.8893	13.7825	0	0	0	0	0	0	0	0	0	0
Q70IA8	MOB3C_HUMAN	MOB kinase activator 3C (Mob1 homolog 2C) (Mps one binder kinase activator-like 2C)	MOB3C MOBKL2C	Homo sapiens (Human)	positive regulation of protein phosphorylation [GO:0001934]; signal transduction [GO:0007165]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	metal ion binding [GO:0046872]; protein kinase activator activity [GO:0030295]	TFRPRKR	0.88084	8.95248	9.26005	9.34174	0	0	0	0	0	0	0	0	0
Q8IUC8	GLT13_HUMAN	Polypeptide N-acetylgalactosaminyltransferase 13 (EC 2.4.1.41) (Polypeptide GalNAc transferase 13) (GalNAc-T13) (pp-GaNTase 13) (Protein-UDP acetylgalactosaminyltransferase 13) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13)	GALNT13 KIAA1918	Homo sapiens (Human)	O-glycan processing [GO:0016266]; protein O-linked glycosylation [GO:0006493]; protein O-linked glycosylation via serine [GO:0018242]; protein O-linked glycosylation via threonine [GO:0018243]	Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	carbohydrate binding [GO:0030246]; metal ion binding [GO:0046872]; polypeptide N-acetylgalactosaminyltransferase activity [GO:0004653]	ARLRGAAASK	0.86305	0	0	0	0	0	0	13.7783	0	13.5561	0	0	0
P22105	TENX_HUMAN	Tenascin-X (TN-X) (Hexabrachion-like protein)	TNXB HXBL TNX TNXB1 TNXB2 XB	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; cell adhesion [GO:0007155]; cell-cell adhesion [GO:0098609]; cell-matrix adhesion [GO:0007160]; collagen fibril organization [GO:0030199]; collagen metabolic process [GO:0032963]; elastic fiber assembly [GO:0048251]; extracellular matrix organization [GO:0030198]; fatty acid metabolic process [GO:0006631]; positive regulation of cell fate determination [GO:1905935]; positive regulation of collagen fibril organization [GO:1904028]; regulation of cell adhesion [GO:0030155]; regulation of cell differentiation [GO:0045595]; regulation of JUN kinase activity [GO:0043506]; triglyceride metabolic process [GO:0006641]	collagen-containing extracellular matrix [GO:0062023]; extracellular exosome [GO:0070062]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]	collagen binding [GO:0005518]; collagen fibril binding [GO:0098633]; extracellular matrix structural constituent [GO:0005201]; heparin binding [GO:0008201]; integrin binding [GO:0005178]	GCSQRGRCK	0.9494	9.28677	8.96015	8.96999	0	0	0	0	0	0	0	0	0
Q5H9M0	PWP3B_HUMAN	PWWP domain-containing DNA repair factor 3B (PWWP3B) (Mutated melanoma-associated antigen 1-like protein 1) (MUM1-like protein 1) (PWWP domain-containing protein MUM1L1)	PWWP3B MUM1L1	Homo sapiens (Human)		extracellular exosome [GO:0070062]		APTNEAH	0.98066	0	8.71771	0	0	0	0	0	0	0	9.19034	9.30629	0
Q9BVI0	PHF20_HUMAN	PHD finger protein 20 (Glioma-expressed antigen 2) (Hepatocellular carcinoma-associated antigen 58) (Novel zinc finger protein) (Transcription factor TZP)	PHF20 C20orf104 GLEA2 HCA58 NZF TZP	Homo sapiens (Human)	chromatin organization [GO:0006325]; histone acetylation [GO:0016573]; histone H4-K16 acetylation [GO:0043984]; histone H4-K5 acetylation [GO:0043981]; histone H4-K8 acetylation [GO:0043982]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of histone H3-K4 methylation [GO:0051571]; regulation of dosage compensation by inactivation of X chromosome [GO:1900095]; regulation of transcription by RNA polymerase II [GO:0006357]	cytosol [GO:0005829]; histone acetyltransferase complex [GO:0000123]; MLL1 complex [GO:0071339]; NSL complex [GO:0044545]; nuclear membrane [GO:0031965]; nucleoplasm [GO:0005654]	DNA binding [GO:0003677]; metal ion binding [GO:0046872]	SKEEAPSYR	0.99612	0	0	0	0	0	0	9.10973	0	0	8.99421	9.10962	0
Q9P225	DYH2_HUMAN	Dynein axonemal heavy chain 2 (Axonemal beta dynein heavy chain 2) (Ciliary dynein heavy chain 2) (Dynein heavy chain domain-containing protein 3)	DNAH2 DNAHC2 DNHD3 KIAA1503	Homo sapiens (Human)	cilium-dependent cell motility [GO:0060285]; inner dynein arm assembly [GO:0036159]; microtubule-based movement [GO:0007018]	axonemal dynein complex [GO:0005858]; axoneme [GO:0005930]; dynein complex [GO:0030286]; inner dynein arm [GO:0036156]; microtubule [GO:0005874]; motile cilium [GO:0031514]; sperm flagellum [GO:0036126]	ATP binding [GO:0005524]; dynein intermediate chain binding [GO:0045505]; dynein light intermediate chain binding [GO:0051959]; microtubule motor activity [GO:0003777]; minus-end-directed microtubule motor activity [GO:0008569]	DRNWEIIETTR	0.83501	0	0	0	8.30948	0	0	0	8.98348	9.9188	0	0	0
Q5GH76	XKR4_HUMAN	"XK-related protein 4 (hXKR4) [Cleaved into: XK-related protein 4, processed form]"	XKR4 KIAA1889 XRG4	Homo sapiens (Human)	apoptotic process involved in development [GO:1902742]; engulfment of apoptotic cell [GO:0043652]; phosphatidylserine exposure on apoptotic cell surface [GO:0070782]	integral component of membrane [GO:0016021]; membrane [GO:0016020]; plasma membrane [GO:0005886]	phospholipid scramblase activity [GO:0017128]	TVVGGGSAAGEGEARPSTPQR	0.16514	9.08754	0	0	0	0	0	0	9.12443	8.98145	0	0	0
Q499Z4	ZN672_HUMAN	Zinc finger protein 672	ZNF672	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; sequence-specific DNA binding [GO:0043565]"	FRCLECGER	0.99809	0	0	9.20731	0	0	0	0	0	0	8.92615	0	9.05512
Q32NC0	CR021_HUMAN	UPF0711 protein C18orf21 (HBV X-transactivated gene 13 protein) (HBV XAg-transactivated protein 13)	C18orf21 XTP13 PNAS-124 PNAS-131	Homo sapiens (Human)				NTSKTKK	0.94151	9.21364	9.01461	8.953	0	0	0	0	0	0	0	0	0
P84996	ALEX_HUMAN	Protein ALEX (Alternative gene product encoded by XL-exon)	GNAS GNAS1	Homo sapiens (Human)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; bone development [GO:0060348]; cognition [GO:0050890]; developmental growth [GO:0048589]; hair follicle placode formation [GO:0060789]; platelet aggregation [GO:0070527]; positive regulation of cold-induced thermogenesis [GO:0120162]; regulation of signal transduction [GO:0009966]	cytosol [GO:0005829]; membrane [GO:0016020]; plasma membrane [GO:0005886]; ruffle [GO:0001726]		VRSASLPPR	0.99733	0	9.52425	8.89491	0	0	0	0	0	0	0	8.72663	0
Q5SYB0	FRPD1_HUMAN	FERM and PDZ domain-containing protein 1 (FERM domain-containing protein 2)	FRMPD1 FRMD2 KIAA0967	Homo sapiens (Human)	establishment of protein localization to membrane [GO:0090150]; regulation of G protein-coupled receptor signaling pathway [GO:0008277]	cytoskeleton [GO:0005856]; cytosol [GO:0005829]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]		SRLCMGSQK	0.99885	0	0	0	0	9.18162	8.83857	0	0	0	8.99421	0	0
P49736	MCM2_HUMAN	DNA replication licensing factor MCM2 (EC 3.6.4.12) (Minichromosome maintenance protein 2 homolog) (Nuclear protein BM28)	MCM2 BM28 CCNL1 CDCL1 KIAA0030	Homo sapiens (Human)	apoptotic process [GO:0006915]; cellular response to interleukin-4 [GO:0071353]; cochlea development [GO:0090102]; DNA replication [GO:0006260]; DNA replication initiation [GO:0006270]; DNA unwinding involved in DNA replication [GO:0006268]; double-strand break repair via break-induced replication [GO:0000727]; mitotic DNA replication initiation [GO:1902975]; negative regulation of DNA helicase activity [GO:1905775]; nucleosome assembly [GO:0006334]; regulation of DNA-templated DNA replication initiation [GO:0030174]	"chromatin [GO:0000785]; chromosome, telomeric region [GO:0000781]; CMG complex [GO:0071162]; cytoplasm [GO:0005737]; MCM complex [GO:0042555]; nuclear origin of replication recognition complex [GO:0005664]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]"	ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; DNA replication origin binding [GO:0003688]; enzyme binding [GO:0019899]; histone binding [GO:0042393]; hydrolase activity [GO:0016787]; metal ion binding [GO:0046872]; single-stranded DNA binding [GO:0003697]	ISDMCKENR	0.99781	0	0	9.01514	0	8.96047	8.92368	0	0	0	0	0	0
Q13480	GAB1_HUMAN	GRB2-associated-binding protein 1 (GRB2-associated binder 1) (Growth factor receptor bound protein 2-associated protein 1)	GAB1	Homo sapiens (Human)	actin cytoskeleton reorganization [GO:0031532]; angiogenesis [GO:0001525]; endothelial cell chemotaxis to vascular endothelial growth factor [GO:0090668]; epidermal growth factor receptor signaling pathway [GO:0007173]; insulin receptor signaling pathway [GO:0008286]; positive regulation of angiogenesis [GO:0045766]; positive regulation of cell migration by vascular endothelial growth factor signaling pathway [GO:0038089]; response to hepatocyte growth factor [GO:0035728]; signal transduction [GO:0007165]; vascular endothelial growth factor signaling pathway [GO:0038084]	cell-cell junction [GO:0005911]; cytoplasm [GO:0005737]; cytosol [GO:0005829]	signaling adaptor activity [GO:0035591]	SSGSGSSVADER	0.94038	0	0	13.244	0	0	0	0	0	0	0	13.1726	0
Q9Y4I1	MYO5A_HUMAN	"Unconventional myosin-Va (Dilute myosin heavy chain, non-muscle) (Myosin heavy chain 12) (Myosin-12) (Myoxin)"	MYO5A MYH12	Homo sapiens (Human)	actin filament organization [GO:0007015]; actin filament-based movement [GO:0030048]; cellular response to insulin stimulus [GO:0032869]; melanosome transport [GO:0032402]; post-Golgi vesicle-mediated transport [GO:0006892]; protein localization to plasma membrane [GO:0072659]; protein transport [GO:0015031]; vesicle transport along actin filament [GO:0030050]; vesicle-mediated transport [GO:0016192]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; filopodium tip [GO:0032433]; growth cone [GO:0030426]; insulin-responsive compartment [GO:0032593]; melanosome [GO:0042470]; membrane [GO:0016020]; myosin complex [GO:0016459]; neuron projection [GO:0043005]; ruffle [GO:0001726]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; microfilament motor activity [GO:0000146]; RNA binding [GO:0003723]; small GTPase binding [GO:0031267]	KEEQVLR	0	0	0	0	8.75846	8.9305	8.62538	0	0	0	0	0	0
O14513	NCKP5_HUMAN	Nck-associated protein 5 (NAP-5) (Peripheral clock protein)	NCKAP5 ERIH NAP5	Homo sapiens (Human)	microtubule bundle formation [GO:0001578]; microtubule depolymerization [GO:0007019]	microtubule plus-end [GO:0035371]		LQREVAQRTSEGAMHEK	0.49479	9.01061	0	0	8.68783	8.59272	0	0	0	0	0	0	0
P11137	MTAP2_HUMAN	Microtubule-associated protein 2 (MAP-2)	MAP2	Homo sapiens (Human)	central nervous system neuron development [GO:0021954]; dendrite development [GO:0016358]; dendrite morphogenesis [GO:0048813]; microtubule bundle formation [GO:0001578]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of axon extension [GO:0030517]; negative regulation of microtubule binding [GO:1904527]; negative regulation of microtubule polymerization [GO:0031115]; neuron projection development [GO:0031175]; positive regulation of anterograde dense core granule transport [GO:1901953]; positive regulation of anterograde synaptic vesicle transport [GO:1903744]; regulation of microtubule polymerization [GO:0031113]; regulation of organelle transport along microtubule [GO:1902513]; regulation of protein localization [GO:0032880]	apical distal dendrite [GO:0150014]; axon hillock [GO:0043203]; axon initial segment [GO:0043194]; basal dendrite [GO:0097441]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendrite cytoplasm [GO:0032839]; dendritic branch [GO:0044307]; dendritic filopodium [GO:1902737]; dendritic growth cone [GO:0044294]; dendritic shaft [GO:0043198]; distal dendrite [GO:0150002]; microtubule [GO:0005874]; microtubule associated complex [GO:0005875]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; primary dendrite [GO:0150001]; proximal dendrite [GO:1990635]; proximal neuron projection [GO:1990769]	calmodulin binding [GO:0005516]; dystroglycan binding [GO:0002162]; microtubule binding [GO:0008017]; structural molecule activity [GO:0005198]; tau protein binding [GO:0048156]	RSSLEKHR	0.94328	0	0	0	0	0	0	0	0	0	8.48768	8.33293	9.22576
Q8NHQ9	DDX55_HUMAN	ATP-dependent RNA helicase DDX55 (EC 3.6.4.13) (DEAD box protein 55)	DDX55 KIAA1595	Homo sapiens (Human)		cytosol [GO:0005829]; membrane [GO:0016020]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724]	MPKMPELRGK	0.93712	0	0	0	0	0	0	13.2961	0	0	12.5449	0	0
Q7Z403	TMC6_HUMAN	Transmembrane channel-like protein 6 (Epidermodysplasia verruciformis protein 1) (Protein LAK-4)	TMC6 EVER1 EVIN1	Homo sapiens (Human)		cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; integral component of plasma membrane [GO:0005887]; nuclear membrane [GO:0031965]; plasma membrane [GO:0005886]; specific granule membrane [GO:0035579]; tertiary granule membrane [GO:0070821]	mechanosensitive ion channel activity [GO:0008381]	GMPLSLAEK	0.91689	0	0	0	8.86474	8.53702	8.3915	0	0	0	0	0	0
P13807	GYS1_HUMAN	"Glycogen [starch] synthase, muscle (EC 2.4.1.11)"	GYS1 GYS	Homo sapiens (Human)	glycogen biosynthetic process [GO:0005978]; heart development [GO:0007507]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; inclusion body [GO:0016234]; membrane [GO:0016020]	"glucose binding [GO:0005536]; glycogen (starch) synthase activity [GO:0004373]; glycogen synthase activity, transferring glucose-1-phosphate [GO:0061547]; protein kinase binding [GO:0019901]"	GADVFLEALAR	0.91967	0	0	0	0	0	0	12.964	0	12.6808	0	0	0
Q96P71	NECA3_HUMAN	N-terminal EF-hand calcium-binding protein 3 (Amyloid-beta A4 protein-binding family A member 2-binding protein) (Nek2-interacting protein 1) (Neuronal calcium-binding protein 3) (X11L-binding protein 51)	NECAB3 APBA2BP NIP1 SYTIP2 XB51	Homo sapiens (Human)	protein metabolic process [GO:0019538]; protein secretion [GO:0009306]; regulation of amyloid precursor protein biosynthetic process [GO:0042984]	cytoplasm [GO:0005737]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]; Golgi cis cisterna [GO:0000137]; nucleus [GO:0005634]	calcium ion binding [GO:0005509]	AVGPGPHK	0.87194	0	8.53165	0	8.68783	0	8.30788	0	0	0	0	0	0
P12955	PEPD_HUMAN	Xaa-Pro dipeptidase (X-Pro dipeptidase) (EC 3.4.13.9) (Imidodipeptidase) (Peptidase D) (Proline dipeptidase) (Prolidase)	PEPD PRD	Homo sapiens (Human)	cellular amino acid metabolic process [GO:0006520]; collagen catabolic process [GO:0030574]; proteolysis [GO:0006508]	extracellular exosome [GO:0070062]	manganese ion binding [GO:0030145]; metalloaminopeptidase activity [GO:0070006]; metallocarboxypeptidase activity [GO:0004181]; peptidase activity [GO:0008233]; proline dipeptidase activity [GO:0102009]	IHSKEHFKEK	0.91684	0	0	0	0	0	0	8.51144	8.62589	0	0	0	8.18507
Q9Y6Q1	CAN6_HUMAN	Calpain-6 (Calpain-like protease X-linked) (Calpamodulin) (CalpM)	CAPN6 CALPM CANPX	Homo sapiens (Human)	microtubule bundle formation [GO:0001578]; regulation of cytoskeleton organization [GO:0051493]	cytoplasm [GO:0005737]; perinuclear region of cytoplasm [GO:0048471]; spindle microtubule [GO:0005876]	calcium-dependent cysteine-type endopeptidase activity [GO:0004198]; microtubule binding [GO:0008017]	YTELVEEK	0.87072	0	0	0	8.34221	8.20501	8.258	0	0	0	0	0	0
Q15746	MYLK_HUMAN	"Myosin light chain kinase, smooth muscle (MLCK) (smMLCK) (EC 2.7.11.18) (Kinase-related protein) (KRP) (Telokin) [Cleaved into: Myosin light chain kinase, smooth muscle, deglutamylated form]"	MYLK MLCK MLCK1 MYLK1	Homo sapiens (Human)	aorta smooth muscle tissue morphogenesis [GO:0060414]; bleb assembly [GO:0032060]; cellular hypotonic response [GO:0071476]; positive regulation of calcium ion transport [GO:0051928]; positive regulation of cell migration [GO:0030335]; positive regulation of wound healing [GO:0090303]; protein phosphorylation [GO:0006468]; smooth muscle contraction [GO:0006939]; tonic smooth muscle contraction [GO:0014820]	actin cytoskeleton [GO:0015629]; cleavage furrow [GO:0032154]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; lamellipodium [GO:0030027]; plasma membrane [GO:0005886]; stress fiber [GO:0001725]	actin binding [GO:0003779]; ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; metal ion binding [GO:0046872]; myosin light chain kinase activity [GO:0004687]; protein kinase activity [GO:0004672]	EPEVDYRTVTINTEQK	0.98446	13.086	0	0	0	0	0	0	0	11.5507	0	0	0
A8MPS7	YDJC_HUMAN	Carbohydrate deacetylase (EC 3.5.1.-)	YDJC	Homo sapiens (Human)	carbohydrate metabolic process [GO:0005975]		deacetylase activity [GO:0019213]; magnesium ion binding [GO:0000287]	VLTAPTLR	0.92438	0	0	0	0	0	11.9704	0	0	0	0	12.5456	0
Q8IWL3	HSC20_HUMAN	"Iron-sulfur cluster co-chaperone protein HscB (DnaJ homolog subfamily C member 20) [Cleaved into: Iron-sulfur cluster co-chaperone protein HscB, cytoplasmic (C-HSC20); Iron-sulfur cluster co-chaperone protein HscB, mitochondrial]"	HSCB DNAJC20 HSC20	Homo sapiens (Human)	[2Fe-2S] cluster assembly [GO:0044571]; iron-sulfur cluster assembly [GO:0016226]; primitive erythrocyte differentiation [GO:0060319]; primitive hemopoiesis [GO:0060215]; protein complex oligomerization [GO:0051259]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]	ATPase activator activity [GO:0001671]; chaperone binding [GO:0051087]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]	TLLAPLSR	0.87359	0	0	0	0	0	11.9704	0	0	0	0	12.5456	0
Q8WYA6	CTBL1_HUMAN	Beta-catenin-like protein 1 (Nuclear-associated protein) (NAP) (Testis development protein NYD-SP19)	CTNNBL1 C20orf33 PP8304	Homo sapiens (Human)	"apoptotic process [GO:0006915]; mRNA splicing, via spliceosome [GO:0000398]; positive regulation of apoptotic process [GO:0043065]; somatic diversification of immunoglobulins [GO:0016445]"	centrosome [GO:0005813]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; Prp19 complex [GO:0000974]; spliceosomal complex [GO:0005681]	enzyme binding [GO:0019899]	KMILTFEK	0.97655	0	0	0	0	0	11.9704	0	0	0	0	12.5456	0
Q96Q89	KI20B_HUMAN	Kinesin-like protein KIF20B (Cancer/testis antigen 90) (CT90) (Kinesin family member 20B) (Kinesin-related motor interacting with PIN1) (M-phase phosphoprotein 1) (MPP1)	KIF20B KRMP1 MPHOSPH1	Homo sapiens (Human)	cell cycle [GO:0007049]; cell division [GO:0051301]; microtubule-based movement [GO:0007018]; neural tube closure [GO:0001843]; neuron projection morphogenesis [GO:0048812]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of cytokinesis [GO:0032467]; positive regulation of intracellular protein transport [GO:0090316]; positive regulation of mitotic cytokinetic process [GO:1903438]; positive regulation of neuron migration [GO:2001224]; protein localization to microtubule [GO:0035372]; regulation of cell cycle [GO:0051726]; regulation of establishment of cell polarity [GO:2000114]; regulation of mitotic nuclear division [GO:0007088]	centrosome [GO:0005813]; contractile ring [GO:0070938]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; growth cone [GO:0030426]; intercellular bridge [GO:0045171]; kinesin complex [GO:0005871]; microtubule [GO:0005874]; midbody [GO:0030496]; mitotic spindle midzone [GO:1990023]; mitotic spindle pole [GO:0097431]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; spindle midzone [GO:0051233]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777]; plus-end-directed microtubule motor activity [GO:0008574]; protein homodimerization activity [GO:0042803]; WW domain binding [GO:0050699]	NQEQEEK	0.90858	0	0	0	7.70162	0	0	8.42882	0	0	0	8.31048	0
Q5JYT7	K1755_HUMAN	Uncharacterized protein KIAA1755	KIAA1755	Homo sapiens (Human)				GAGEAER	0.77174	0	12.2102	0	0	0	0	0	0	0	0	0	11.8663
P16989	YBOX3_HUMAN	Y-box-binding protein 3 (Cold shock domain-containing protein A) (DNA-binding protein A) (Single-strand DNA-binding protein NF-GMB)	YBX3 CSDA DBPA	Homo sapiens (Human)	3'-UTR-mediated mRNA stabilization [GO:0070935]; apoptotic process [GO:0006915]; cellular hyperosmotic response [GO:0071474]; cellular response to tumor necrosis factor [GO:0071356]; ectopic germ cell programmed cell death [GO:0035234]; fertilization [GO:0009566]; in utero embryonic development [GO:0001701]; male gonad development [GO:0008584]; negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [GO:1902219]; negative regulation of necroptotic process [GO:0060546]; negative regulation of reproductive process [GO:2000242]; negative regulation of skeletal muscle tissue development [GO:0048642]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of cytoplasmic translation [GO:2000767]; positive regulation of organ growth [GO:0046622]; regulation of gene expression [GO:0010468]; spermatogenesis [GO:0007283]	bicellular tight junction [GO:0005923]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]	mRNA 3'-UTR binding [GO:0003730]; nucleic acid binding [GO:0003676]; polysome binding [GO:1905538]; RNA binding [GO:0003723]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; small GTPase binding [GO:0031267]	RGYYGRR	0.93989	0	11.9236	0	0	0	0	12.1027	0	0	0	0	0
Q6R327	RICTR_HUMAN	Rapamycin-insensitive companion of mTOR (AVO3 homolog) (hAVO3)	RICTOR KIAA1999	Homo sapiens (Human)	actin cytoskeleton reorganization [GO:0031532]; cellular response to nutrient levels [GO:0031669]; cytoskeleton organization [GO:0007010]; embryo development ending in birth or egg hatching [GO:0009792]; negative regulation of apoptotic process [GO:0043066]; peptidyl-serine phosphorylation [GO:0018105]; phosphorylation [GO:0016310]; positive regulation of actin filament polymerization [GO:0030838]; positive regulation of cell growth [GO:0030307]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of protein kinase B signaling [GO:0051897]; positive regulation of TOR signaling [GO:0032008]; regulation of actin cytoskeleton organization [GO:0032956]; regulation of establishment of cell polarity [GO:2000114]; regulation of gene expression [GO:0010468]; regulation of GTPase activity [GO:0043087]; regulation of inflammatory response [GO:0050727]; regulation of peptidyl-serine phosphorylation [GO:0033135]; regulation of protein kinase B signaling [GO:0051896]; TORC2 signaling [GO:0038203]	cytosol [GO:0005829]; TORC2 complex [GO:0031932]	molecular adaptor activity [GO:0060090]; protein kinase binding [GO:0019901]; protein serine/threonine kinase activator activity [GO:0043539]; ribosome binding [GO:0043022]	LSSESKTSNRR	0.94479	0	0	0	0	11.9778	0	0	11.8687	0	0	0	0
Q15596	NCOA2_HUMAN	Nuclear receptor coactivator 2 (NCoA-2) (Class E basic helix-loop-helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2)	NCOA2 BHLHE75 SRC2 TIF2	Homo sapiens (Human)	cellular response to hormone stimulus [GO:0032870]; cellular response to Thyroglobulin triiodothyronine [GO:1904017]; circadian regulation of gene expression [GO:0032922]; locomotor rhythm [GO:0045475]; mRNA transcription by RNA polymerase II [GO:0042789]; negative regulation of transcription by RNA polymerase II [GO:0000122]; peroxisome proliferator activated receptor signaling pathway [GO:0035357]; positive regulation of adipose tissue development [GO:1904179]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of cellular response to insulin stimulus [GO:1900076]; regulation of DNA-templated transcription [GO:0006355]; regulation of glucose metabolic process [GO:0010906]; regulation of lipid metabolic process [GO:0019216]; response to progesterone [GO:0032570]	chromatin [GO:0000785]; cytoplasm [GO:0005737]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]; RNA polymerase II transcription regulator complex [GO:0090575]; transcription regulator complex [GO:0005667]	aryl hydrocarbon receptor binding [GO:0017162]; chromatin binding [GO:0003682]; nuclear receptor binding [GO:0016922]; nuclear receptor coactivator activity [GO:0030374]; protein dimerization activity [GO:0046983]; protein domain specific binding [GO:0019904]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding [GO:0001162]; transcription coactivator activity [GO:0003713]	HHHEVLR	0.92927	0	11.9236	0	0	0	0	0	11.6071	0	0	0	0
O60449	LY75_HUMAN	Lymphocyte antigen 75 (Ly-75) (C-type lectin domain family 13 member B) (DEC-205) (gp200-MR6) (CD antigen CD205)	LY75 CD205 CLEC13B	Homo sapiens (Human)	endocytosis [GO:0006897]; immune response [GO:0006955]; inflammatory response [GO:0006954]	external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; integral component of plasma membrane [GO:0005887]	carbohydrate binding [GO:0030246]; signaling receptor activity [GO:0038023]	YLNNLYK	0.86162	0	0	11.8602	0	0	0	0	0	0	0	11.5969	0
Q9Y3Q4	HCN4_HUMAN	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4	HCN4	Homo sapiens (Human)	blood circulation [GO:0008015]; cation transport [GO:0006812]; cellular response to cAMP [GO:0071320]; cellular response to cGMP [GO:0071321]; membrane depolarization during cardiac muscle cell action potential [GO:0086012]; membrane depolarization during SA node cell action potential [GO:0086046]; muscle contraction [GO:0006936]; potassium ion import across plasma membrane [GO:1990573]; potassium ion transmembrane transport [GO:0071805]; regulation of cardiac muscle cell action potential involved in regulation of contraction [GO:0098909]; regulation of cardiac muscle contraction [GO:0055117]; regulation of cation channel activity [GO:2001257]; regulation of heart rate [GO:0002027]; regulation of heart rate by cardiac conduction [GO:0086091]; regulation of membrane depolarization [GO:0003254]; regulation of membrane potential [GO:0042391]; regulation of SA node cell action potential [GO:0098907]; SA node cell action potential [GO:0086015]; sinoatrial node development [GO:0003163]; sodium ion import across plasma membrane [GO:0098719]; sodium ion transmembrane transport [GO:0035725]	axon [GO:0030424]; dendrite [GO:0030425]; HCN channel complex [GO:0098855]; intrinsic component of plasma membrane [GO:0031226]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]	cAMP binding [GO:0030552]; identical protein binding [GO:0042802]; intracellular cAMP-activated cation channel activity [GO:0005222]; voltage-gated potassium channel activity [GO:0005249]; voltage-gated potassium channel activity involved in SA node cell action potential depolarization [GO:0086041]; voltage-gated sodium channel activity [GO:0005248]	DKLPPSMR	0.98043	0	11.6874	11.7198	0	0	0	0	0	0	0	0	0
Q8NFA0	UBP32_HUMAN	Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.4.19.12) (Deubiquitinating enzyme 32) (Renal carcinoma antigen NY-REN-60) (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32)	USP32 USP10	Homo sapiens (Human)	protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]	calcium ion binding [GO:0005509]; cysteine-type deubiquitinase activity [GO:0004843]	EISCGLSACCRGPLAERQK	0.92258	0	11.8638	0	0	0	0	0	0	0	0	11.4271	0
D6RGX4	F90AP_HUMAN	Putative protein FAM90A26	FAM90A26 FAM90A26P	Homo sapiens (Human)				DPKPGAK	0.90444	0	0	11.6662	0	0	0	0	0	0	0	11.554	0
Q9NSD4	ZN275_HUMAN	Zinc finger protein 275	ZNF275	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	QELLKHQR	0.99153	11.7184	11.5005	0	0	0	0	0	0	0	0	0	0
A6NC98	CC88B_HUMAN	Coiled-coil domain-containing protein 88B (Brain leucine zipper domain-containing protein) (Gipie) (Hook-related protein 3) (HkRP3)	CCDC88B BRLZ	Homo sapiens (Human)	cytoplasmic microtubule organization [GO:0031122]; cytoskeleton-dependent intracellular transport [GO:0030705]; defense response to protozoan [GO:0042832]; positive regulation of cytokine production [GO:0001819]; positive regulation of T cell activation [GO:0050870]; positive regulation of T cell proliferation [GO:0042102]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]; nucleoplasm [GO:0005654]	dynein light intermediate chain binding [GO:0051959]; microtubule binding [GO:0008017]	LMQDGHRQR	0.99673	11.6672	0	11.4277	0	0	0	0	0	0	0	0	0
Q8TAF3	WDR48_HUMAN	WD repeat-containing protein 48 (USP1-associated factor 1) (WD repeat endosomal protein) (p80)	WDR48 KIAA1449 UAF1	Homo sapiens (Human)	cellular response to DNA damage stimulus [GO:0006974]; double-strand break repair via homologous recombination [GO:0000724]; embryonic organ development [GO:0048568]; homeostasis of number of cells [GO:0048872]; multicellular organism growth [GO:0035264]; positive regulation of double-strand break repair via homologous recombination [GO:1905168]; positive regulation of epithelial cell proliferation [GO:0050679]; protein deubiquitination [GO:0016579]; regulation of protein monoubiquitination [GO:1902525]; seminiferous tubule development [GO:0072520]; single fertilization [GO:0007338]; skeletal system morphogenesis [GO:0048705]; skin development [GO:0043588]; spermatogenesis [GO:0007283]	cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; late endosome [GO:0005770]; lysosome [GO:0005764]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	deubiquitinase activator activity [GO:0035800]; DNA binding [GO:0003677]; double-stranded DNA binding [GO:0003690]; single-stranded DNA binding [GO:0003697]; ubiquitin binding [GO:0043130]	ELVASAGLDR	0.82911	11.3092	0	0	0	0	0	11.5104	0	0	0	0	0
P49916	DNLI3_HUMAN	DNA ligase 3 (EC 6.5.1.1) (DNA ligase III) (Polydeoxyribonucleotide synthase [ATP] 3)	LIG3	Homo sapiens (Human)	"base-excision repair, DNA ligation [GO:0006288]; base-excision repair, gap-filling [GO:0006287]; cell cycle [GO:0007049]; cell division [GO:0051301]; DNA biosynthetic process [GO:0071897]; DNA ligation [GO:0006266]; double-strand break repair [GO:0006302]; double-strand break repair via alternative nonhomologous end joining [GO:0097681]; double-strand break repair via homologous recombination [GO:0000724]; lagging strand elongation [GO:0006273]; mitochondrial DNA repair [GO:0043504]; mitochondrion organization [GO:0007005]; negative regulation of mitochondrial DNA replication [GO:0090298]"	cytoplasm [GO:0005737]; DNA ligase III-XRCC1 complex [GO:0070421]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA ligase (ATP) activity [GO:0003910]; DNA ligase activity [GO:0003909]; zinc ion binding [GO:0008270]	AAGTPKK	0.76261	12.2058	0	10.5069	0	0	0	0	0	0	0	0	0
A8K979	ERI2_HUMAN	ERI1 exoribonuclease 2 (EC 3.1.-.-) (Exonuclease domain-containing protein 1)	ERI2 EXOD1 KIAA1504	Homo sapiens (Human)	"exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000467]"		3'-5'-exoribonuclease activity [GO:0000175]; nucleic acid binding [GO:0003676]; zinc ion binding [GO:0008270]	SGKMTPPLCK	0.99977	11.4884	0	10.9835	0	0	0	0	0	0	0	0	0
Q14152	EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 subunit 10) (eIF-3-theta) (eIF3 p167) (eIF3 p180) (eIF3 p185)	EIF3A EIF3S10 KIAA0139	Homo sapiens (Human)	formation of cytoplasmic translation initiation complex [GO:0001732]; IRES-dependent viral translational initiation [GO:0075522]; translation reinitiation [GO:0002188]; translational initiation [GO:0006413]; viral translational termination-reinitiation [GO:0075525]	"cytoplasm [GO:0005737]; cytosol [GO:0005829]; eukaryotic 43S preinitiation complex [GO:0016282]; eukaryotic 48S preinitiation complex [GO:0033290]; eukaryotic translation initiation factor 3 complex [GO:0005852]; eukaryotic translation initiation factor 3 complex, eIF3e [GO:0071540]; eukaryotic translation initiation factor 3 complex, eIF3m [GO:0071541]; membrane [GO:0016020]; multi-eIF complex [GO:0043614]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; postsynaptic density [GO:0014069]"	mRNA binding [GO:0003729]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198]; translation initiation factor activity [GO:0003743]	ASWRAEKDR	0.87417	11.4884	0	10.9835	0	0	0	0	0	0	0	0	0
P27144	KAD4_HUMAN	"Adenylate kinase 4, mitochondrial (AK 4) (EC 2.7.4.10) (EC 2.7.4.6) (Adenylate kinase 3-like) (GTP:AMP phosphotransferase AK4)"	AK4 AK3 AK3L1	Homo sapiens (Human)	ADP biosynthetic process [GO:0006172]; AMP metabolic process [GO:0046033]; ATP metabolic process [GO:0046034]; cellular response to hypoxia [GO:0071456]; GTP metabolic process [GO:0046039]; nucleobase-containing small molecule interconversion [GO:0015949]; nucleoside diphosphate phosphorylation [GO:0006165]; nucleoside triphosphate biosynthetic process [GO:0009142]; regulation of ATP biosynthetic process [GO:2001169]; regulation of oxidative phosphorylation [GO:0002082]	cytoplasm [GO:0005737]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]	adenylate kinase activity [GO:0004017]; ATP binding [GO:0005524]; GTP binding [GO:0005525]; nucleoside diphosphate kinase activity [GO:0004550]; nucleoside monophosphate kinase activity [GO:0050145]; nucleoside triphosphate adenylate kinase activity [GO:0046899]	AVILGPPGSGK	0.16346	11.5827	0	0	0	0	0	0	0	10.6705	0	0	0
O75311	GLRA3_HUMAN	Glycine receptor subunit alpha-3	GLRA3	Homo sapiens (Human)	"chemical synaptic transmission [GO:0007268]; chloride transmembrane transport [GO:1902476]; ion transmembrane transport [GO:0034220]; nervous system process [GO:0050877]; neuropeptide signaling pathway [GO:0007218]; protein homooligomerization [GO:0051260]; regulation of membrane potential [GO:0042391]; response to amino acid [GO:0043200]; signal transduction [GO:0007165]; synaptic transmission, glycinergic [GO:0060012]"	anchoring junction [GO:0070161]; dendrite [GO:0030425]; glycine-gated chloride channel complex [GO:0016935]; integral component of plasma membrane [GO:0005887]; neuron projection [GO:0043005]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; postsynaptic membrane [GO:0045211]; synapse [GO:0045202]	excitatory extracellular ligand-gated ion channel activity [GO:0005231]; extracellularly glycine-gated chloride channel activity [GO:0016934]; glycine binding [GO:0016594]; glycine-gated chloride ion channel activity [GO:0022852]; metal ion binding [GO:0046872]; neurotransmitter receptor activity [GO:0030594]; transmembrane signaling receptor activity [GO:0004888]; transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential [GO:1904315]	AKKIDTISR	0.96561	0	10.9682	0	0	0	0	0	0	0	0	11.1608	0
P23634	AT2B4_HUMAN	Plasma membrane calcium-transporting ATPase 4 (PMCA4) (EC 7.2.2.10) (Matrix-remodeling-associated protein 1) (Plasma membrane calcium ATPase isoform 4) (Plasma membrane calcium pump isoform 4)	ATP2B4 ATP2B2 MXRA1	Homo sapiens (Human)	calcium ion export [GO:1901660]; calcium ion import across plasma membrane [GO:0098703]; calcium ion transmembrane import into cytosol [GO:0097553]; calcium ion transmembrane transport [GO:0070588]; cellular calcium ion homeostasis [GO:0006874]; cellular response to acetylcholine [GO:1905145]; cellular response to epinephrine stimulus [GO:0071872]; flagellated sperm motility [GO:0030317]; hippocampus development [GO:0021766]; ion transmembrane transport [GO:0034220]; negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process [GO:0140199]; negative regulation of angiogenesis [GO:0016525]; negative regulation of arginine catabolic process [GO:1900082]; negative regulation of blood vessel endothelial cell migration [GO:0043537]; negative regulation of calcineurin-NFAT signaling cascade [GO:0070885]; negative regulation of cardiac muscle hypertrophy in response to stress [GO:1903243]; negative regulation of cellular response to vascular endothelial growth factor stimulus [GO:1902548]; negative regulation of citrulline biosynthetic process [GO:1903249]; negative regulation of gene expression [GO:0010629]; negative regulation of nitric oxide biosynthetic process [GO:0045019]; negative regulation of nitric oxide mediated signal transduction [GO:0010751]; negative regulation of nitric-oxide synthase activity [GO:0051001]; negative regulation of peptidyl-cysteine S-nitrosylation [GO:1902083]; negative regulation of the force of heart contraction [GO:0098736]; neural retina development [GO:0003407]; positive regulation of cAMP-dependent protein kinase activity [GO:2000481]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of protein localization to plasma membrane [GO:1903078]; regulation of cardiac conduction [GO:1903779]; regulation of cell cycle G1/S phase transition [GO:1902806]; regulation of cytosolic calcium ion concentration [GO:0051480]; regulation of sodium ion transmembrane transport [GO:1902305]; regulation of transcription by RNA polymerase II [GO:0006357]; response to hydrostatic pressure [GO:0051599]; spermatogenesis [GO:0007283]; transport across blood-brain barrier [GO:0150104]; urinary bladder smooth muscle contraction [GO:0014832]	basolateral plasma membrane [GO:0016323]; caveola [GO:0005901]; glutamatergic synapse [GO:0098978]; integral component of plasma membrane [GO:0005887]; integral component of presynaptic active zone membrane [GO:0099059]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; membrane raft [GO:0045121]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; sperm flagellum [GO:0036126]; sperm principal piece [GO:0097228]; T-tubule [GO:0030315]; Z disc [GO:0030018]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATPase-coupled cation transmembrane transporter activity [GO:0019829]; calcium ion transmembrane transporter activity [GO:0015085]; calmodulin binding [GO:0005516]; metal ion binding [GO:0046872]; nitric-oxide synthase binding [GO:0050998]; nitric-oxide synthase inhibitor activity [GO:0036487]; P-type calcium transporter activity [GO:0005388]; PDZ domain binding [GO:0030165]; protein kinase binding [GO:0019901]; protein phosphatase 2B binding [GO:0030346]; scaffold protein binding [GO:0097110]; sodium channel regulator activity [GO:0017080]	EKQFRGLQCR	0.99685	0	0	0	0	0	0	0	11.4823	10.5931	0	0	0
Q14005	IL16_HUMAN	Pro-interleukin-16 [Cleaved into: Interleukin-16 (IL-16) (Lymphocyte chemoattractant factor) (LCF)]	IL16	Homo sapiens (Human)	cytokine-mediated signaling pathway [GO:0019221]; immune response [GO:0006955]; induction of positive chemotaxis [GO:0050930]; leukocyte chemotaxis [GO:0030595]; positive regulation of inflammatory response [GO:0050729]; positive regulation of interleukin-1 alpha production [GO:0032730]; positive regulation of interleukin-12 production [GO:0032735]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of neutrophil activation [GO:1902565]; regulation of calcium ion transport [GO:0051924]	cytosol [GO:0005829]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Flemming body [GO:0090543]; focal adhesion [GO:0005925]; nuclear speck [GO:0016607]; plasma membrane [GO:0005886]	CD4 receptor binding [GO:0042609]; cytokine activity [GO:0005125]	SAAPTDR	0.92857	0	0	0	0	0	0	0	0	10.7311	0	0	11.2866
Q6ZP82	CC141_HUMAN	Coiled-coil domain-containing protein 141 (Coiled-coil protein associated with myosin II and DISC1)	CCDC141 CAMDI	Homo sapiens (Human)	centrosome localization [GO:0051642]; cerebral cortex radially oriented cell migration [GO:0021799]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; neuron projection [GO:0043005]		ELEFVEQPK	0.91943	0	11.03	10.9835	0	0	0	0	0	0	0	0	0
Q14789	GOGB1_HUMAN	Golgin subfamily B member 1 (372 kDa Golgi complex-associated protein) (GCP372) (Giantin) (Macrogolgin)	GOLGB1	Homo sapiens (Human)	chondrocyte proliferation [GO:0035988]; Golgi organization [GO:0007030]; protein localization to pericentriolar material [GO:1905793]; regulation of DNA-templated transcription [GO:0006355]	cis-Golgi network [GO:0005801]; cytosol [GO:0005829]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; Golgi stack [GO:0005795]; integral component of membrane [GO:0016021]; membrane [GO:0016020]	RNA binding [GO:0003723]; sequence-specific DNA binding [GO:0043565]	DTVLGRLALLQEERDK	0.41975	8.64465	0	0	0	0	0	0	0	0	0	13.263	0
O60486	PLXC1_HUMAN	Plexin-C1 (Virus-encoded semaphorin protein receptor) (CD antigen CD232)	PLXNC1 VESPR	Homo sapiens (Human)	cell adhesion [GO:0007155]; negative regulation of cell adhesion [GO:0007162]; positive regulation of axonogenesis [GO:0050772]; regulation of cell migration [GO:0030334]; regulation of cell shape [GO:0008360]; regulation of GTPase activity [GO:0043087]; semaphorin-plexin signaling pathway involved in axon guidance [GO:1902287]	integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; plasma membrane [GO:0005886]; semaphorin receptor complex [GO:0002116]	semaphorin receptor activity [GO:0017154]; signaling receptor binding [GO:0005102]	NESLTALDALICNK	0.41333	0	0	0	0	10.8307	0	11.059	0	0	0	0	0
Q9UPX6	MNAR1_HUMAN	Major intrinsically disordered Notch2-binding receptor 1 (Membrane integral NOTCH2-associated receptor 1) (Ubiquitination and mTOR signaling protein)	MINAR1 KIAA1024 UBTOR	Homo sapiens (Human)	angiogenesis [GO:0001525]; negative regulation of angiogenesis [GO:0016525]; negative regulation of cell growth [GO:0030308]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of neuron projection development [GO:0010977]; negative regulation of protein ubiquitination [GO:0031397]; negative regulation of TOR signaling [GO:0032007]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]		QSSKCRK	0.86207	11.6605	0	10.1903	0	0	0	0	0	0	0	0	0
P08559	ODPA_HUMAN	"Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (EC 1.2.4.1) (PDHE1-A type I)"	PDHA1 PHE1A	Homo sapiens (Human)	acetyl-CoA biosynthetic process from pyruvate [GO:0006086]; glucose metabolic process [GO:0006006]; mitochondrial acetyl-CoA biosynthetic process from pyruvate [GO:0061732]; tricarboxylic acid cycle [GO:0006099]	mitochondrial matrix [GO:0005759]; mitochondrial pyruvate dehydrogenase complex [GO:0005967]; mitochondrion [GO:0005739]; nucleolus [GO:0005730]; nucleus [GO:0005634]; pyruvate dehydrogenase complex [GO:0045254]	pyruvate dehydrogenase (acetyl-transferring) activity [GO:0004739]; pyruvate dehydrogenase (NAD+) activity [GO:0034604]	RKMLAAVSR	0.99528	0	0	0	0	10.5806	0	0	0	0	0	0	11.2422
O60318	GANP_HUMAN	Germinal-center associated nuclear protein (GANP) (EC 2.3.1.48) (80 kDa MCM3-associated protein) (MCM3 acetylating protein) (MCM3AP) (EC 2.3.1.-) (MCM3 acetyltransferase)	MCM3AP GANP KIAA0572 MAP80	Homo sapiens (Human)	mRNA export from nucleus [GO:0006406]; nucleosome organization [GO:0034728]; poly(A)+ mRNA export from nucleus [GO:0016973]; protein transport [GO:0015031]; somatic hypermutation of immunoglobulin genes [GO:0016446]	chromosome [GO:0005694]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nuclear membrane [GO:0031965]; nuclear pore nuclear basket [GO:0044615]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription export complex 2 [GO:0070390]	chromatin binding [GO:0003682]; H3 histone acetyltransferase activity [GO:0010484]; histone acetyltransferase activity [GO:0004402]; histone binding [GO:0042393]; nucleic acid binding [GO:0003676]	ERYMRETR	0.93977	0	11.4151	0	0	0	0	0	0	0	0	0	10.4006
Q96ST2	IWS1_HUMAN	Protein IWS1 homolog (IWS1-like protein)	IWS1 IWS1L	Homo sapiens (Human)	mRNA processing [GO:0006397]; poly(A)+ mRNA export from nucleus [GO:0016973]; regulation of histone H3-K36 trimethylation [GO:2001253]; regulation of histone H4 acetylation [GO:0090239]; regulation of mRNA export from nucleus [GO:0010793]; regulation of mRNA processing [GO:0050684]; RNA splicing [GO:0008380]	nucleoplasm [GO:0005654]; nucleus [GO:0005634]		KSRSAHAVK	0.63668	0	0	0	10.7148	0	0	0	0	0	0	11.0983	0
P02774	VTDB_HUMAN	Vitamin D-binding protein (DBP) (VDB) (Gc protein-derived macrophage activating factor) (Gc-MAF) (GcMAF) (Gc-globulin) (Group-specific component) (Gc) (Vitamin D-binding protein-macrophage activating factor) (DBP-maf)	GC	Homo sapiens (Human)	vitamin D metabolic process [GO:0042359]; vitamin transport [GO:0051180]	blood microparticle [GO:0072562]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; lysosomal lumen [GO:0043202]	actin binding [GO:0003779]; calcidiol binding [GO:1902118]; vitamin D binding [GO:0005499]; vitamin transmembrane transporter activity [GO:0090482]	ELPEHTVK	0	8.50104	0	0	13.1852	0	0	0	0	0	0	0	0
P98155	VLDLR_HUMAN	Very low-density lipoprotein receptor (VLDL receptor) (VLDL-R)	VLDLR	Homo sapiens (Human)	cholesterol metabolic process [GO:0008203]; dendrite morphogenesis [GO:0048813]; glycoprotein transport [GO:0034436]; lipid transport [GO:0006869]; memory [GO:0007613]; nervous system development [GO:0007399]; positive regulation of dendrite development [GO:1900006]; positive regulation of protein kinase activity [GO:0045860]; receptor-mediated endocytosis [GO:0006898]; reelin-mediated signaling pathway [GO:0038026]; signal transduction [GO:0007165]; ventral spinal cord development [GO:0021517]; very-low-density lipoprotein particle clearance [GO:0034447]	clathrin-coated pit [GO:0005905]; integral component of membrane [GO:0016021]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]; very-low-density lipoprotein particle [GO:0034361]	apolipoprotein binding [GO:0034185]; calcium ion binding [GO:0005509]; calcium-dependent protein binding [GO:0048306]; cargo receptor activity [GO:0038024]; low-density lipoprotein particle receptor activity [GO:0005041]; reelin receptor activity [GO:0038025]; very-low-density lipoprotein particle binding [GO:0034189]; very-low-density lipoprotein particle receptor activity [GO:0030229]	CITLLWK	0.94508	10.5787	0	0	0	0	0	11.0695	0	0	0	0	0
Q8IWJ2	GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 (185 kDa Golgi coiled-coil protein) (GCC185) (CLL-associated antigen KW-11) (CTCL tumor antigen se1-1) (Ran-binding protein 2-like 4) (RanBP2L4) (Renal carcinoma antigen NY-REN-53)	GCC2 KIAA0336 RANBP2L4	Homo sapiens (Human)	"Golgi ribbon formation [GO:0090161]; late endosome to Golgi transport [GO:0034499]; microtubule anchoring [GO:0034453]; microtubule organizing center organization [GO:0031023]; protein localization to Golgi apparatus [GO:0034067]; protein targeting to lysosome [GO:0006622]; recycling endosome to Golgi transport [GO:0071955]; regulation of protein exit from endoplasmic reticulum [GO:0070861]; retrograde transport, endosome to Golgi [GO:0042147]"	cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; trans-Golgi network [GO:0005802]	identical protein binding [GO:0042802]; small GTPase binding [GO:0031267]	DALLETVNR	0.87344	11.3092	0	10.1903	0	0	0	0	0	0	0	0	0
Q05823	RN5A_HUMAN	2-5A-dependent ribonuclease (2-5A-dependent RNase) (EC 3.1.26.-) (Ribonuclease 4) (Ribonuclease L) (RNase L)	RNASEL RNS4	Homo sapiens (Human)	defense response to virus [GO:0051607]; fat cell differentiation [GO:0045444]; mRNA processing [GO:0006397]; negative regulation of viral genome replication [GO:0045071]; positive regulation of glucose import [GO:0046326]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein phosphorylation [GO:0006468]; regulation of mRNA stability [GO:0043488]; RNA processing [GO:0006396]; rRNA processing [GO:0006364]	cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; nuclear matrix [GO:0016363]	ATP binding [GO:0005524]; endoribonuclease activity [GO:0004521]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; protein kinase activity [GO:0004672]; ribonuclease activity [GO:0004540]; ribonucleoprotein complex binding [GO:0043021]; RNA binding [GO:0003723]; rRNA binding [GO:0019843]	VLLSHGAK	0.90472	0	0	0	0	10.4165	0	0	0	10.9617	0	0	0
Q14498	RBM39_HUMAN	RNA-binding protein 39 (CAPER alpha) (CAPERalpha) (Hepatocellular carcinoma protein 1) (RNA-binding motif protein 39) (RNA-binding region-containing protein 2) (Splicing factor HCC1)	RBM39 HCC1 RNPC2	Homo sapiens (Human)	"mRNA processing [GO:0006397]; regulation of mRNA splicing, via spliceosome [GO:0048024]; RNA processing [GO:0006396]; RNA splicing [GO:0008380]"	centriolar satellite [GO:0034451]; microtubule cytoskeleton [GO:0015630]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; protein-containing complex [GO:0032991]	RNA binding [GO:0003723]; RS domain binding [GO:0050733]	SRSHERK	0.94229	0	0	0	0	0	0	0	0	10.4017	0	10.9709	0
Q8N612	FHI1B_HUMAN	FHF complex subunit HOOK interacting protein 1B (FHIP1B) (FTS and Hook-interacting protein) (FHIP)	FHIP1B C11orf56 FAM160A2 KIAA1759	Homo sapiens (Human)	early endosome to late endosome transport [GO:0045022]; endosome organization [GO:0007032]; endosome to lysosome transport [GO:0008333]; lysosome organization [GO:0007040]; protein localization to perinuclear region of cytoplasm [GO:1905719]; protein transport [GO:0015031]	cytosol [GO:0005829]; FHF complex [GO:0070695]		HAHSPTR	0.92745	0	0	10.9547	0	0	0	0	0	0	10.3956	0	0
Q9H7N4	SFR19_HUMAN	"Splicing factor, arginine/serine-rich 19 (SR-related C-terminal domain-associated factor 1) (SR-related and CTD-associated factor 1) (SR-related-CTD-associated factor) (SCAF) (Serine arginine-rich pre-mRNA splicing factor SR-A1) (SR-A1)"	SCAF1 SFRS19 SRA1	Homo sapiens (Human)	mRNA processing [GO:0006397]; RNA splicing [GO:0008380]; transcription by RNA polymerase II [GO:0006366]	nucleus [GO:0005634]	protein domain specific binding [GO:0019904]; RNA binding [GO:0003723]; RNA polymerase II C-terminal domain binding [GO:0099122]	GTKGKTKPSK	0.95816	0	0	11.0287	0	0	0	0	0	10.2531	0	0	0
Q53TS8	CTSRT_HUMAN	Cation channel sperm-associated targeting subunit tau (CatSper-tau) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 11 protein) (C2 calcium-dependent domain-containing protein 6)	C2CD6 ALS2CR11 CATSPERT	Homo sapiens (Human)	flagellated sperm motility [GO:0030317]; sperm capacitation [GO:0048240]; spermatogenesis [GO:0007283]; vesicle-mediated transport to the plasma membrane [GO:0098876]	CatSper complex [GO:0036128]; sperm principal piece [GO:0097228]		MKSLDRK	0.99674	11.4851	9.7653	0	0	0	0	0	0	0	0	0	0
A2IDD5	CCD78_HUMAN	Coiled-coil domain-containing protein 78 (hsCCDC78)	CCDC78 C16orf25 JFP10	Homo sapiens (Human)	cell projection organization [GO:0030030]; de novo centriole assembly involved in multi-ciliated epithelial cell differentiation [GO:0098535]; skeletal muscle contraction [GO:0003009]	centriole [GO:0005814]; cytoplasm [GO:0005737]; deuterosome [GO:0098536]; perinuclear region of cytoplasm [GO:0048471]; sarcolemma [GO:0042383]; sarcoplasmic reticulum [GO:0016529]		SREQQLAR	1	0	0	0	0	0	0	0	0	0	10.4287	0	10.57
Q9C0H5	RHG39_HUMAN	Rho GTPase-activating protein 39	ARHGAP39 KIAA1688	Homo sapiens (Human)	postsynapse organization [GO:0099173]; regulation of small GTPase mediated signal transduction [GO:0051056]; signal transduction [GO:0007165]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; glutamatergic synapse [GO:0098978]; nucleus [GO:0005634]	GTPase activator activity [GO:0005096]	SPGRKPRPFLQPNK	0.87126	0	0	0	0	0	0	0	10.5602	10.3433	0	0	0
Q6ZU80	CE128_HUMAN	Centrosomal protein of 128 kDa (Cep128)	CEP128 C14orf145 C14orf61	Homo sapiens (Human)	protein localization [GO:0008104]	centriolar subdistal appendage [GO:0120103]; centriole [GO:0005814]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; spindle pole [GO:0000922]		LKLKYQCLK	0.89223	0	10.6573	0	0	0	0	0	0	0	0	0	9.95923
Q8N4X5	AF1L2_HUMAN	Actin filament-associated protein 1-like 2 (AFAP1-like protein 2)	AFAP1L2 KIAA1914 XB130	Homo sapiens (Human)	inflammatory response [GO:0006954]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of epidermal growth factor receptor signaling pathway [GO:0045742]; positive regulation of interleukin-8 production [GO:0032757]; regulation of interleukin-6 production [GO:0032675]; regulation of mitotic cell cycle [GO:0007346]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; plasma membrane [GO:0005886]	protein tyrosine kinase activator activity [GO:0030296]; SH2 domain binding [GO:0042169]; SH3 domain binding [GO:0017124]; signaling adaptor activity [GO:0035591]	SLETSSYLNVLVNSQWK	0.40994	9.95251	0	0	0	10.6615	0	0	0	0	0	0	0
Q06587	RING1_HUMAN	E3 ubiquitin-protein ligase RING1 (EC 2.3.2.27) (Polycomb complex protein RING1) (RING finger protein 1) (RING-type E3 ubiquitin transferase RING1) (Really interesting new gene 1 protein)	RING1 RNF1	Homo sapiens (Human)	anterior/posterior pattern specification [GO:0009952]; camera-type eye morphogenesis [GO:0048593]; chromatin organization [GO:0006325]; histone H2A monoubiquitination [GO:0035518]; negative regulation of DNA-templated transcription [GO:0045892]	cytosol [GO:0005829]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; PcG protein complex [GO:0031519]; PRC1 complex [GO:0035102]; sex chromatin [GO:0001739]; ubiquitin ligase complex [GO:0000151]	chromatin binding [GO:0003682]; metal ion binding [GO:0046872]; ubiquitin protein ligase activity [GO:0061630]; ubiquitin-protein transferase activator activity [GO:0097027]	VSRPLELCYAPTK	0.59438	0	0	0	0	0	0	10.3583	0	10.0079	0	0	0
Q6ZTR5	CFA47_HUMAN	Cilia- and flagella-associated protein 47	CFAP47 CHDC2 CXorf22 CXorf30 CXorf59	Homo sapiens (Human)	cilium assembly [GO:0060271]; sperm axoneme assembly [GO:0007288]	cilium [GO:0005929]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; sperm connecting piece [GO:0097224]		DEDTFDR	0.97968	0	10.7773	0	9.58509	0	0	0	0	0	0	0	0
Q53FT3	HIKES_HUMAN	Protein Hikeshi	HIKESHI C11orf73 HSPC138 HSPC179 HSPC248	Homo sapiens (Human)	cellular response to heat [GO:0034605]; Golgi organization [GO:0007030]; lung development [GO:0030324]; protein import into nucleus [GO:0006606]; protein transport [GO:0015031]	cytosol [GO:0005829]; nuclear body [GO:0016604]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	Hsp70 protein binding [GO:0030544]; molecular adaptor activity [GO:0060090]; nuclear import signal receptor activity [GO:0061608]	WYENFQRR	0.99752	0	9.85148	10.4531	0	0	0	0	0	0	0	0	0
Q9UF56	FXL17_HUMAN	F-box/LRR-repeat protein 17 (F-box and leucine-rich repeat protein 17) (F-box only protein 13)	FBXL17 FBL17 FBX13 FBXO13	Homo sapiens (Human)	entrainment of circadian clock by photoperiod [GO:0043153]; G2/M transition of mitotic cell cycle [GO:0000086]; nervous system development [GO:0007399]; neural crest cell differentiation [GO:0014033]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein polyubiquitination [GO:0000209]; protein quality control for misfolded or incompletely synthesized proteins [GO:0006515]; protein ubiquitination [GO:0016567]; regulation of cell cycle [GO:0051726]; regulation of smoothened signaling pathway [GO:0008589]; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; SCF ubiquitin ligase complex [GO:0019005]		IYMQENK	0.99977	0	10.2123	0	0	0	0	10.0705	0	0	0	0	0
P41182	BCL6_HUMAN	B-cell lymphoma 6 protein (BCL-6) (B-cell lymphoma 5 protein) (BCL-5) (Protein LAZ-3) (Zinc finger and BTB domain-containing protein 27) (Zinc finger protein 51)	BCL6 BCL5 LAZ3 ZBTB27 ZNF51	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; B cell proliferation [GO:0042100]; cell morphogenesis [GO:0000902]; cell-matrix adhesion [GO:0007160]; cellular response to DNA damage stimulus [GO:0006974]; erythrocyte development [GO:0048821]; germinal center formation [GO:0002467]; histone deacetylation [GO:0016575]; inflammatory response [GO:0006954]; isotype switching to IgE isotypes [GO:0048289]; negative regulation of B cell apoptotic process [GO:0002903]; negative regulation of cell growth [GO:0030308]; negative regulation of cell-matrix adhesion [GO:0001953]; negative regulation of cellular senescence [GO:2000773]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of isotype switching to IgE isotypes [GO:0048294]; negative regulation of leukocyte proliferation [GO:0070664]; negative regulation of mast cell cytokine production [GO:0032764]; negative regulation of mitotic cell cycle DNA replication [GO:1903464]; negative regulation of Notch signaling pathway [GO:0045746]; negative regulation of plasma cell differentiation [GO:1900099]; negative regulation of Rho protein signal transduction [GO:0035024]; negative regulation of T-helper 2 cell differentiation [GO:0045629]; negative regulation of transcription by RNA polymerase II [GO:0000122]; plasma cell differentiation [GO:0002317]; positive regulation of apoptotic process [GO:0043065]; positive regulation of B cell proliferation [GO:0030890]; positive regulation of histone deacetylation [GO:0031065]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of regulatory T cell differentiation [GO:0045591]; protein localization [GO:0008104]; pyramidal neuron differentiation [GO:0021859]; regulation of cell differentiation [GO:0045595]; regulation of cell population proliferation [GO:0042127]; regulation of cytokine production [GO:0001817]; regulation of germinal center formation [GO:0002634]; regulation of GTPase activity [GO:0043087]; regulation of immune response [GO:0050776]; regulation of immune system process [GO:0002682]; regulation of inflammatory response [GO:0050727]; regulation of memory T cell differentiation [GO:0043380]; regulation of T cell proliferation [GO:0042129]; regulation of transcription by RNA polymerase II [GO:0006357]; Rho protein signal transduction [GO:0007266]; spermatogenesis [GO:0007283]; T-helper 2 cell differentiation [GO:0045064]; transcription by RNA polymerase II [GO:0006366]; type 2 immune response [GO:0042092]	Golgi apparatus [GO:0005794]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; paraspeckles [GO:0042382]	"chromatin binding [GO:0003682]; chromatin DNA binding [GO:0031490]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor binding [GO:0140297]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; identical protein binding [GO:0042802]; intronic transcription regulatory region sequence-specific DNA binding [GO:0001161]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]; sequence-specific double-stranded DNA binding [GO:1990837]; transcription corepressor binding [GO:0001222]"	CETCGAR	0.87207	0	0	0	0	0	10.013	0	10.2282	0	0	0	0
Q8NBI5	S43A3_HUMAN	Equilibrative nucleobase transporter 1 (Protein FOAP-13) (Solute carrier family 43 member 3)	SLC43A3 ENBT1 PSEC0252	Homo sapiens (Human)	hypoxanthine transport [GO:0035344]	basolateral plasma membrane [GO:0016323]; integral component of membrane [GO:0016021]	adenine transmembrane transporter activity [GO:0015207]; fatty acid transmembrane transporter activity [GO:0015245]; guanine transmembrane transporter activity [GO:0015208]; xenobiotic transmembrane transporter activity [GO:0042910]	ESPSAIA	0.58704	8.70701	0	11.508	0	0	0	0	0	0	0	0	0
Q04637	IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 (eIF-4-gamma 1) (eIF-4G 1) (eIF-4G1) (p220)	EIF4G1 EIF4F EIF4G EIF4GI	Homo sapiens (Human)	behavioral fear response [GO:0001662]; cap-dependent translational initiation [GO:0002191]; cellular macromolecule biosynthetic process [GO:0034645]; cellular response to nutrient levels [GO:0031669]; energy homeostasis [GO:0097009]; lung development [GO:0030324]; miRNA-mediated gene silencing by inhibition of translation [GO:0035278]; negative regulation of autophagy [GO:0010507]; negative regulation of neuron death [GO:1901215]; negative regulation of peptidyl-threonine phosphorylation [GO:0010801]; neuron differentiation [GO:0030182]; positive regulation of cell death [GO:0010942]; positive regulation of cell growth [GO:0030307]; positive regulation of eukaryotic translation initiation factor 4F complex assembly [GO:1905537]; positive regulation of G1/S transition of mitotic cell cycle [GO:1900087]; positive regulation of mRNA cap binding [GO:1905612]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of protein metabolic process [GO:0051247]; positive regulation of translation in response to endoplasmic reticulum stress [GO:0036493]; regulation of cellular response to stress [GO:0080135]; regulation of miRNA-mediated gene silencing [GO:0060964]; regulation of polysome binding [GO:1905696]; regulation of presynapse assembly [GO:1905606]; regulation of translational initiation [GO:0006446]; response to ethanol [GO:0045471]; translation [GO:0006412]; translational initiation [GO:0006413]	cytoplasm [GO:0005737]; cytoplasmic stress granule [GO:0010494]; cytosol [GO:0005829]; eukaryotic translation initiation factor 4F complex [GO:0016281]; membrane [GO:0016020]; nucleus [GO:0005634]; polysome [GO:0005844]; postsynapse [GO:0098794]	"ATP binding [GO:0005524]; eukaryotic initiation factor 4E binding [GO:0008190]; identical protein binding [GO:0042802]; molecular adaptor activity [GO:0060090]; mRNA binding [GO:0003729]; RNA binding [GO:0003723]; translation factor activity, RNA binding [GO:0008135]; translation initiation factor activity [GO:0003743]; translation initiation factor binding [GO:0031369]"	GVIDLIFEK	0.99808	10.4736	0	0	0	0	0	0	0	0	0	0	9.73139
P15924	DESP_HUMAN	Desmoplakin (DP) (250/210 kDa paraneoplastic pemphigus antigen)	DSP	Homo sapiens (Human)	adherens junction organization [GO:0034332]; bundle of His cell-Purkinje myocyte adhesion involved in cell communication [GO:0086073]; cell-cell adhesion [GO:0098609]; desmosome organization [GO:0002934]; epidermis development [GO:0008544]; epithelial cell-cell adhesion [GO:0090136]; intermediate filament cytoskeleton organization [GO:0045104]; intermediate filament organization [GO:0045109]; keratinocyte differentiation [GO:0030216]; peptide cross-linking [GO:0018149]; protein localization to cell-cell junction [GO:0150105]; regulation of heart rate by cardiac conduction [GO:0086091]; regulation of ventricular cardiac muscle cell action potential [GO:0098911]; skin development [GO:0043588]; ventricular compact myocardium morphogenesis [GO:0003223]; wound healing [GO:0042060]	basolateral plasma membrane [GO:0016323]; cornified envelope [GO:0001533]; cytoplasm [GO:0005737]; desmosome [GO:0030057]; extracellular exosome [GO:0070062]; fascia adherens [GO:0005916]; ficolin-1-rich granule membrane [GO:0101003]; intercalated disc [GO:0014704]; intermediate filament [GO:0005882]; membrane [GO:0016020]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	cell adhesive protein binding involved in bundle of His cell-Purkinje myocyte communication [GO:0086083]; protein kinase C binding [GO:0005080]; RNA binding [GO:0003723]; scaffold protein binding [GO:0097110]; structural constituent of cytoskeleton [GO:0005200]; structural molecule activity [GO:0005198]	DANSENCNK	0.98109	0	0	0	0	0	0	0	0	0	9.21018	10.9449	0
Q6PCB5	RSBNL_HUMAN	Lysine-specific demethylase RSBN1L (EC 1.14.11.-) (Round spermatid basic protein 1-like protein)	RSBN1L	Homo sapiens (Human)		nucleus [GO:0005634]	dioxygenase activity [GO:0051213]; metal ion binding [GO:0046872]	NLDTKNYDSK	0.99912	0	10.1606	9.94119	0	0	0	0	0	0	0	0	0
Q8IYX7	SAXO1_HUMAN	Stabilizer of axonemal microtubules 1	SAXO1 C9orf138 FAM154A	Homo sapiens (Human)	cell projection organization [GO:0030030]; cellular response to cold [GO:0070417]; cold acclimation [GO:0009631]; positive regulation of cilium assembly [GO:0045724]; protein stabilization [GO:0050821]	axonemal microtubule [GO:0005879]; centriole [GO:0005814]; ciliary basal body [GO:0036064]; cytoskeleton [GO:0005856]; motile cilium [GO:0031514]; sperm flagellum [GO:0036126]	microtubule binding [GO:0008017]	ADYLPWNQPRR	0.99648	0	9.77248	0	0	0	10.2419	0	0	0	0	0	0
O15527	OGG1_HUMAN	N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (AP lyase) (EC 4.2.99.18)]	OGG1 MMH MUTM OGH1	Homo sapiens (Human)	"acute inflammatory response [GO:0002526]; aging [GO:0007568]; base-excision repair [GO:0006284]; base-excision repair, AP site formation [GO:0006285]; cellular response to cadmium ion [GO:0071276]; cellular response to DNA damage stimulus [GO:0006974]; depurination [GO:0045007]; depyrimidination [GO:0045008]; negative regulation of apoptotic process [GO:0043066]; negative regulation of double-strand break repair via single-strand annealing [GO:1901291]; nucleotide-excision repair, DNA incision [GO:0033683]; regulation of DNA-templated transcription [GO:0006355]; response to estradiol [GO:0032355]; response to ethanol [GO:0045471]; response to folic acid [GO:0051593]; response to light stimulus [GO:0009416]; response to oxidative stress [GO:0006979]; response to radiation [GO:0009314]; response to xenobiotic stimulus [GO:0009410]"	cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; nuclear matrix [GO:0016363]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]	"8-oxo-7,8-dihydroguanine DNA N-glycosylase activity [GO:0034039]; class I DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0140078]; damaged DNA binding [GO:0003684]; endonuclease activity [GO:0004519]; microtubule binding [GO:0008017]; oxidized purine DNA binding [GO:0032357]; oxidized purine nucleobase lesion DNA N-glycosylase activity [GO:0008534]"	GPSPQTNKELGNFFR	0.35971	0	0	10.2719	0	0	0	9.71675	0	0	0	0	0
Q99909	SSX3_HUMAN	Protein SSX3 (Cancer/testis antigen 5.3) (CT5.3)	SSX3	Homo sapiens (Human)	regulation of DNA-templated transcription [GO:0006355]	nucleus [GO:0005634]		LGFKAILPSFMRNK	0.94872	0	0	9.40827	0	0	0	0	10.5602	0	0	0	0
Q13017	RHG05_HUMAN	Rho GTPase-activating protein 5 (Rho-type GTPase-activating protein 5) (p190-B)	ARHGAP5 RHOGAP5	Homo sapiens (Human)	cell adhesion [GO:0007155]; mammary gland development [GO:0030879]; regulation of cell size [GO:0008361]; regulation of small GTPase mediated signal transduction [GO:0051056]; Rho protein signal transduction [GO:0007266]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; plasma membrane [GO:0005886]	GTP binding [GO:0005525]; GTPase activator activity [GO:0005096]; GTPase activity [GO:0003924]; SH2 domain binding [GO:0042169]	TDQDNIQK	0.94197	0	0	0	0	0	0	0	10.0772	0	0	9.82818	0
P56962	STX17_HUMAN	Syntaxin-17	STX17	Homo sapiens (Human)	autophagosome maturation [GO:0097352]; autophagosome membrane docking [GO:0016240]; endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; endoplasmic reticulum-Golgi intermediate compartment organization [GO:0097111]; exocytosis [GO:0006887]; Golgi organization [GO:0007030]; intracellular protein transport [GO:0006886]; protein localization to phagophore assembly site [GO:0034497]; vesicle docking [GO:0048278]; vesicle fusion [GO:0006906]	autophagosome [GO:0005776]; autophagosome membrane [GO:0000421]; COPII-coated ER to Golgi transport vesicle [GO:0030134]; cytosol [GO:0005829]; endomembrane system [GO:0012505]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; ER to Golgi transport vesicle membrane [GO:0012507]; integral component of membrane [GO:0016021]; mitochondria-associated endoplasmic reticulum membrane [GO:0044233]; mitochondrion [GO:0005739]; plasma membrane [GO:0005886]; smooth endoplasmic reticulum membrane [GO:0030868]; SNARE complex [GO:0031201]	protein kinase binding [GO:0019901]; protein phosphatase binding [GO:0019903]; SNAP receptor activity [GO:0005484]; SNARE binding [GO:0000149]	KHQINIEK	0.99805	0	9.94904	0	0	0	0	0	0	0	9.94295	0	0
Q15477	SKIV2_HUMAN	Helicase SKI2W (Ski2) (EC 3.6.4.-) (Helicase-like protein) (HLP)	SKIV2L DDX13 SKI2W SKIV2 W	Homo sapiens (Human)	"nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay [GO:0070478]; RNA catabolic process [GO:0006401]"	cytosol [GO:0005829]; nucleus [GO:0005634]; Ski complex [GO:0055087]	ATP binding [GO:0005524]; hydrolase activity [GO:0016787]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724]	LVGEPVLGAK	0.9077	0	0	0	9.90988	0	9.96694	0	0	0	0	0	0
P55008	AIF1_HUMAN	Allograft inflammatory factor 1 (AIF-1) (Ionized calcium-binding adapter molecule 1) (Protein G1)	AIF1 G1 IBA1	Homo sapiens (Human)	"actin crosslink formation [GO:0051764]; actin filament bundle assembly [GO:0051017]; actin filament polymerization [GO:0030041]; cellular response to extracellular stimulus [GO:0031668]; cellular response to hormone stimulus [GO:0032870]; cellular response to hydroperoxide [GO:0071447]; cellular response to interferon-gamma [GO:0071346]; cellular response to morphine [GO:0071315]; cellular response to oxidative stress [GO:0034599]; cerebellum development [GO:0021549]; inflammatory response [GO:0006954]; microglial cell activation [GO:0001774]; negative regulation of apoptotic process [GO:0043066]; negative regulation of gene expression [GO:0010629]; negative regulation of smooth muscle cell chemotaxis [GO:0071672]; negative regulation of smooth muscle cell proliferation [GO:0048662]; parallel actin filament bundle assembly [GO:0030046]; phagocytosis, engulfment [GO:0006911]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of chemokine production [GO:0032722]; positive regulation of chemotaxis [GO:0050921]; positive regulation of fibroblast growth factor production [GO:0090271]; positive regulation of G1/S transition of mitotic cell cycle [GO:1900087]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of monocyte chemotaxis [GO:0090026]; positive regulation of mononuclear cell migration [GO:0071677]; positive regulation of muscle hyperplasia [GO:0014739]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of smooth muscle cell chemotaxis [GO:0071673]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of T cell migration [GO:2000406]; positive regulation of T cell proliferation [GO:0042102]; Rac protein signal transduction [GO:0016601]; regulation of gene expression [GO:0010468]; response to axon injury [GO:0048678]; response to electrical stimulus [GO:0051602]; response to glucocorticoid [GO:0051384]; ruffle assembly [GO:0097178]"	actin filament [GO:0005884]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; glial cell projection [GO:0097386]; lamellipodium [GO:0030027]; nucleus [GO:0005634]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]; phagocytic cup [GO:0001891]; ruffle [GO:0001726]; ruffle membrane [GO:0032587]	actin filament binding [GO:0051015]; calcium ion binding [GO:0005509]	YSSDEDLPSK	0.94191	0	10.3382	0	0	0	0	0	0	0	0	9.50863	0
O15031	PLXB2_HUMAN	Plexin-B2 (MM1)	PLXNB2 KIAA0315	Homo sapiens (Human)	brain development [GO:0007420]; excitatory synapse assembly [GO:1904861]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; negative regulation of cell adhesion [GO:0007162]; neural tube closure [GO:0001843]; neuroblast proliferation [GO:0007405]; positive regulation of axonogenesis [GO:0050772]; positive regulation of neuron projection development [GO:0010976]; positive regulation of translation [GO:0045727]; regulation of cell migration [GO:0030334]; regulation of cell shape [GO:0008360]; regulation of GTPase activity [GO:0043087]; regulation of neuron migration [GO:2001222]; regulation of protein phosphorylation [GO:0001932]; semaphorin-plexin signaling pathway [GO:0071526]; semaphorin-plexin signaling pathway involved in axon guidance [GO:1902287]	cell surface [GO:0009986]; extracellular exosome [GO:0070062]; integral component of plasma membrane [GO:0005887]; semaphorin receptor complex [GO:0002116]	semaphorin receptor activity [GO:0017154]	SDCSLCR	0.9287	0	0	0	0	9.75891	0	0	10.0251	0	0	0	0
A0MZ66	SHOT1_HUMAN	Shootin-1 (Shootin1)	SHTN1 KIAA1598	Homo sapiens (Human)	"actin filament bundle retrograde transport [GO:0061573]; axonogenesis [GO:0007409]; Cdc42 protein signal transduction [GO:0032488]; cytoplasmic actin-based contraction involved in cell motility [GO:0060327]; endoplasmic reticulum polarization [GO:0061163]; netrin-activated signaling pathway [GO:0038007]; neuron projection morphogenesis [GO:0048812]; positive regulation of axon extension [GO:0045773]; positive regulation of neuron migration [GO:2001224]; Ras protein signal transduction [GO:0007265]; regulation of establishment of cell polarity [GO:2000114]; substrate-dependent cell migration, cell extension [GO:0006930]"	axon [GO:0030424]; axonal growth cone [GO:0044295]; cell leading edge [GO:0031252]; cytoplasm [GO:0005737]; filopodium [GO:0030175]; growth cone [GO:0030426]; lamellipodium [GO:0030027]; microtubule [GO:0005874]; microtubule associated complex [GO:0005875]; microtubule cytoskeleton [GO:0015630]; perikaryon [GO:0043204]; perinuclear region of cytoplasm [GO:0048471]	actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; identical protein binding [GO:0042802]; kinesin binding [GO:0019894]	ARNLKHSVDELQK	0.87369	0	0	0	0	0	0	0	0	9.95104	0	0	9.82375
Q9NYF8	BCLF1_HUMAN	Bcl-2-associated transcription factor 1 (Btf) (BCLAF1 and THRAP3 family member 1)	BCLAF1 BTF KIAA0164	Homo sapiens (Human)	apoptotic process [GO:0006915]; cellular response to leukemia inhibitory factor [GO:1990830]; negative regulation of DNA-templated transcription [GO:0045892]; positive regulation of apoptotic process [GO:0043065]; positive regulation of DNA-templated transcription initiation [GO:2000144]; positive regulation of intrinsic apoptotic signaling pathway [GO:2001244]; positive regulation of response to DNA damage stimulus [GO:2001022]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of DNA-templated transcription in response to stress [GO:0043620]	cytoplasm [GO:0005737]; mediator complex [GO:0016592]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	DNA binding [GO:0003677]; RNA binding [GO:0003723]; transcription coregulator activity [GO:0003712]	SKERGDSK	0.99549	8.98165	10.7754	0	0	0	0	0	0	0	0	0	0
P17480	UBF1_HUMAN	Nucleolar transcription factor 1 (Autoantigen NOR-90) (Upstream-binding factor 1) (UBF-1)	UBTF UBF UBF1	Homo sapiens (Human)	positive regulation of transcription by RNA polymerase I [GO:0045943]; transcription by RNA polymerase I [GO:0006360]; transcription initiation at RNA polymerase I promoter [GO:0006361]	fibrillar center [GO:0001650]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	chromatin binding [GO:0003682]; RNA binding [GO:0003723]; RNA polymerase I cis-regulatory region sequence-specific DNA binding [GO:0001165]; RNA polymerase I core promoter sequence-specific DNA binding [GO:0001164]; RNA polymerase I general transcription initiation factor activity [GO:0001181]; scaffold protein binding [GO:0097110]	MVLCSQQWK	0.94019	0	9.92217	9.7827	0	0	0	0	0	0	0	0	0
Q8WXH2	JPH3_HUMAN	Junctophilin-3 (JP-3) (Junctophilin type 3) (Trinucleotide repeat-containing gene 22 protein)	JPH3 JP3 TNRC22	Homo sapiens (Human)	calcium ion transport into cytosol [GO:0060402]; exploration behavior [GO:0035640]; learning [GO:0007612]; locomotion [GO:0040011]; memory [GO:0007613]; neuromuscular process controlling balance [GO:0050885]; regulation of neuronal synaptic plasticity [GO:0048168]; regulation of ryanodine-sensitive calcium-release channel activity [GO:0060314]; regulation of synaptic plasticity [GO:0048167]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; junctional membrane complex [GO:0030314]; junctional sarcoplasmic reticulum membrane [GO:0014701]; plasma membrane [GO:0005886]		ASNHSPGGSRLLELQEEK	0.86531	0	0	0	0	0	0	0	0	0	0	9.82818	9.82375
Q04725	TLE2_HUMAN	Transducin-like enhancer protein 2 (Enhancer of split groucho-like protein 2) (ESG2)	TLE2	Homo sapiens (Human)	animal organ morphogenesis [GO:0009887]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of DNA-templated transcription [GO:0045892]; signal transduction [GO:0007165]; Wnt signaling pathway [GO:0016055]	extracellular space [GO:0005615]; focal adhesion [GO:0005925]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	transcription corepressor activity [GO:0003714]	DLVDSPASLASSLGSPLPR	0.41718	9.82026	0	0	0	9.72615	0	0	0	0	0	0	0
Q5TBA9	FRY_HUMAN	Protein furry homolog	FRY C13orf14	Homo sapiens (Human)	cell morphogenesis [GO:0000902]; negative regulation of tubulin deacetylation [GO:1904428]; neuron projection development [GO:0031175]	cell cortex [GO:0005938]; microtubule organizing center [GO:0005815]; site of polarized growth [GO:0030427]; spindle pole [GO:0000922]	enzyme inhibitor activity [GO:0004857]	EGDVTASHGLR	0.16216	10.2215	9.30911	0	0	0	0	0	0	0	0	0	0
O75628	REM1_HUMAN	GTP-binding protein REM 1 (GTPase-regulating endothelial cell sprouting) (Rad and Gem-like GTP-binding protein 1)	REM1 GES REM	Homo sapiens (Human)	negative regulation of high voltage-gated calcium channel activity [GO:1901842]	plasma membrane [GO:0005886]	calcium channel regulator activity [GO:0005246]; calmodulin binding [GO:0005516]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]	TLNTEQEAK	0.93675	0	0	0	0	0	0	0	0	0	0	9.69881	9.81012
Q8TDJ6	DMXL2_HUMAN	DmX-like protein 2 (Rabconnectin-3)	DMXL2 KIAA0856	Homo sapiens (Human)	vacuolar acidification [GO:0007035]	anchoring junction [GO:0070161]; extracellular space [GO:0005615]; neuronal dense core vesicle [GO:0098992]; RAVE complex [GO:0043291]; synaptic vesicle [GO:0008021]; synaptic vesicle membrane [GO:0030672]	small GTPase binding [GO:0031267]	KAVVWGLFR	0.94435	0	0	0	9.24982	0	0	0	0	0	10.2175	0	0
A8MYZ5	IQCF6_HUMAN	IQ domain-containing protein F6	IQCF6	Homo sapiens (Human)			calmodulin binding [GO:0005516]	GHYEVRASR	1	0	0	9.86081	0	0	0	0	0	0	0	9.60134	0
Q68CR7	LRC66_HUMAN	Leucine-rich repeat-containing protein 66	LRRC66	Homo sapiens (Human)		integral component of membrane [GO:0016021]		LPPIHLHR	0.93804	0	0	0	0	0	0	9.88528	0	0	0	9.51761	0
Q9HCS5	E41LA_HUMAN	Band 4.1-like protein 4A (Erythrocyte membrane protein band 4.1-like 4A) (Protein NBL4)	EPB41L4A EPB41L4	Homo sapiens (Human)	actomyosin structure organization [GO:0031032]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	cytoskeletal protein binding [GO:0008092]	FYAEDPCK	0.93726	0	0	0	0	0	0	0	0	9.44671	0	9.92052	0
Q5TEZ5	CF163_HUMAN	Uncharacterized protein C6orf163	C6orf163	Homo sapiens (Human)				TEMYQNMDDEMK	0.94156	0	9.57969	9.73044	0	0	0	0	0	0	0	0	0
Q9H2G2	SLK_HUMAN	STE20-like serine/threonine-protein kinase (STE20-like kinase) (hSLK) (EC 2.7.11.1) (CTCL tumor antigen se20-9) (STE20-related serine/threonine-protein kinase) (STE20-related kinase) (Serine/threonine-protein kinase 2)	SLK KIAA0204 STK2	Homo sapiens (Human)	apoptotic process [GO:0006915]; cytoplasmic microtubule organization [GO:0031122]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of apoptotic process [GO:0042981]; regulation of cell migration [GO:0030334]; regulation of focal adhesion assembly [GO:0051893]	cell leading edge [GO:0031252]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; perinuclear region of cytoplasm [GO:0048471]	ATP binding [GO:0005524]; cadherin binding [GO:0045296]; identical protein binding [GO:0042802]; protein homodimerization activity [GO:0042803]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	FEQEMMSK	0.93977	0	0	0	0	0	0	0	9.34851	0	9.88402	0	0
P04798	CP1A1_HUMAN	Cytochrome P450 1A1 (CYPIA1) (EC 1.14.14.1) (Cytochrome P450 form 6) (Cytochrome P450-C) (Cytochrome P450-P1) (Hydroperoxy icosatetraenoate dehydratase) (EC 4.2.1.152)	CYP1A1	Homo sapiens (Human)	9-cis-retinoic acid biosynthetic process [GO:0042904]; aging [GO:0007568]; amine metabolic process [GO:0009308]; camera-type eye development [GO:0043010]; cell population proliferation [GO:0008283]; cellular response to copper ion [GO:0071280]; cellular response to organic cyclic compound [GO:0071407]; coumarin metabolic process [GO:0009804]; dibenzo-p-dioxin catabolic process [GO:0019341]; digestive tract development [GO:0048565]; DNA methylation [GO:0006306]; epoxygenase P450 pathway [GO:0019373]; estrogen metabolic process [GO:0008210]; ethylene metabolic process [GO:0009692]; fatty acid metabolic process [GO:0006631]; flavonoid metabolic process [GO:0009812]; hepatocyte differentiation [GO:0070365]; hydrogen peroxide biosynthetic process [GO:0050665]; insecticide metabolic process [GO:0017143]; lipid hydroxylation [GO:0002933]; long-chain fatty acid biosynthetic process [GO:0042759]; long-chain fatty acid metabolic process [GO:0001676]; maternal process involved in parturition [GO:0060137]; omega-hydroxylase P450 pathway [GO:0097267]; porphyrin-containing compound metabolic process [GO:0006778]; positive regulation of G1/S transition of mitotic cell cycle [GO:1900087]; response to antibiotic [GO:0046677]; response to arsenic-containing substance [GO:0046685]; response to food [GO:0032094]; response to herbicide [GO:0009635]; response to hyperoxia [GO:0055093]; response to hypoxia [GO:0001666]; response to immobilization stress [GO:0035902]; response to iron(III) ion [GO:0010041]; response to lipopolysaccharide [GO:0032496]; response to nematode [GO:0009624]; response to virus [GO:0009615]; response to vitamin A [GO:0033189]; response to wounding [GO:0009611]; retinol metabolic process [GO:0042572]; steroid biosynthetic process [GO:0006694]; steroid metabolic process [GO:0008202]; vitamin D metabolic process [GO:0042359]; xenobiotic metabolic process [GO:0006805]	endoplasmic reticulum membrane [GO:0005789]; intracellular membrane-bounded organelle [GO:0043231]; mitochondrial inner membrane [GO:0005743]	"arachidonic acid monooxygenase activity [GO:0008391]; aromatase activity [GO:0070330]; demethylase activity [GO:0032451]; enzyme binding [GO:0019899]; estrogen 16-alpha-hydroxylase activity [GO:0101020]; estrogen 2-hydroxylase activity [GO:0101021]; flavonoid 3'-monooxygenase activity [GO:0016711]; heme binding [GO:0020037]; Hsp70 protein binding [GO:0030544]; Hsp90 protein binding [GO:0051879]; hydroperoxy icosatetraenoate dehydratase activity [GO:0106256]; iron ion binding [GO:0005506]; long-chain fatty acid omega-1 hydroxylase activity [GO:0120319]; long-chain fatty acid omega-hydroxylase activity [GO:0102033]; monooxygenase activity [GO:0004497]; oxidoreductase activity [GO:0016491]; oxidoreductase activity, acting on diphenols and related substances as donors [GO:0016679]; oxygen binding [GO:0019825]; vitamin D 24-hydroxylase activity [GO:0070576]"	TFEKGHIR	0.99977	0	0	0	9.50577	0	0	9.6962	0	0	0	0	0
Q3KRB8	RHGBB_HUMAN	Inactive Rho GTPase-activating protein 11B (Rho-type GTPase-activating protein 11B)	ARHGAP11B FAM7B1	Homo sapiens (Human)	cerebral cortex development [GO:0021987]; glutamine catabolic process [GO:0006543]; negative regulation of mitochondrial membrane permeability [GO:0035795]; regulation of small GTPase mediated signal transduction [GO:0051056]; signal transduction [GO:0007165]	cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]	GTPase activator activity [GO:0005096]	AFYGIKVKGVR	0.95843	0	0	0	0	0	0	0	0	0	9.53572	9.59462	0
Q9NVU0	RPC5_HUMAN	DNA-directed RNA polymerase III subunit RPC5 (RNA polymerase III subunit C5) (DNA-directed RNA polymerase III 80 kDa polypeptide)	POLR3E KIAA1452	Homo sapiens (Human)	defense response to virus [GO:0051607]; DNA-templated transcription [GO:0006351]; innate immune response [GO:0045087]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; RNA polymerase III complex [GO:0005666]		LEKVYNLVK	0.99866	0	0	0	0	0	9.02874	0	0	0	0	10.0938	0
Q9HBH7	BEX1_HUMAN	Protein BEX1 (Brain-expressed X-linked protein 1)	BEX1	Homo sapiens (Human)	cell differentiation [GO:0030154]; nervous system development [GO:0007399]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of transcription by RNA polymerase II [GO:0045944]; signal transduction [GO:0007165]	cytoplasm [GO:0005737]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; signaling receptor binding [GO:0005102]	LGEPQARMR	0.99907	9.92218	0	0	0	0	0	0	9.08736	0	0	0	0
Q2TAA8	TXIP1_HUMAN	Translin-associated factor X-interacting protein 1 (Trax-interacting protein 1)	TSNAXIP1 TXI1	Homo sapiens (Human)	cell differentiation [GO:0030154]; spermatogenesis [GO:0007283]	cytoplasm [GO:0005737]; perinuclear region of cytoplasm [GO:0048471]		EIFEFFIEDFK	0.97117	0	0	0	0	0	0	9.53428	0	9.44966	0	0	0
Q16678	CP1B1_HUMAN	Cytochrome P450 1B1 (EC 1.14.14.1) (CYPIB1) (Hydroperoxy icosatetraenoate dehydratase) (EC 4.2.1.152)	CYP1B1	Homo sapiens (Human)	adrenal gland development [GO:0030325]; angiogenesis [GO:0001525]; arachidonic acid metabolic process [GO:0019369]; benzene-containing compound metabolic process [GO:0042537]; blood vessel endothelial cell migration [GO:0043534]; blood vessel morphogenesis [GO:0048514]; cell adhesion [GO:0007155]; cellular response to cAMP [GO:0071320]; cellular response to cortisol stimulus [GO:0071387]; cellular response to hydrogen peroxide [GO:0070301]; cellular response to luteinizing hormone stimulus [GO:0071373]; cellular response to organic cyclic compound [GO:0071407]; cellular response to progesterone stimulus [GO:0071393]; cellular response to tumor necrosis factor [GO:0071356]; collagen fibril organization [GO:0030199]; DNA modification [GO:0006304]; endothelial cell migration [GO:0043542]; endothelial cell-cell adhesion [GO:0071603]; epoxygenase P450 pathway [GO:0019373]; estrogen metabolic process [GO:0008210]; estrous cycle [GO:0044849]; ganglion development [GO:0061548]; intrinsic apoptotic signaling pathway in response to oxidative stress [GO:0008631]; male gonad development [GO:0008584]; membrane lipid catabolic process [GO:0046466]; negative regulation of cell adhesion mediated by integrin [GO:0033629]; negative regulation of cell migration [GO:0030336]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of NF-kappaB transcription factor activity [GO:0032088]; nitric oxide biosynthetic process [GO:0006809]; omega-hydroxylase P450 pathway [GO:0097267]; positive regulation of angiogenesis [GO:0045766]; positive regulation of apoptotic process [GO:0043065]; positive regulation of DNA biosynthetic process [GO:2000573]; positive regulation of reactive oxygen species metabolic process [GO:2000379]; positive regulation of receptor signaling pathway via JAK-STAT [GO:0046427]; positive regulation of smooth muscle cell migration [GO:0014911]; positive regulation of translation [GO:0045727]; positive regulation of vascular endothelial growth factor production [GO:0010575]; regulation of reactive oxygen species metabolic process [GO:2000377]; response to arsenic-containing substance [GO:0046685]; response to dexamethasone [GO:0071548]; response to estradiol [GO:0032355]; response to follicle-stimulating hormone [GO:0032354]; response to indole-3-methanol [GO:0071680]; response to nutrient [GO:0007584]; response to toxic substance [GO:0009636]; retinal blood vessel morphogenesis [GO:0061304]; retinal metabolic process [GO:0042574]; retinol metabolic process [GO:0042572]; steroid metabolic process [GO:0008202]; sterol metabolic process [GO:0016125]; toxin metabolic process [GO:0009404]; trabecular meshwork development [GO:0002930]; xenobiotic metabolic process [GO:0006805]	endoplasmic reticulum membrane [GO:0005789]; intracellular membrane-bounded organelle [GO:0043231]; mitochondrion [GO:0005739]; nucleus [GO:0005634]	"aromatase activity [GO:0070330]; estrogen 16-alpha-hydroxylase activity [GO:0101020]; heme binding [GO:0020037]; hydroperoxy icosatetraenoate dehydratase activity [GO:0106256]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen [GO:0016712]"	LARRYGDVFQIR	0.93794	0	9.2861	0	0	0	0	9.66253	0	0	0	0	0
Q53S58	TM177_HUMAN	Transmembrane protein 177	TMEM177	Homo sapiens (Human)		integral component of membrane [GO:0016021]; integral component of mitochondrial inner membrane [GO:0031305]		MAGPLWRTAAFVQRHR	0.93196	0	0	0	0	0	9.18398	0	9.71395	0	0	0	0
Q8TF74	WIPF2_HUMAN	WAS/WASL-interacting protein family member 2 (WASP-interacting protein-related protein) (WIP- and CR16-homologous protein) (WIP-related protein)	WIPF2 WICH WIRE PP10631	Homo sapiens (Human)	actin filament-based movement [GO:0030048]	actin filament [GO:0005884]; cytosol [GO:0005829]	actin binding [GO:0003779]	SAPILEKPK	0.94255	0	0	0	0	0	0	0	0	0	9.30184	9.51761	0
O15213	WDR46_HUMAN	WD repeat-containing protein 46 (WD repeat-containing protein BING4)	WDR46 BING4 C6orf11 FP221	Homo sapiens (Human)	"maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000462]"	nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; small-subunit processome [GO:0032040]	RNA binding [GO:0003723]	GRSSTASLVK	0.97582	0	0	0	9.14341	0	0	0	0	9.63996	0	0	0
Q92819	HYAS2_HUMAN	Hyaluronan synthase 2 (EC 2.4.1.212) (Hyaluronate synthase 2) (Hyaluronic acid synthase 2) (HA synthase 2)	HAS2	Homo sapiens (Human)	atrioventricular canal development [GO:0036302]; bone morphogenesis [GO:0060349]; cellular response to fluid shear stress [GO:0071498]; cellular response to interleukin-1 [GO:0071347]; cellular response to platelet-derived growth factor stimulus [GO:0036120]; cellular response to tumor necrosis factor [GO:0071356]; endocardial cushion to mesenchymal transition [GO:0090500]; estrous cycle [GO:0044849]; extracellular matrix assembly [GO:0085029]; extracellular polysaccharide biosynthetic process [GO:0045226]; hyaluronan biosynthetic process [GO:0030213]; kidney development [GO:0001822]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of hyaluronan biosynthetic process [GO:1900127]; positive regulation of keratinocyte migration [GO:0051549]; positive regulation of keratinocyte proliferation [GO:0010838]; positive regulation of monocyte aggregation [GO:1900625]; positive regulation of smooth muscle cell migration [GO:0014911]; positive regulation of substrate adhesion-dependent cell spreading [GO:1900026]; positive regulation of urine volume [GO:0035810]; regulation of extracellular matrix assembly [GO:1901201]; renal water absorption [GO:0070295]; vasculogenesis [GO:0001570]	cytoplasmic vesicle [GO:0031410]; endoplasmic reticulum membrane [GO:0005789]; extracellular vesicle [GO:1903561]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of plasma membrane [GO:0005887]; lysosome [GO:0005764]; plasma membrane [GO:0005886]; plasma membrane raft [GO:0044853]	hyaluronan synthase activity [GO:0050501]; identical protein binding [GO:0042802]	VLEEDPMVGGVGGDVQILNK	0.55204	0	0	0	9.24082	9.32656	0	0	0	0	0	0	0
O75534	CSDE1_HUMAN	Cold shock domain-containing protein E1 (N-ras upstream gene protein) (Protein UNR)	CSDE1 D1S155E KIAA0885 NRU UNR	Homo sapiens (Human)	"CRD-mediated mRNA stabilization [GO:0070934]; IRES-dependent viral translational initiation [GO:0075522]; male gonad development [GO:0008584]; negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay [GO:1900152]; nuclear-transcribed mRNA catabolic process, no-go decay [GO:0070966]; positive regulation of cytoplasmic translation [GO:2000767]; regulation of translational initiation [GO:0006446]; stress granule assembly [GO:0034063]"	CRD-mediated mRNA stability complex [GO:0070937]; cytoplasmic stress granule [GO:0010494]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; mCRD-mediated mRNA stability complex [GO:0106002]; P-body [GO:0000932]; plasma membrane [GO:0005886]	RNA binding [GO:0003723]; RNA stem-loop binding [GO:0035613]	FNISTDRRDK	0.99807	9.47407	0	0	0	0	0	0	9.05775	0	0	0	0
Q9BVS5	TR61B_HUMAN	"tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial (EC 2.1.1.220) (mRNA methyladenosine-N(1)-methyltransferase) (EC 2.1.1.-)"	TRMT61B	Homo sapiens (Human)	mitochondrial tRNA methylation [GO:0070901]; mRNA methylation [GO:0080009]; protein homooligomerization [GO:0051260]; tRNA methylation [GO:0030488]	mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]; tRNA (m1A) methyltransferase complex [GO:0031515]	mRNA (adenine-N1-)-methyltransferase activity [GO:0061953]; rRNA (adenine) methyltransferase activity [GO:0016433]; tRNA (adenine-N1-)-methyltransferase activity [GO:0016429]	KNYKHWR	0.94316	0	0	0	0	0	0	8.89676	0	0	9.62828	0	0
P33121	ACSL1_HUMAN	Long-chain-fatty-acid--CoA ligase 1 (EC 6.2.1.3) (Acyl-CoA synthetase 1) (ACS1) (Arachidonate--CoA ligase) (EC 6.2.1.15) (Long-chain acyl-CoA synthetase 1) (LACS 1) (Long-chain acyl-CoA synthetase 2) (LACS 2) (Long-chain fatty acid-CoA ligase 2) (Palmitoyl-CoA ligase 1) (Palmitoyl-CoA ligase 2) (Phytanate--CoA ligase) (EC 6.2.1.24)	ACSL1 FACL1 FACL2 LACS LACS1 LACS2	Homo sapiens (Human)	adiponectin-activated signaling pathway [GO:0033211]; fatty acid transport [GO:0015908]; lipid biosynthetic process [GO:0008610]; long-chain fatty acid import into cell [GO:0044539]; long-chain fatty acid metabolic process [GO:0001676]; long-chain fatty-acyl-CoA biosynthetic process [GO:0035338]; positive regulation of cold-induced thermogenesis [GO:0120162]; positive regulation of long-chain fatty acid import across plasma membrane [GO:0010747]; positive regulation of protein serine/threonine kinase activity [GO:0071902]; response to nutrient [GO:0007584]; response to oleic acid [GO:0034201]; response to organic cyclic compound [GO:0014070]; triglyceride biosynthetic process [GO:0019432]; very long-chain fatty acid metabolic process [GO:0000038]; xenobiotic catabolic process [GO:0042178]	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; peroxisomal membrane [GO:0005778]; plasma membrane [GO:0005886]	arachidonate-CoA ligase activity [GO:0047676]; ATP binding [GO:0005524]; long-chain fatty acid-CoA ligase activity [GO:0004467]; oleoyl-CoA ligase activity [GO:0090434]; phytanate-CoA ligase activity [GO:0050197]; pristanate-CoA ligase activity [GO:0070251]	LLNRMFDR	0.50265	9.4044	0	0	0	0	0	9.10415	0	0	0	0	0
Q9NQ32	CK016_HUMAN	Uncharacterized protein C11orf16	C11orf16	Homo sapiens (Human)				ELVSKATHMKPPR	0.86828	0	9.2861	0	0	0	0	0	9.21021	0	0	0	0
O94925	GLSK_HUMAN	"Glutaminase kidney isoform, mitochondrial (GLS) (EC 3.5.1.2) (K-glutaminase) (L-glutamine amidohydrolase) [Cleaved into: Glutaminase kidney isoform, mitochondrial 68 kDa chain; Glutaminase kidney isoform, mitochondrial 65 kDa chain]"	GLS GLS1 KIAA0838	Homo sapiens (Human)	chemical synaptic transmission [GO:0007268]; glutamate biosynthetic process [GO:0006537]; glutamate homeostasis [GO:0090461]; glutamine catabolic process [GO:0006543]; protein homotetramerization [GO:0051289]; regulation of respiratory gaseous exchange by nervous system process [GO:0002087]; suckling behavior [GO:0001967]	cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]; synapse [GO:0045202]	glutaminase activity [GO:0004359]	ESGDRNFAIGYYLKEK	0.67732	0	0	0	0	0	9.09408	0	9.37988	0	0	0	0
Q8NEM7	SP20H_HUMAN	Transcription factor SPT20 homolog (p38-interacting protein) (p38IP)	SUPT20H C13orf19 FAM48A FP757	Homo sapiens (Human)	autophagy [GO:0006914]; gastrulation [GO:0007369]; histone H3 acetylation [GO:0043966]; monoubiquitinated histone deubiquitination [GO:0035521]; monoubiquitinated histone H2A deubiquitination [GO:0035522]; positive regulation of DNA-templated transcription [GO:0045893]; regulation of DNA repair [GO:0006282]; regulation of RNA splicing [GO:0043484]; regulation of transcription by RNA polymerase II [GO:0006357]	SAGA complex [GO:0000124]; SAGA-type complex [GO:0070461]	transcription coregulator activity [GO:0003712]	GVKHRPPPIK	0.99978	0	9.35383	9.06569	0	0	0	0	0	0	0	0	0
Q9NUQ6	SPS2L_HUMAN	SPATS2-like protein (DNA polymerase-transactivated protein 6) (Stress granule and nucleolar protein) (SGNP)	SPATS2L DNAPTP6 SP1224	Homo sapiens (Human)		cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; protein-containing complex [GO:0032991]	RNA binding [GO:0003723]	SVKDLQRCTVSLTR	0.93606	0	0	0	0	0	0	0	9.19261	9.22427	0	0	0
P01042	KNG1_HUMAN	Kininogen-1 (Alpha-2-thiol proteinase inhibitor) (Fitzgerald factor) (High molecular weight kininogen) (HMWK) (Williams-Fitzgerald-Flaujeac factor) [Cleaved into: Kininogen-1 heavy chain; T-kinin (Ile-Ser-Bradykinin); Bradykinin (Kallidin I); Lysyl-bradykinin (Kallidin II); Kininogen-1 light chain; Low molecular weight growth-promoting factor]	KNG1 BDK KNG	Homo sapiens (Human)	antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; blood coagulation [GO:0007596]; inflammatory response [GO:0006954]; killing of cells of another organism [GO:0031640]; negative regulation of blood coagulation [GO:0030195]; negative regulation of cell adhesion [GO:0007162]; negative regulation of endopeptidase activity [GO:0010951]; negative regulation of proteolysis [GO:0045861]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; vasodilation [GO:0042311]	blood microparticle [GO:0072562]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]; platelet alpha granule lumen [GO:0031093]	cysteine-type endopeptidase inhibitor activity [GO:0004869]; endopeptidase inhibitor activity [GO:0004866]; heparin binding [GO:0008201]; signaling receptor binding [GO:0005102]; zinc ion binding [GO:0008270]	DIPTNSPELEETLTHTITK	0	8.89072	0	0	0	9.50581	0	0	0	0	0	0	0
Q5THJ4	VP13D_HUMAN	Intermembrane lipid transfer protein VPS13D (Vacuolar protein sorting-associated protein 13D)	VPS13D KIAA0453	Homo sapiens (Human)	lipid transport [GO:0006869]; mitochondrion organization [GO:0007005]; positive regulation of mitophagy [GO:1901526]; protein retention in Golgi apparatus [GO:0045053]; protein targeting to vacuole [GO:0006623]	extracellular exosome [GO:0070062]; extrinsic component of membrane [GO:0019898]		EKIFPQEEQR	0.96101	9.68573	0	0	0	0	0	8.69282	0	0	0	0	0
Q96JK2	DCAF5_HUMAN	DDB1- and CUL4-associated factor 5 (Breakpoint cluster region protein 2) (BCRP2) (WD repeat-containing protein 22)	DCAF5 BCRG2 KIAA1824 WDR22	Homo sapiens (Human)	protein ubiquitination [GO:0016567]	Cul4-RING E3 ubiquitin ligase complex [GO:0080008]; cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]		DNPAPSSSK	0.99926	0	0	8.03375	0	0	0	0	0	10.3433	0	0	0
Q9HBW0	LPAR2_HUMAN	Lysophosphatidic acid receptor 2 (LPA receptor 2) (LPA-2) (Lysophosphatidic acid receptor Edg-4)	LPAR2 EDG4 LPA2	Homo sapiens (Human)	activation of phospholipase C activity [GO:0007202]; adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; G protein-coupled receptor signaling pathway [GO:0007186]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; regulation of metabolic process [GO:0019222]	cell surface [GO:0009986]; cytoplasm [GO:0005737]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; lipid binding [GO:0008289]; lysophosphatidic acid receptor activity [GO:0070915]	SVMAVQLHSRLPR	0.51707	0	0	0	0	9.20178	0	0	0	0	0	0	9.16988
Q32P44	EMAL3_HUMAN	Echinoderm microtubule-associated protein-like 3 (EMAP-3)	EML3	Homo sapiens (Human)	cell division [GO:0051301]; microtubule cytoskeleton organization [GO:0000226]; mitotic metaphase plate congression [GO:0007080]; regulation of mitotic spindle assembly [GO:1901673]	cytoplasm [GO:0005737]; microtubule cytoskeleton [GO:0015630]; midbody [GO:0030496]; mitotic spindle microtubule [GO:1990498]; nucleus [GO:0005634]; spindle [GO:0005819]; spindle microtubule [GO:0005876]	microtubule binding [GO:0008017]; protein self-association [GO:0043621]	VVAVADDFCK	0.93684	0	9.17792	9.18948	0	0	0	0	0	0	0	0	0
Q6ZRS4	ITPI1_HUMAN	Protein ITPRID1 (Coiled-coil domain-containing protein 129) (ITPR-interacting domain-containing protein 1)	ITPRID1 CCDC129	Homo sapiens (Human)			signaling receptor binding [GO:0005102]	QAPPSCVSEGSVK	0.87177	8.81051	0	0	0	0	0	9.54653	0	0	0	0	0
P01011	AACT_HUMAN	Alpha-1-antichymotrypsin (ACT) (Cell growth-inhibiting gene 24/25 protein) (Serpin A3) [Cleaved into: Alpha-1-antichymotrypsin His-Pro-less]	SERPINA3 AACT GIG24 GIG25	Homo sapiens (Human)	acute-phase response [GO:0006953]; inflammatory response [GO:0006954]; maintenance of gastrointestinal epithelium [GO:0030277]; negative regulation of endopeptidase activity [GO:0010951]; regulation of lipid metabolic process [GO:0019216]	azurophil granule lumen [GO:0035578]; blood microparticle [GO:0072562]; collagen-containing extracellular matrix [GO:0062023]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nucleus [GO:0005634]; platelet alpha granule lumen [GO:0031093]; secretory granule lumen [GO:0034774]	DNA binding [GO:0003677]; serine-type endopeptidase inhibitor activity [GO:0004867]	ADLSGITGAR	0	9.43064	0	0	0	0	0	8.67705	0	0	0	0	0
Q16206	ENOX2_HUMAN	Ecto-NOX disulfide-thiol exchanger 2 (APK1 antigen) (Cytosolic ovarian carcinoma antigen 1) (Tumor-associated hydroquinone oxidase) (tNOX) [Includes: Hydroquinone [NADH] oxidase (EC 1.-.-.-); Protein disulfide-thiol oxidoreductase (EC 1.-.-.-)]	ENOX2 COVA1	Homo sapiens (Human)	electron transport chain [GO:0022900]; ultradian rhythm [GO:0007624]	cytosol [GO:0005829]; external side of plasma membrane [GO:0009897]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]	protein-disulfide reductase activity [GO:0015035]; RNA binding [GO:0003723]	LGSSTDKKDTGR	0.92151	8.39708	0	0	9.67624	0	0	0	0	0	0	0	0
Q765P7	MTSS2_HUMAN	Protein MTSS 2 (Actin-bundling with BAIAP2 homology protein 1) (ABBA-1) (MTSS1-like protein)	MTSS2 MTSS1L	Homo sapiens (Human)	activation of GTPase activity [GO:0090630]; cell projection assembly [GO:0030031]; cellular response to platelet-derived growth factor stimulus [GO:0036120]; lamellipodium organization [GO:0097581]; membrane organization [GO:0061024]; plasma membrane organization [GO:0007009]; ruffle assembly [GO:0097178]	actin cytoskeleton [GO:0015629]; cortical actin cytoskeleton [GO:0030864]; intrinsic component of the cytoplasmic side of the plasma membrane [GO:0031235]; lamellipodium [GO:0030027]; ruffle membrane [GO:0032587]	"actin binding [GO:0003779]; actin monomer binding [GO:0003785]; GTPase activator activity [GO:0005096]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]; phospholipid binding [GO:0005543]; small GTPase binding [GO:0031267]"	GLSLEHQK	0.96026	0	9.05164	9.01734	0	0	0	0	0	0	0	0	0
Q9Y547	IFT25_HUMAN	Intraflagellar transport protein 25 homolog (Heat shock protein beta-11) (Hspb11) (Placental protein 25) (PP25)	HSPB11 C1orf41 IFT25 HSPC034	Homo sapiens (Human)	cell differentiation [GO:0030154]; cilium assembly [GO:0060271]; heart development [GO:0007507]; intraciliary anterograde transport [GO:0035720]; kidney development [GO:0001822]; left/right axis specification [GO:0070986]; lung development [GO:0030324]; protein transport [GO:0015031]; skeletal system development [GO:0001501]; smoothened signaling pathway [GO:0007224]; spermatogenesis [GO:0007283]	centrosome [GO:0005813]; ciliary tip [GO:0097542]; cilium [GO:0005929]; intraciliary transport particle B [GO:0030992]	metal ion binding [GO:0046872]	IEKSTSKEPVDFEQWIEK	0.86244	0	0	0	0	9.21335	0	0	0	8.8549	0	0	0
Q9Y2D9	ZN652_HUMAN	Zinc finger protein 652	ZNF652 KIAA0924	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	CEEKETLTCEK	0.85714	0	0	9.0343	0	0	0	9.02934	0	0	0	0	0
Q09666	AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK (Desmoyokin)	AHNAK PM227	Homo sapiens (Human)	positive regulation of plasma membrane repair [GO:1905686]; regulation of RNA splicing [GO:0043484]; regulation of voltage-gated calcium channel activity [GO:1901385]	actin cytoskeleton [GO:0015629]; cell-cell contact zone [GO:0044291]; costamere [GO:0043034]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; plasma membrane protein complex [GO:0098797]; sarcolemma [GO:0042383]; T-tubule [GO:0030315]; vesicle [GO:0031982]	cadherin binding [GO:0045296]; identical protein binding [GO:0042802]; RNA binding [GO:0003723]; S100 protein binding [GO:0044548]; structural molecule activity conferring elasticity [GO:0097493]	AKGEVDVDVPK	0.86771	0	0	8.50331	0	0	0	9.49173	0	0	0	0	0
O94985	CSTN1_HUMAN	Calsyntenin-1 (Alcadein-alpha) (Alc-alpha) (Alzheimer-related cadherin-like protein) (Non-classical cadherin XB31alpha) [Cleaved into: Soluble Alc-alpha (SAlc-alpha); CTF1-alpha (C-terminal fragment 1-alpha)]	CLSTN1 CS1 KIAA0911	Homo sapiens (Human)	cell adhesion [GO:0007155]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; neurotransmitter receptor transport to postsynaptic membrane [GO:0098969]; positive regulation of synapse assembly [GO:0051965]; positive regulation of synaptic transmission [GO:0050806]; regulation of cell growth [GO:0001558]; regulation of synapse maturation [GO:0090128]; vesicle-mediated transport in synapse [GO:0099003]	anchoring junction [GO:0070161]; cell surface [GO:0009986]; endoplasmic reticulum membrane [GO:0005789]; extracellular region [GO:0005576]; glutamatergic synapse [GO:0098978]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; neuron projection [GO:0043005]; nucleus [GO:0005634]; postsynaptic density [GO:0014069]; postsynaptic endosome [GO:0098845]; postsynaptic membrane [GO:0045211]	amyloid-beta binding [GO:0001540]; calcium ion binding [GO:0005509]; kinesin binding [GO:0019894]; X11-like protein binding [GO:0042988]	EPFTISVWMR	0.94216	0	8.95108	0	0	0	0	0	0	0	9.00459	0	0
Q8TAQ2	SMRC2_HUMAN	SWI/SNF complex subunit SMARCC2 (BRG1-associated factor 170) (BAF170) (SWI/SNF complex 170 kDa subunit) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 2)	SMARCC2 BAF170	Homo sapiens (Human)	chromatin remodeling [GO:0006338]; negative regulation of DNA-templated transcription [GO:0045892]; nervous system development [GO:0007399]; nucleosome disassembly [GO:0006337]; positive regulation of cell differentiation [GO:0045597]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of double-strand break repair [GO:2000781]; positive regulation of myoblast differentiation [GO:0045663]; positive regulation of T cell differentiation [GO:0045582]; regulation of G0 to G1 transition [GO:0070316]; regulation of G1/S transition of mitotic cell cycle [GO:2000045]; regulation of mitotic metaphase/anaphase transition [GO:0030071]; regulation of nucleotide-excision repair [GO:2000819]; regulation of transcription by RNA polymerase II [GO:0006357]	bBAF complex [GO:0140092]; brahma complex [GO:0035060]; chromatin [GO:0000785]; kinetochore [GO:0000776]; nBAF complex [GO:0071565]; npBAF complex [GO:0071564]; nuclear matrix [GO:0016363]; nucleoplasm [GO:0005654]; protein-containing complex [GO:0032991]; RSC-type complex [GO:0016586]; SWI/SNF complex [GO:0016514]	histone binding [GO:0042393]; transcription coactivator activity [GO:0003713]	EALEYQR	0.99902	0	0	0	0	0	0	8.17002	0	0	9.77175	0	0
Q6ZVL6	K154L_HUMAN	UPF0606 protein KIAA1549L	KIAA1549L C11orf41 C11orf69	Homo sapiens (Human)		integral component of membrane [GO:0016021]		ILSTIDSQR	0.87449	9.11228	0	8.77656	0	0	0	0	0	0	0	0	0
Q86X52	CHSS1_HUMAN	Chondroitin sulfate synthase 1 (EC 2.4.1.175) (EC 2.4.1.226) (Chondroitin glucuronyltransferase 1) (Chondroitin synthase 1) (ChSy-1) (Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase 1) (N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 1) (N-acetylgalactosaminyltransferase 1)	CHSY1 CHSY CSS1 KIAA0990 UNQ756/PRO1487	Homo sapiens (Human)	bone morphogenesis [GO:0060349]; chondrocyte development [GO:0002063]; chondroitin sulfate biosynthetic process [GO:0030206]; negative regulation of ossification [GO:0030279]; positive regulation of smoothened signaling pathway [GO:0045880]; proximal/distal pattern formation [GO:0009954]; response to nutrient levels [GO:0031667]; sulfation [GO:0051923]	extracellular region [GO:0005576]; Golgi cisterna membrane [GO:0032580]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; membrane [GO:0016020]	acetylgalactosaminyltransferase activity [GO:0008376]; glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity [GO:0047238]; metal ion binding [GO:0046872]; N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase activity [GO:0050510]	FDMFVRFMGNFEK	0.99956	0	0	0	9.21089	0	8.64872	0	0	0	0	0	0
Q8N5S3	CB073_HUMAN	Uncharacterized protein C2orf73	C2orf73	Homo sapiens (Human)				ACPSTPESR	0.91812	9.07666	0	8.76032	0	0	0	0	0	0	0	0	0
Q9Y6N3	CLCA3_HUMAN	Calcium-activated chloride channel regulator family member 3 (Calcium-activated chloride channel family member 3) (hCLCA3)	CLCA3P CLCA3	Homo sapiens (Human)	ion transmembrane transport [GO:0034220]; regulation of ion transmembrane transport [GO:0034765]	chloride channel complex [GO:0034707]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]	calcium channel activity [GO:0005262]; chloride channel activity [GO:0005254]; metalloendopeptidase activity [GO:0004222]; voltage-gated ion channel activity [GO:0005244]	NVSILIPMTYKSK	0.86815	0	0	0	0	0	0	0	0	0	8.63981	0	9.16988
P49767	VEGFC_HUMAN	Vascular endothelial growth factor C (VEGF-C) (Flt4 ligand) (Flt4-L) (Vascular endothelial growth factor-related protein) (VRP)	VEGFC	Homo sapiens (Human)	animal organ morphogenesis [GO:0009887]; cellular response to leukemia inhibitory factor [GO:1990830]; glial cell proliferation [GO:0014009]; induction of positive chemotaxis [GO:0050930]; morphogenesis of embryonic epithelium [GO:0016331]; negative regulation of blood pressure [GO:0045776]; negative regulation of osteoblast differentiation [GO:0045668]; positive regulation of angiogenesis [GO:0045766]; positive regulation of blood vessel endothelial cell migration [GO:0043536]; positive regulation of cell division [GO:0051781]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of endothelial cell proliferation [GO:0001938]; positive regulation of glial cell proliferation [GO:0060252]; positive regulation of lymphangiogenesis [GO:1901492]; positive regulation of mast cell chemotaxis [GO:0060754]; positive regulation of mesenchymal stem cell proliferation [GO:1902462]; positive regulation of neuroblast proliferation [GO:0002052]; positive regulation of protein autophosphorylation [GO:0031954]; positive regulation of protein kinase activity [GO:0045860]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein secretion [GO:0050714]; regulation of vascular endothelial growth factor receptor signaling pathway [GO:0030947]; response to hypoxia [GO:0001666]; response to xenobiotic stimulus [GO:0009410]; signal transduction [GO:0007165]; sprouting angiogenesis [GO:0002040]; substrate-dependent cell migration [GO:0006929]; vascular endothelial growth factor receptor signaling pathway [GO:0048010]; vascular endothelial growth factor signaling pathway [GO:0038084]	extracellular region [GO:0005576]; extracellular space [GO:0005615]; membrane [GO:0016020]; platelet alpha granule lumen [GO:0031093]	chemoattractant activity [GO:0042056]; growth factor activity [GO:0008083]; vascular endothelial growth factor receptor 3 binding [GO:0043185]; vascular endothelial growth factor receptor binding [GO:0005172]	SIDNEWRK	0.99594	0	0	0	8.43729	0	0	0	0	0	0	0	9.31872
Q9BXR6	FHR5_HUMAN	Complement factor H-related protein 5 (FHR-5)	CFHR5 CFHL5 FHR5	Homo sapiens (Human)	"complement activation [GO:0006956]; complement activation, alternative pathway [GO:0006957]; cytolysis by host of symbiont cells [GO:0051838]; negative regulation of protein binding [GO:0032091]"	extracellular region [GO:0005576]; extracellular space [GO:0005615]; protein-containing complex [GO:0032991]	complement component C3b binding [GO:0001851]; identical protein binding [GO:0042802]; protein heterodimerization activity [GO:0046982]	VGDVLKFSCRK	0.93581	0	0	0	9.3152	0	0	0	0	0	0	8.43846	0
Q6ZRI0	OTOG_HUMAN	Otogelin	OTOG OTGN	Homo sapiens (Human)	adult locomotory behavior [GO:0008344]; L-arabinose metabolic process [GO:0046373]; sensory perception of sound [GO:0007605]	apical plasma membrane [GO:0016324]; extracellular matrix [GO:0031012]; extracellular space [GO:0005615]	alpha-L-arabinofuranosidase activity [GO:0046556]; structural molecule activity [GO:0005198]	EDCNTCTCTSGK	0.81687	8.91534	8.80858	0	0	0	0	0	0	0	0	0	0
O75051	PLXA2_HUMAN	Plexin-A2 (Semaphorin receptor OCT)	PLXNA2 KIAA0463 OCT PLXN2 UNQ209/PRO235	Homo sapiens (Human)	centrosome localization [GO:0051642]; cerebellar granule cell precursor tangential migration [GO:0021935]; limb bud formation [GO:0060174]; negative regulation of cell adhesion [GO:0007162]; neural tube development [GO:0021915]; pharyngeal system development [GO:0060037]; positive regulation of axonogenesis [GO:0050772]; regulation of cell migration [GO:0030334]; regulation of cell shape [GO:0008360]; regulation of GTPase activity [GO:0043087]; semaphorin-plexin signaling pathway [GO:0071526]; semaphorin-plexin signaling pathway involved in axon guidance [GO:1902287]; somitogenesis [GO:0001756]	integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; semaphorin receptor complex [GO:0002116]	identical protein binding [GO:0042802]; semaphorin receptor activity [GO:0017154]	TGTMYGVIVRSEGEDGK	0.82727	0	0	0	0	0	0	0	0	0	8.6738	8.99421	0
Q9UPT8	ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4	ZC3H4 C19orf7 KIAA1064	Homo sapiens (Human)	"DNA-templated transcription termination [GO:0006353]; lncRNA catabolic process [GO:0110064]; negative regulation of DNA-templated transcription, elongation [GO:0032785]; negative regulation of lncRNA transcription [GO:0140744]; nuclear RNA surveillance [GO:0071027]"	chromosome [GO:0005694]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	metal ion binding [GO:0046872]; promoter-specific chromatin binding [GO:1990841]; RNA binding [GO:0003723]	GAEGNGK	0.98136	0	0	0	0	8.76977	0	0	0	8.83842	0	0	0
P09972	ALDOC_HUMAN	Fructose-bisphosphate aldolase C (EC 4.1.2.13) (Brain-type aldolase)	ALDOC ALDC	Homo sapiens (Human)	"epithelial cell differentiation [GO:0030855]; fructose 1,6-bisphosphate metabolic process [GO:0030388]; fructose metabolic process [GO:0006000]; gluconeogenesis [GO:0006094]; glycolytic process [GO:0006096]"	cytoskeleton [GO:0005856]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; ficolin-1-rich granule lumen [GO:1904813]; secretory granule lumen [GO:0034774]; tertiary granule lumen [GO:1904724]	cytoskeletal protein binding [GO:0008092]; fructose-bisphosphate aldolase activity [GO:0004332]	AEVNGLAAQGK	0.99642	0	0	0	0	0	9.13799	8.44224	0	0	0	0	0
Q99797	MIPEP_HUMAN	Mitochondrial intermediate peptidase (MIP) (EC 3.4.24.59)	MIPEP MIP	Homo sapiens (Human)	peptide metabolic process [GO:0006518]; protein processing involved in protein targeting to mitochondrion [GO:0006627]; proteolysis [GO:0006508]	mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	TLKDFEMIR	0.87438	0	0	0	0	0	0	8.89664	0	0	0	0	8.68148
Q70EL2	UBP45_HUMAN	Ubiquitin carboxyl-terminal hydrolase 45 (EC 3.4.19.12) (Deubiquitinating enzyme 45) (Ubiquitin thioesterase 45) (Ubiquitin-specific-processing protease 45)	USP45	Homo sapiens (Human)	cell migration [GO:0016477]; DNA repair [GO:0006281]; global genome nucleotide-excision repair [GO:0070911]; neural retina development [GO:0003407]; photoreceptor cell maintenance [GO:0045494]; protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; photoreceptor inner segment [GO:0001917]	cysteine-type deubiquitinase activity [GO:0004843]; zinc ion binding [GO:0008270]	CETDEIQK	0.91603	0	8.38776	9.14799	0	0	0	0	0	0	0	0	0
Q6ZRK6	CCD73_HUMAN	Coiled-coil domain-containing protein 73 (Sarcoma antigen NY-SAR-79)	CCDC73	Homo sapiens (Human)				EDYHKQLSEIEK	0.38028	0	0	0	8.58101	0	0	8.94416	0	0	0	0	0
P0DOX2	IGA2_HUMAN	Immunoglobulin alpha-2 heavy chain (Immunoglobulin alpha-2 heavy chain BUT)		Homo sapiens (Human)	adaptive immune response [GO:0002250]	extracellular region [GO:0005576]; immunoglobulin complex [GO:0019814]; plasma membrane [GO:0005886]		AEDTAVYYCAR	0	9.04067	0	0	0	0	0	8.4814	0	0	0	0	0
Q9Y5X3	SNX5_HUMAN	Sorting nexin-5	SNX5	Homo sapiens (Human)	"intracellular protein transport [GO:0006886]; pinocytosis [GO:0006907]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of insulin receptor signaling pathway [GO:0046628]; regulation of macroautophagy [GO:0016241]; retrograde transport, endosome to Golgi [GO:0042147]"	"cytosol [GO:0005829]; early endosome membrane [GO:0031901]; endosome [GO:0005768]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]; extrinsic component of endosome membrane [GO:0031313]; intracellular membrane-bounded organelle [GO:0043231]; macropinocytic cup [GO:0070685]; perinuclear region of cytoplasm [GO:0048471]; phagocytic cup [GO:0001891]; retromer complex [GO:0030904]; retromer, tubulation complex [GO:0030905]; ruffle [GO:0001726]; tubular endosome [GO:0097422]"	cadherin binding [GO:0045296]; dynactin binding [GO:0034452]; phosphatidylinositol binding [GO:0035091]	ADKMTRSHK	0.8227	8.89966	0	0	0	0	0	8.6115	0	0	0	0	0
Q6ZRS2	SRCAP_HUMAN	Helicase SRCAP (EC 3.6.4.-) (Domino homolog 2) (Snf2-related CBP activator)	SRCAP KIAA0309	Homo sapiens (Human)	histone exchange [GO:0043486]; regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase II [GO:0006357]	Golgi apparatus [GO:0005794]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleosome [GO:0000786]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; protein-containing complex [GO:0032991]; Swr1 complex [GO:0000812]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent chromatin remodeler activity [GO:0140658]; DNA binding [GO:0003677]; helicase activity [GO:0004386]; histone acetyltransferase activity [GO:0004402]; histone binding [GO:0042393]; transcription coactivator activity [GO:0003713]	RQGWTKPNAFHVCITSYK	0.13402	0	8.7656	8.74271	0	0	0	0	0	0	0	0	0
Q5JPF3	AN36C_HUMAN	Ankyrin repeat domain-containing protein 36C (Protein immuno-reactive with anti-PTH polyclonal antibodies)	ANKRD36C	Homo sapiens (Human)			ion channel inhibitor activity [GO:0008200]	EADPSSKAAMRR	0.96474	8.36776	9.10536	0	0	0	0	0	0	0	0	0	0
O14975	S27A2_HUMAN	"Long-chain fatty acid transport protein 2 (Arachidonate--CoA ligase) (EC 6.2.1.15) (Fatty acid transport protein 2) (FATP-2) (Fatty-acid-coenzyme A ligase, very long-chain 1) (Long-chain-fatty-acid--CoA ligase) (EC 6.2.1.3) (Phytanate--CoA ligase) (EC 6.2.1.24) (Solute carrier family 27 member 2) (THCA-CoA ligase) (EC 6.2.1.7) (Very long-chain acyl-CoA synthetase) (VLACS) (VLCS) (EC 6.2.1.-) (Very long-chain-fatty-acid-CoA ligase)"	SLC27A2 ACSVL1 FACVL1 FATP2 VLACS	Homo sapiens (Human)	bile acid biosynthetic process [GO:0006699]; fatty acid alpha-oxidation [GO:0001561]; fatty acid beta-oxidation [GO:0006635]; long-chain fatty acid import into cell [GO:0044539]; long-chain fatty acid metabolic process [GO:0001676]; methyl-branched fatty acid metabolic process [GO:0097089]; very long-chain fatty acid catabolic process [GO:0042760]	cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; endoplasmic reticulum membrane [GO:0005789]; extracellular exosome [GO:0070062]; integral component of endoplasmic reticulum membrane [GO:0030176]; integral component of peroxisomal membrane [GO:0005779]; peroxisomal membrane [GO:0005778]; plasma membrane [GO:0005886]; specific granule membrane [GO:0035579]	arachidonate-CoA ligase activity [GO:0047676]; ATP binding [GO:0005524]; cholate-CoA ligase activity [GO:0047747]; enzyme binding [GO:0019899]; fatty acid transmembrane transporter activity [GO:0015245]; long-chain fatty acid transporter activity [GO:0005324]; long-chain fatty acid-CoA ligase activity [GO:0004467]; phytanate-CoA ligase activity [GO:0050197]; pristanate-CoA ligase activity [GO:0070251]; very long-chain fatty acid-CoA ligase activity [GO:0031957]	IQDTIEITGTFK	0.16038	0	0	0	0	0	0	0	8.80983	0	0	8.65467	0
A9YTQ3	AHRR_HUMAN	Aryl hydrocarbon receptor repressor (AhR repressor) (AhRR) (Class E basic helix-loop-helix protein 77) (bHLHe77)	AHRR BHLHE77 KIAA1234	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]; xenobiotic metabolic process [GO:0006805]	aryl hydrocarbon receptor complex [GO:0034751]; chromatin [GO:0000785]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; nuclear receptor activity [GO:0004879]; protein dimerization activity [GO:0046983]; transcription cis-regulatory region binding [GO:0000976]"	CFICRVR	0.99929	0	8.8269	0	0	0	0	0	0	0	0	8.61787	0
A6H8M9	CDHR4_HUMAN	Cadherin-related family member 4 (Cadherin-like protein 29)	CDHR4 CDH29 UNQ9392/PRO34300	Homo sapiens (Human)	cell adhesion [GO:0007155]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	integral component of plasma membrane [GO:0005887]	calcium ion binding [GO:0005509]	DYLFNTHTGAR	0.86038	8.72195	0	8.71401	0	0	0	0	0	0	0	0	0
P58215	LOXL3_HUMAN	Lysyl oxidase homolog 3 (EC 1.4.3.-) (EC 1.4.3.13) (Lysyl oxidase-like protein 3)	LOXL3 LOXL	Homo sapiens (Human)	collagen fibril organization [GO:0030199]; epithelial to mesenchymal transition [GO:0001837]; fibronectin fibril organization [GO:1905590]; inflammatory response [GO:0006954]; lung development [GO:0030324]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of T-helper 17 cell lineage commitment [GO:2000329]; peptidyl-lysine oxidation [GO:0018057]; positive regulation of integrin-mediated signaling pathway [GO:2001046]; roof of mouth development [GO:0060021]; somite development [GO:0061053]; spinal cord development [GO:0021510]	collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; membrane [GO:0016020]; nucleus [GO:0005634]	copper ion binding [GO:0005507]; fibronectin binding [GO:0001968]; protein-lysine 6-oxidase activity [GO:0004720]; scavenger receptor activity [GO:0005044]	ASTWGTVCDR	0.98019	0	0	0	0	0	8.92368	0	8.50704	0	0	0	0
P35555	FBN1_HUMAN	Fibrillin-1 [Cleaved into: Asprosin]	FBN1 FBN	Homo sapiens (Human)	activation of protein kinase A activity [GO:0034199]; anatomical structure morphogenesis [GO:0009653]; camera-type eye development [GO:0043010]; cell adhesion mediated by integrin [GO:0033627]; cellular response to insulin-like growth factor stimulus [GO:1990314]; cellular response to transforming growth factor beta stimulus [GO:0071560]; embryonic eye morphogenesis [GO:0048048]; glucose homeostasis [GO:0042593]; glucose metabolic process [GO:0006006]; heart development [GO:0007507]; metanephros development [GO:0001656]; negative regulation of osteoclast development [GO:2001205]; negative regulation of osteoclast differentiation [GO:0045671]; positive regulation of appetite [GO:0032100]; post-embryonic eye morphogenesis [GO:0048050]; protein kinase A signaling [GO:0010737]; sequestering of BMP in extracellular matrix [GO:0035582]; sequestering of TGFbeta in extracellular matrix [GO:0035583]; skeletal system development [GO:0001501]	basement membrane [GO:0005604]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum lumen [GO:0005788]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; microfibril [GO:0001527]	calcium ion binding [GO:0005509]; extracellular matrix constituent conferring elasticity [GO:0030023]; extracellular matrix structural constituent [GO:0005201]; heparin binding [GO:0008201]; hormone activity [GO:0005179]; identical protein binding [GO:0042802]; integrin binding [GO:0005178]; protein-containing complex binding [GO:0044877]	CQCPSGMTLDATGR	0.9433	0	0	0	0	0	0	8.73315	0	8.67356	0	0	0
Q9H1U4	MEGF9_HUMAN	Multiple epidermal growth factor-like domains protein 9 (Multiple EGF-like domains protein 9) (Epidermal growth factor-like protein 5) (EGF-like protein 5)	MEGF9 EGFL5 KIAA0818 UNQ671/PRO1305	Homo sapiens (Human)	animal organ morphogenesis [GO:0009887]; cell migration [GO:0016477]; substrate adhesion-dependent cell spreading [GO:0034446]; tissue development [GO:0009888]	basement membrane [GO:0005604]; integral component of membrane [GO:0016021]		SSELEPECDQCK	0.75749	0	0	0	0	0	0	8.91907	0	0	0	0	8.47982
Q14093	CYLC2_HUMAN	Cylicin-2 (Cylicin II) (Multiple-band polypeptide II)	CYLC2 CYL2	Homo sapiens (Human)	cell differentiation [GO:0030154]; spermatogenesis [GO:0007283]	cytoskeletal calyx [GO:0033150]; nucleus [GO:0005634]	structural constituent of cytoskeleton [GO:0005200]	TTQKDTTDSESELKQGK	0.92418	0	8.81638	0	0	0	0	0	0	0	0	0	8.56094
Q14571	ITPR2_HUMAN	"Inositol 1,4,5-trisphosphate receptor type 2 (IP3 receptor isoform 2) (IP3R 2) (InsP3R2) (Type 2 inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor)"	ITPR2	Homo sapiens (Human)	cellular response to cAMP [GO:0071320]; cellular response to ethanol [GO:0071361]; release of sequestered calcium ion into cytosol [GO:0051209]; response to hypoxia [GO:0001666]; signal transduction [GO:0007165]	cell cortex [GO:0005938]; cytoplasmic vesicle membrane [GO:0030659]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; platelet dense tubular network membrane [GO:0031095]; receptor complex [GO:0043235]; sarcoplasmic reticulum [GO:0016529]; sarcoplasmic reticulum membrane [GO:0033017]; secretory granule membrane [GO:0030667]	"calcium ion binding [GO:0005509]; calcium ion transmembrane transporter activity [GO:0015085]; inositol 1,4,5 trisphosphate binding [GO:0070679]; inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity [GO:0005220]; phosphatidylinositol binding [GO:0035091]; scaffold protein binding [GO:0097110]; transmembrane transporter binding [GO:0044325]"	AEVLQAFK	0.99854	0	0	0	0	0	0	8.93814	0	0	0	0	8.40331
Q9Y2H0	DLGP4_HUMAN	Disks large-associated protein 4 (DAP-4) (PSD-95/SAP90-binding protein 4) (SAP90/PSD-95-associated protein 4) (SAPAP-4)	DLGAP4 DAP4 KIAA0964 SAPAP4	Homo sapiens (Human)	regulation of postsynaptic neurotransmitter receptor activity [GO:0098962]; signaling [GO:0023052]	cholinergic synapse [GO:0098981]; glutamatergic synapse [GO:0098978]; neuromuscular junction [GO:0031594]; plasma membrane [GO:0005886]; postsynaptic specialization [GO:0099572]	molecular adaptor activity [GO:0060090]	VGGNGSK	0.89088	0	0	0	8.87107	8.43621	0	0	0	0	0	0	0
Q96NW4	ANR27_HUMAN	Ankyrin repeat domain-containing protein 27 (VPS9 domain-containing protein)	ANKRD27 PP12899	Homo sapiens (Human)	early endosome to late endosome transport [GO:0045022]; endocytic recycling [GO:0032456]; endosome to melanosome transport [GO:0035646]; negative regulation of SNARE complex assembly [GO:0035544]; neuron projection morphogenesis [GO:0048812]; positive regulation of dendrite morphogenesis [GO:0050775]; positive regulation of neuron projection development [GO:0010976]; protein transport [GO:0015031]	cytoplasmic vesicle membrane [GO:0030659]; cytosol [GO:0005829]; early endosome [GO:0005769]; intracellular membrane-bounded organelle [GO:0043231]; late endosome [GO:0005770]; lysosome [GO:0005764]; melanosome [GO:0042470]; membrane [GO:0016020]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]; transport vesicle [GO:0030133]; tubular endosome [GO:0097422]	GTPase activator activity [GO:0005096]; guanyl-nucleotide exchange factor activity [GO:0005085]; small GTPase binding [GO:0031267]; SNARE binding [GO:0000149]	LKETPLK	0.9967	0	0	0	0	8.60655	8.66196	0	0	0	0	0	0
Q6ZUJ8	BCAP_HUMAN	Phosphoinositide 3-kinase adapter protein 1 (B-cell adapter for phosphoinositide 3-kinase) (B-cell phosphoinositide 3-kinase adapter protein 1)	PIK3AP1 BCAP	Homo sapiens (Human)	positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; regulation of inflammatory response [GO:0050727]; toll-like receptor 2 signaling pathway [GO:0034134]; toll-like receptor 4 signaling pathway [GO:0034142]; toll-like receptor 7 signaling pathway [GO:0034154]; toll-like receptor 9 signaling pathway [GO:0034162]	cytosol [GO:0005829]; membrane [GO:0016020]; plasma membrane [GO:0005886]	identical protein binding [GO:0042802]; phosphatidylinositol 3-kinase regulatory subunit binding [GO:0036312]; signaling receptor binding [GO:0005102]	SQKILTHR	0.99909	0	0	0	0	0	0	0	0	0	8.29797	0	8.90087
Q16533	SNPC1_HUMAN	snRNA-activating protein complex subunit 1 (SNAPc subunit 1) (Proximal sequence element-binding transcription factor subunit gamma) (PSE-binding factor subunit gamma) (PTF subunit gamma) (Small nuclear RNA-activating complex polypeptide 1) (snRNA-activating protein complex 43 kDa subunit) (SNAPc 43 kDa subunit)	SNAPC1 SNAP43	Homo sapiens (Human)	snRNA transcription by RNA polymerase II [GO:0042795]; snRNA transcription by RNA polymerase III [GO:0042796]	nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; snRNA-activating protein complex [GO:0019185]	RNA polymerase II general transcription initiation factor activity [GO:0016251]; RNA polymerase III general transcription initiation factor activity [GO:0000995]; sequence-specific DNA binding [GO:0043565]	NLEKNMFTK	0.99752	8.8097	0	0	0	0	0	0	0	0	0	0	8.36431
P13798	ACPH_HUMAN	Acylamino-acid-releasing enzyme (AARE) (EC 3.4.19.1) (Acyl-peptide hydrolase) (APH) (Acylaminoacyl-peptidase) (Oxidized protein hydrolase) (OPH)	APEH D3F15S2 D3S48E DNF15S2	Homo sapiens (Human)	amyloid-beta metabolic process [GO:0050435]; proteolysis [GO:0006508]; translational termination [GO:0006415]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; ficolin-1-rich granule lumen [GO:1904813]; nuclear membrane [GO:0031965]	identical protein binding [GO:0042802]; omega peptidase activity [GO:0008242]; RNA binding [GO:0003723]; serine-type endopeptidase activity [GO:0004252]	AGGTGPGEEK	0.88793	8.97341	0	0	0	0	0	0	0	0	0	0	8.18507
Q8IWX8	CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein (ERPROT 213-21) (SR-related CTD-associated factor 6)	CHERP DAN26 SCAF6	Homo sapiens (Human)	cellular calcium ion homeostasis [GO:0006874]; negative regulation of cell population proliferation [GO:0008285]; nervous system development [GO:0007399]; positive regulation of calcineurin-NFAT signaling cascade [GO:0070886]; release of sequestered calcium ion into cytosol [GO:0051209]; RNA processing [GO:0006396]	cytoplasm [GO:0005737]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; perinuclear region of cytoplasm [GO:0048471]; sarcoplasmic reticulum membrane [GO:0033017]	RNA binding [GO:0003723]; transmembrane transporter binding [GO:0044325]	FMQDDFPPR	0.94071	0	8.77182	0	0	0	0	0	0	0	0	0	8.36431
O15230	LAMA5_HUMAN	Laminin subunit alpha-5 (Laminin-10 subunit alpha) (Laminin-11 subunit alpha) (Laminin-15 subunit alpha)	LAMA5 KIAA0533 KIAA1907	Homo sapiens (Human)	animal organ morphogenesis [GO:0009887]; axon guidance [GO:0007411]; branching involved in salivary gland morphogenesis [GO:0060445]; branching involved in ureteric bud morphogenesis [GO:0001658]; cell migration [GO:0016477]; cell-cell adhesion [GO:0098609]; cilium assembly [GO:0060271]; hair follicle development [GO:0001942]; integrin-mediated signaling pathway [GO:0007229]; lung development [GO:0030324]; morphogenesis of a polarized epithelium [GO:0001738]; morphogenesis of embryonic epithelium [GO:0016331]; muscle organ development [GO:0007517]; odontogenesis of dentin-containing tooth [GO:0042475]; protein localization to plasma membrane [GO:0072659]; regulation of cell adhesion [GO:0030155]; regulation of cell migration [GO:0030334]; regulation of embryonic development [GO:0045995]; regulation of epithelial cell proliferation [GO:0050678]; substrate adhesion-dependent cell spreading [GO:0034446]; tissue development [GO:0009888]; trunk neural crest cell migration [GO:0036484]	basement membrane [GO:0005604]; collagen-containing extracellular matrix [GO:0062023]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; laminin-10 complex [GO:0043259]; laminin-11 complex [GO:0043260]; laminin-5 complex [GO:0005610]; neuromuscular junction [GO:0031594]; nucleus [GO:0005634]; synaptic cleft [GO:0043083]	extracellular matrix structural constituent [GO:0005201]; integrin binding [GO:0005178]	ASPDGLCQVSLQQGR	0.46067	0	0	0	0	0	0	0	8.57501	8.55236	0	0	0
Q9Y5Y4	PD2R2_HUMAN	Prostaglandin D2 receptor 2 (Chemoattractant receptor-homologous molecule expressed on Th2 cells) (G-protein coupled receptor 44) (CD antigen CD294)	PTGDR2 CRTH2 DL1R GPR44	Homo sapiens (Human)	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway [GO:0007193]; calcium-mediated signaling [GO:0019722]; chemotaxis [GO:0006935]; G protein-coupled receptor signaling pathway [GO:0007186]; immune response [GO:0006955]; negative regulation of male germ cell proliferation [GO:2000255]; neuropeptide signaling pathway [GO:0007218]; positive regulation of G protein-coupled receptor signaling pathway [GO:0045745]	integral component of plasma membrane [GO:0005887]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; neuropeptide binding [GO:0042923]; peptide binding [GO:0042277]; prostaglandin D receptor activity [GO:0004956]; prostaglandin F receptor activity [GO:0004958]; prostaglandin J receptor activity [GO:0001785]	ALSSTSS	0.83101	0	0	0	0	0	0	8.68004	0	8.31075	0	0	0
Q5T7N3	KANK4_HUMAN	KN motif and ankyrin repeat domain-containing protein 4 (Ankyrin repeat domain-containing protein 38)	KANK4 ANKRD38	Homo sapiens (Human)	negative regulation of actin filament polymerization [GO:0030837]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; microtubule cytoskeleton [GO:0015630]		AGGNGTK	0.87523	0	8.5944	0	0	8.33686	0	0	0	0	0	0	0
Q8NBS3	S4A11_HUMAN	Solute carrier family 4 member 11 (Sodium borate cotransporter 1) (NaBC1)	SLC4A11 BTR1	Homo sapiens (Human)	bicarbonate transport [GO:0015701]; borate transport [GO:0046713]; cellular cation homeostasis [GO:0030003]; cellular hypotonic response [GO:0071476]; cellular response to oxidative stress [GO:0034599]; fluid transport [GO:0042044]; ion homeostasis [GO:0050801]; proton transmembrane transport [GO:1902600]; regulation of mesenchymal stem cell differentiation [GO:2000739]; regulation of mitochondrial membrane potential [GO:0051881]; sodium ion transport [GO:0006814]; transmembrane transport [GO:0055085]	apical plasma membrane [GO:0016324]; basolateral plasma membrane [GO:0016323]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; vesicle membrane [GO:0012506]	active borate transmembrane transporter activity [GO:0046715]; bicarbonate transmembrane transporter activity [GO:0015106]; protein dimerization activity [GO:0046983]; proton channel activity [GO:0015252]; proton transmembrane transporter activity [GO:0015078]; sodium channel activity [GO:0005272]; solute:inorganic anion antiporter activity [GO:0005452]; symporter activity [GO:0015293]; transmembrane transporter activity [GO:0022857]; water transmembrane transporter activity [GO:0005372]	ALALVEER	0.93545	0	8.06059	0	8.86474	0	0	0	0	0	0	0	0
Q5QJE6	TDIF2_HUMAN	Deoxynucleotidyltransferase terminal-interacting protein 2 (Estrogen receptor-binding protein) (LPTS-interacting protein 2) (LPTS-RP2) (Terminal deoxynucleotidyltransferase-interacting factor 2) (TdIF2) (TdT-interacting factor 2)	DNTTIP2 ERBP TDIF2	Homo sapiens (Human)	RNA processing [GO:0006396]	chromosome [GO:0005694]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	RNA binding [GO:0003723]	AANAAGK	0.93852	0	0	0	0	8.49313	0	0	8.37408	0	0	0	0
O00555	CAC1A_HUMAN	"Voltage-dependent P/Q-type calcium channel subunit alpha-1A (Brain calcium channel I) (BI) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Voltage-gated calcium channel subunit alpha Cav2.1)"	CACNA1A CACH4 CACN3 CACNL1A4	Homo sapiens (Human)	calcium ion import across plasma membrane [GO:0098703]; calcium ion transmembrane transport [GO:0070588]; cell death [GO:0008219]; cellular response to amyloid-beta [GO:1904646]; chemical synaptic transmission [GO:0007268]; modulation of chemical synaptic transmission [GO:0050804]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; regulation of ion transmembrane transport [GO:0034765]; response to amyloid-beta [GO:1904645]	cell projection [GO:0042995]; cytoplasm [GO:0005737]; integral component of membrane [GO:0016021]; neuronal cell body [GO:0043025]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; synapse [GO:0045202]; voltage-gated calcium channel complex [GO:0005891]	amyloid-beta binding [GO:0001540]; high voltage-gated calcium channel activity [GO:0008331]; metal ion binding [GO:0046872]; syntaxin binding [GO:0019905]; voltage-gated calcium channel activity [GO:0005245]	RPWAGSQEAELSREGPYGR	0.42262	0	0	0	0	0	0	0	8.52411	8.23654	0	0	0
P11279	LAMP1_HUMAN	Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a)	LAMP1	Homo sapiens (Human)	establishment of protein localization to organelle [GO:0072594]; Golgi to lysosome transport [GO:0090160]; granzyme-mediated programmed cell death signaling pathway [GO:0140507]; positive regulation of natural killer cell degranulation [GO:0043323]; positive regulation of natural killer cell mediated cytotoxicity [GO:0045954]; protein stabilization [GO:0050821]; regulation of organelle transport along microtubule [GO:1902513]	autolysosome [GO:0044754]; autophagosome membrane [GO:0000421]; azurophil granule membrane [GO:0035577]; cytolytic granule membrane [GO:0101004]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endosome membrane [GO:0010008]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; ficolin-1-rich granule membrane [GO:0101003]; integral component of plasma membrane [GO:0005887]; late endosome [GO:0005770]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; melanosome [GO:0042470]; membrane [GO:0016020]; multivesicular body [GO:0005771]; perinuclear region of cytoplasm [GO:0048471]; phagolysosome membrane [GO:0061474]; plasma membrane [GO:0005886]; sarcolemma [GO:0042383]; synaptic vesicle [GO:0008021]	enzyme binding [GO:0019899]; protein domain specific binding [GO:0019904]; virus receptor activity [GO:0001618]	AAPGSAR	0.80867	0	0	8.16123	8.06625	0	0	0	0	0	0	0	0
Q92499	DDX1_HUMAN	ATP-dependent RNA helicase DDX1 (EC 3.6.4.13) (DEAD box protein 1) (DEAD box protein retinoblastoma) (DBP-RB)	DDX1	Homo sapiens (Human)	"defense response to virus [GO:0051607]; DNA duplex unwinding [GO:0032508]; double-strand break repair [GO:0006302]; innate immune response [GO:0045087]; nucleic acid phosphodiester bond hydrolysis [GO:0090305]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of myeloid dendritic cell cytokine production [GO:0002735]; protein localization to cytoplasmic stress granule [GO:1903608]; regulation of translational initiation [GO:0006446]; response to exogenous dsRNA [GO:0043330]; spliceosomal complex assembly [GO:0000245]; tRNA splicing, via endonucleolytic cleavage and ligation [GO:0006388]"	cleavage body [GO:0071920]; cytoplasm [GO:0005737]; cytoplasmic stress granule [GO:0010494]; cytosol [GO:0005829]; membrane [GO:0016020]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]; tRNA-splicing ligase complex [GO:0072669]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA/RNA helicase activity [GO:0033677]; double-stranded RNA binding [GO:0003725]; exonuclease activity [GO:0004527]; nuclease activity [GO:0004518]; poly(A) binding [GO:0008143]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724]; transcription coregulator activity [GO:0003712]	IGRVGRAER	0.94149	15.5272	0	0	0	0	0	0	0	0	0	0	0
Q86SE9	PCGF5_HUMAN	Polycomb group RING finger protein 5 (RING finger protein 159)	PCGF5 RNF159	Homo sapiens (Human)	histone H2A-K119 monoubiquitination [GO:0036353]; inactivation of X chromosome by genomic imprinting [GO:0060819]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of transcription by RNA polymerase II [GO:0006357]	centrosome [GO:0005813]; Golgi apparatus [GO:0005794]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; PcG protein complex [GO:0031519]; PRC1 complex [GO:0035102]; X chromosome [GO:0000805]	metal ion binding [GO:0046872]	DHTMEFIYMTR	0.93969	14.9121	0	0	0	0	0	0	0	0	0	0	0
E7ETH6	Z587B_HUMAN	Zinc finger protein 587B	ZNF587B	Homo sapiens (Human)	negative regulation of transcription by RNA polymerase II [GO:0000122]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; metal ion binding [GO:0046872]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	TPVTGVSPKK	0.99814	0	0	0	0	14.6088	0	0	0	0	0	0	0
P10745	RET3_HUMAN	Retinol-binding protein 3 (Interphotoreceptor retinoid-binding protein) (IRBP) (Interstitial retinol-binding protein)	RBP3	Homo sapiens (Human)	lipid metabolic process [GO:0006629]; proteolysis [GO:0006508]; retinoid metabolic process [GO:0001523]; visual perception [GO:0007601]	cone matrix sheath [GO:0090658]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; extracellular vesicle [GO:1903561]	retinal binding [GO:0016918]; retinoid binding [GO:0005501]; retinol binding [GO:0019841]; serine-type peptidase activity [GO:0008236]	VPTVLQTAGK	0.93707	0	0	0	0	14.6088	0	0	0	0	0	0	0
Q9NY65	TBA8_HUMAN	Tubulin alpha-8 chain (EC 3.6.5.-) (Alpha-tubulin 8) (Tubulin alpha chain-like 2) [Cleaved into: Dephenylalaninated tubulin alpha-8 chain]	TUBA8 TUBAL2	Homo sapiens (Human)	microtubule cytoskeleton organization [GO:0000226]; mitotic cell cycle [GO:0000278]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; microtubule cytoskeleton [GO:0015630]	GTP binding [GO:0005525]; structural constituent of cytoskeleton [GO:0005200]	DVNVAIAAIK	0.95739	0	0	0	0	0	14.5741	0	0	0	0	0	0
O95886	DLGP3_HUMAN	Disks large-associated protein 3 (DAP-3) (PSD-95/SAP90-binding protein 3) (SAP90/PSD-95-associated protein 3) (SAPAP3)	DLGAP3 DAP3	Homo sapiens (Human)	modification of synaptic structure [GO:0099563]; regulation of postsynaptic neurotransmitter receptor activity [GO:0098962]; signaling [GO:0023052]	anchoring junction [GO:0070161]; cholinergic synapse [GO:0098981]; glutamatergic synapse [GO:0098978]; neuromuscular junction [GO:0031594]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; postsynaptic specialization [GO:0099572]	amyloid-beta binding [GO:0001540]; molecular adaptor activity [GO:0060090]	GLLGPETKAK	0.99978	0	0	0	0	0	0	0	0	14.4185	0	0	0
Q13433	S39A6_HUMAN	Zinc transporter ZIP6 (Estrogen-regulated protein LIV-1) (Solute carrier family 39 member 6) (Zrt- and Irt-like protein 6) (ZIP-6)	SLC39A6 LIV1 ZIP6	Homo sapiens (Human)	cellular zinc ion homeostasis [GO:0006882]; zinc ion import across plasma membrane [GO:0071578]; zinc ion transmembrane transport [GO:0071577]	cell surface [GO:0009986]; endoplasmic reticulum [GO:0005783]; integral component of plasma membrane [GO:0005887]; lamellipodium membrane [GO:0031258]; plasma membrane [GO:0005886]	zinc ion transmembrane transporter activity [GO:0005385]	LLQNIGIDK	0.99956	0	0	0	0	0	0	0	14.4086	0	0	0	0
Q8TAT5	NEIL3_HUMAN	Endonuclease 8-like 3 (EC 3.2.2.-) (EC 4.2.99.18) (DNA glycosylase FPG2) (DNA glycosylase/AP lyase Neil3) (Endonuclease VIII-like 3) (Nei-like protein 3)	NEIL3	Homo sapiens (Human)	"base-excision repair [GO:0006284]; base-excision repair, AP site formation [GO:0006285]; depurination [GO:0045007]; interstrand cross-link repair [GO:0036297]"	chromosome [GO:0005694]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	bubble DNA binding [GO:0000405]; class I DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0140078]; damaged DNA binding [GO:0003684]; DNA N-glycosylase activity [GO:0019104]; DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0003906]; double-stranded DNA binding [GO:0003690]; MCM complex binding [GO:1904931]; single-stranded DNA binding [GO:0003697]; zinc ion binding [GO:0008270]	MTYFCPHCQK	0.93959	14.4045	0	0	0	0	0	0	0	0	0	0	0
Q92887	MRP2_HUMAN	ATP-binding cassette sub-family C member 2 (EC 7.6.2.-) (EC 7.6.2.2) (EC 7.6.2.3) (Canalicular multidrug resistance protein) (Canalicular multispecific organic anion transporter 1) (Multidrug resistance-associated protein 2)	ABCC2 CMOAT CMOAT1 CMRP MRP2	Homo sapiens (Human)	bile acid and bile salt transport [GO:0015721]; bilirubin transport [GO:0015723]; heme catabolic process [GO:0042167]; leukotriene transport [GO:0071716]; negative regulation of gene expression [GO:0010629]; transepithelial transport [GO:0070633]; transmembrane transport [GO:0055085]; transport across blood-brain barrier [GO:0150104]; xenobiotic export from cell [GO:0046618]; xenobiotic metabolic process [GO:0006805]; xenobiotic transmembrane transport [GO:0006855]; xenobiotic transport across blood-brain barrier [GO:1990962]	apical plasma membrane [GO:0016324]; cell surface [GO:0009986]; integral component of plasma membrane [GO:0005887]; intercellular canaliculus [GO:0046581]; membrane [GO:0016020]; plasma membrane [GO:0005886]	ABC-type glutathione S-conjugate transporter activity [GO:0015431]; ABC-type transporter activity [GO:0140359]; ABC-type xenobiotic transporter activity [GO:0008559]; ATP binding [GO:0005524]; ATPase-coupled inorganic anion transmembrane transporter activity [GO:0043225]; ATPase-coupled transmembrane transporter activity [GO:0042626]; bilirubin transmembrane transporter activity [GO:0015127]; organic anion transmembrane transporter activity [GO:0008514]; xenobiotic transmembrane transporter activity [GO:0042910]	ARRALQR	0.85734	13.9908	0	0	0	0	0	0	0	0	0	0	0
Q96PL1	SG3A2_HUMAN	Secretoglobin family 3A member 2 (Pneumo secretory protein 1) (PnSP-1) (Uteroglobin-related protein 1)	SCGB3A2 PNSP1 UGRP1 UNQ566/PRO1128	Homo sapiens (Human)		endocytic vesicle lumen [GO:0071682]; extracellular region [GO:0005576]; extracellular space [GO:0005615]		VPLPVDK	0.93783	0	13.9308	0	0	0	0	0	0	0	0	0	0
O00515	LAD1_HUMAN	Ladinin-1 (Lad-1) (Linear IgA disease antigen) (LADA)	LAD1 LAD	Homo sapiens (Human)		actin cytoskeleton [GO:0015629]; basement membrane [GO:0005604]; extracellular exosome [GO:0070062]	cadherin binding [GO:0045296]; structural molecule activity [GO:0005198]	GPWALEEESLVGREPEERK	0.95562	0	13.5013	0	0	0	0	0	0	0	0	0	0
P57071	PRD15_HUMAN	PR domain zinc finger protein 15 (EC 2.1.1.-) (PR domain-containing protein 15) (Zinc finger protein 298)	PRDM15 C21orf83 ZNF298	Homo sapiens (Human)	methylation [GO:0032259]; negative regulation of MAPK cascade [GO:0043409]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of stem cell division [GO:2000035]; regulation of transcription by RNA polymerase II [GO:0006357]	nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; metal ion binding [GO:0046872]; methyltransferase activity [GO:0008168]; promoter-specific chromatin binding [GO:1990841]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	HGKAAKR	0.93964	0	0	0	0	0	0	0	0	0	0	0	13.4163
P49815	TSC2_HUMAN	Tuberin (Tuberous sclerosis 2 protein)	TSC2 TSC4	Homo sapiens (Human)	anoikis [GO:0043276]; endocytosis [GO:0006897]; heart development [GO:0007507]; insulin-like growth factor receptor signaling pathway [GO:0048009]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of insulin receptor signaling pathway [GO:0046627]; negative regulation of mitophagy [GO:1901525]; negative regulation of phosphatidylinositol 3-kinase signaling [GO:0014067]; negative regulation of protein kinase activity [GO:0006469]; negative regulation of protein kinase B signaling [GO:0051898]; negative regulation of TOR signaling [GO:0032007]; negative regulation of Wnt signaling pathway [GO:0030178]; neural tube closure [GO:0001843]; positive chemotaxis [GO:0050918]; positive regulation of GTPase activity [GO:0043547]; positive regulation of macroautophagy [GO:0016239]; protein import into nucleus [GO:0006606]; protein kinase B signaling [GO:0043491]; protein localization [GO:0008104]; regulation of cell cycle [GO:0051726]; regulation of endocytosis [GO:0030100]; regulation of insulin receptor signaling pathway [GO:0046626]; regulation of small GTPase mediated signal transduction [GO:0051056]; vesicle-mediated transport [GO:0016192]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; lysosome [GO:0005764]; membrane [GO:0016020]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; postsynaptic density [GO:0014069]; TSC1-TSC2 complex [GO:0033596]	GTPase activator activity [GO:0005096]; Hsp90 protein binding [GO:0051879]; phosphatase binding [GO:0019902]; protein homodimerization activity [GO:0042803]; small GTPase binding [GO:0031267]	ELCEPCWK	0.97942	0	0	0	0	0	0	13.3534	0	0	0	0	0
O43303	CP110_HUMAN	Centriolar coiled-coil protein of 110 kDa (Centrosomal protein of 110 kDa) (CP110) (Cep110)	CCP110 CEP110 CP110 KIAA0419	Homo sapiens (Human)	centriole replication [GO:0007099]; centrosome duplication [GO:0051298]; ciliary basal body organization [GO:0032053]; negative regulation of centriole elongation [GO:1903723]; negative regulation of cilium assembly [GO:1902018]; positive regulation of cilium assembly [GO:0045724]; regulation of cytokinesis [GO:0032465]	centriole [GO:0005814]; centrosome [GO:0005813]; cilium [GO:0005929]; cytosol [GO:0005829]; protein-containing complex [GO:0032991]		MLGTSSK	0.94675	13.3365	0	0	0	0	0	0	0	0	0	0	0
Q9Y5B6	PAXB1_HUMAN	PAX3- and PAX7-binding protein 1 (GC-rich sequence DNA-binding factor 1)	PAXBP1 C21orf66 GCFC GCFC1	Homo sapiens (Human)	"mRNA splicing, via spliceosome [GO:0000398]; muscle organ development [GO:0007517]; positive regulation of histone methylation [GO:0031062]; positive regulation of myoblast proliferation [GO:2000288]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of skeletal muscle satellite cell proliferation [GO:0014842]; transcription by RNA polymerase II [GO:0006366]"	cytosol [GO:0005829]; nucleus [GO:0005634]	DNA binding [GO:0003677]	ARRVNVR	0.93601	0	0	0	0	0	0	13.311	0	0	0	0	0
Q8WXF8	DEDD2_HUMAN	DNA-binding death effector domain-containing protein 2 (DED-containing protein FLAME-3) (FADD-like anti-apoptotic molecule 3)	DEDD2 FLAME3 PSEC0004	Homo sapiens (Human)	apoptotic nuclear changes [GO:0030262]; cellular homeostasis [GO:0019725]; extrinsic apoptotic signaling pathway via death domain receptors [GO:0008625]; intracellular signal transduction [GO:0035556]; negative regulation of DNA-templated transcription [GO:0045892]; positive regulation of extrinsic apoptotic signaling pathway [GO:2001238]; RNA processing [GO:0006396]; rRNA catabolic process [GO:0016075]	nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	DNA binding [GO:0003677]; signaling receptor complex adaptor activity [GO:0030159]	RPQALAR	0.93514	0	0	0	0	0	0	0	0	0	0	0	13.2955
Q8NBS9	TXND5_HUMAN	Thioredoxin domain-containing protein 5 (EC 1.8.4.-) (EC 5.3.4.1) (Endoplasmic reticulum resident protein 46) (ER protein 46) (ERp46) (Thioredoxin-like protein p46)	TXNDC5 TLP46 UNQ364/PRO700	Homo sapiens (Human)	negative regulation of apoptotic process [GO:0043066]; protein folding [GO:0006457]	azurophil granule lumen [GO:0035578]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; lysosomal lumen [GO:0043202]	protein disulfide isomerase activity [GO:0003756]; protein-disulfide reductase activity [GO:0015035]	FVLSQAKDEL	0.99934	0	13.2821	0	0	0	0	0	0	0	0	0	0
Q9UN36	NDRG2_HUMAN	Protein NDRG2 (N-myc downstream-regulated gene 2 protein) (Protein Syld709613)	NDRG2 KIAA1248 SYLD	Homo sapiens (Human)	cell differentiation [GO:0030154]; negative regulation of cytokine production [GO:0001818]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; negative regulation of vascular associated smooth muscle cell proliferation [GO:1904706]; regulation of platelet-derived growth factor production [GO:0090361]; regulation of vascular endothelial growth factor production [GO:0010574]; signal transduction [GO:0007165]; substantia nigra development [GO:0021762]; vascular associated smooth muscle cell proliferation [GO:1990874]; Wnt signaling pathway [GO:0016055]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; growth cone [GO:0030426]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]		LDPTQTSFLK	0.93765	0	13.2821	0	0	0	0	0	0	0	0	0	0
Q96L73	NSD1_HUMAN	"Histone-lysine N-methyltransferase, H3 lysine-36 specific (EC 2.1.1.357) (Androgen receptor coactivator 267 kDa protein) (Androgen receptor-associated protein of 267 kDa) (H3-K36-HMTase) (Lysine N-methyltransferase 3B) (Nuclear receptor-binding SET domain-containing protein 1) (NR-binding SET domain-containing protein)"	NSD1 ARA267 KMT3B	Homo sapiens (Human)	chromatin organization [GO:0006325]; histone methylation [GO:0016571]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of DNA-templated transcription [GO:0045893]; regulation of DNA-templated transcription [GO:0006355]; regulation of histone H3-K36 methylation [GO:0000414]; regulation of peptidyl-serine phosphorylation [GO:0033135]; regulation of RNA polymerase II regulatory region sequence-specific DNA binding [GO:1903025]	chromatin [GO:0000785]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	chromatin binding [GO:0003682]; histone methyltransferase activity (H3-K36 specific) [GO:0046975]; histone methyltransferase activity (H4-K20 specific) [GO:0042799]; histone-lysine N-methyltransferase activity [GO:0018024]; nuclear androgen receptor binding [GO:0050681]; nuclear estrogen receptor binding [GO:0030331]; nuclear retinoic acid receptor binding [GO:0042974]; nuclear retinoid X receptor binding [GO:0046965]; nuclear thyroid hormone receptor binding [GO:0046966]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; transcription coregulator activity [GO:0003712]; transcription corepressor activity [GO:0003714]; zinc ion binding [GO:0008270]	APASLPTEEK	0.97273	0	0	0	0	0	0	0	0	0	0	13.2079	0
Q86UV7	TRI73_HUMAN	Tripartite motif-containing protein 73 (Tripartite motif-containing protein 50B)	TRIM73 TRIM50B	Homo sapiens (Human)	protein ubiquitination [GO:0016567]	cytoplasm [GO:0005737]; cytosol [GO:0005829]	ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]	VDELIAKLVK	0.99909	0	0	0	0	0	0	0	13.2047	0	0	0	0
P29323	EPHB2_HUMAN	Ephrin type-B receptor 2 (EC 2.7.10.1) (Developmentally-regulated Eph-related tyrosine kinase) (ELK-related tyrosine kinase) (EPH tyrosine kinase 3) (EPH-like kinase 5) (EK5) (hEK5) (Renal carcinoma antigen NY-REN-47) (Tyrosine-protein kinase TYRO5) (Tyrosine-protein kinase receptor EPH-3) [Cleaved into: EphB2/CTF1; EphB2/CTF2]	EPHB2 DRT EPHT3 EPTH3 ERK HEK5 TYRO5	Homo sapiens (Human)	"angiogenesis [GO:0001525]; axon guidance [GO:0007411]; axonal fasciculation [GO:0007413]; B cell activation [GO:0042113]; camera-type eye morphogenesis [GO:0048593]; cellular response to amyloid-beta [GO:1904646]; cellular response to lipopolysaccharide [GO:0071222]; central nervous system projection neuron axonogenesis [GO:0021952]; commissural neuron axon guidance [GO:0071679]; corpus callosum development [GO:0022038]; dendritic spine development [GO:0060996]; dendritic spine morphogenesis [GO:0060997]; ephrin receptor signaling pathway [GO:0048013]; hindbrain tangential cell migration [GO:0021934]; inner ear morphogenesis [GO:0042472]; learning [GO:0007612]; learning or memory [GO:0007611]; negative regulation of axonogenesis [GO:0050771]; negative regulation of cell adhesion [GO:0007162]; negative regulation of cytokine production involved in inflammatory response [GO:1900016]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; negative regulation of NMDA glutamate receptor activity [GO:1904782]; negative regulation of protein kinase activity [GO:0006469]; negative regulation of protein phosphorylation [GO:0001933]; negative regulation of Ras protein signal transduction [GO:0046580]; nervous system development [GO:0007399]; neuron projection retraction [GO:0106028]; optic nerve morphogenesis [GO:0021631]; peptidyl-tyrosine phosphorylation [GO:0018108]; phosphorylation [GO:0016310]; positive regulation of B cell proliferation [GO:0030890]; positive regulation of cell migration [GO:0030335]; positive regulation of dendritic spine morphogenesis [GO:0061003]; positive regulation of gene expression [GO:0010628]; positive regulation of immunoglobulin production [GO:0002639]; positive regulation of kinase activity [GO:0033674]; positive regulation of long-term neuronal synaptic plasticity [GO:0048170]; positive regulation of long-term synaptic potentiation [GO:1900273]; positive regulation of NMDA glutamate receptor activity [GO:1904783]; positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of synapse assembly [GO:0051965]; positive regulation of synaptic plasticity [GO:0031915]; positive regulation of tumor necrosis factor production [GO:0032760]; postsynaptic membrane assembly [GO:0097104]; regulation of behavioral fear response [GO:2000822]; regulation of blood coagulation [GO:0030193]; regulation of body fluid levels [GO:0050878]; regulation of filopodium assembly [GO:0051489]; regulation of neuronal synaptic plasticity [GO:0048168]; regulation of receptor signaling pathway via JAK-STAT [GO:0046425]; regulation of T-helper 17 type immune response [GO:2000316]; retinal ganglion cell axon guidance [GO:0031290]; roof of mouth development [GO:0060021]; tight junction assembly [GO:0120192]; trans-synaptic signaling by trans-synaptic complex, modulating synaptic transmission [GO:0099557]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]; urogenital system development [GO:0001655]; vesicle-mediated intercellular transport [GO:0110077]"	axon [GO:0030424]; cell surface [GO:0009986]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendritic spine [GO:0043197]; extracellular region [GO:0005576]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; integral component of plasma membrane [GO:0005887]; integral component of postsynaptic membrane [GO:0099055]; integral component of presynaptic membrane [GO:0099056]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; receptor complex [GO:0043235]	amyloid-beta binding [GO:0001540]; ATP binding [GO:0005524]; axon guidance receptor activity [GO:0008046]; identical protein binding [GO:0042802]; protein tyrosine kinase activity [GO:0004713]; protein-containing complex binding [GO:0044877]; signaling receptor binding [GO:0005102]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]; transmembrane-ephrin receptor activity [GO:0005005]	TVAGYGR	0.93791	0	13.1999	0	0	0	0	0	0	0	0	0	0
Q01344	IL5RA_HUMAN	Interleukin-5 receptor subunit alpha (IL-5 receptor subunit alpha) (IL-5R subunit alpha) (IL-5R-alpha) (IL-5RA) (CDw125) (CD antigen CD125)	IL5RA IL5R	Homo sapiens (Human)	cytokine-mediated signaling pathway [GO:0019221]; inflammatory response to antigenic stimulus [GO:0002437]; positive regulation of leukocyte proliferation [GO:0070665]; regulation of interleukin-5 production [GO:0032674]; signal transduction [GO:0007165]	external side of plasma membrane [GO:0009897]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]	cytokine binding [GO:0019955]; cytokine receptor activity [GO:0004896]; interleukin-5 receptor activity [GO:0004914]	GFSASVR	0.93625	0	13.1999	0	0	0	0	0	0	0	0	0	0
Q9NV66	TYW1_HUMAN	S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1 (EC 4.1.3.44) (Radical S-adenosyl methionine and flavodoxin domain-containing protein 1) (tRNA wybutosine-synthesizing protein 1 homolog) (tRNA-yW-synthesizing protein)	TYW1 RSAFD1	Homo sapiens (Human)	wybutosine biosynthetic process [GO:0031591]		"4 iron, 4 sulfur cluster binding [GO:0051539]; FMN binding [GO:0010181]; metal ion binding [GO:0046872]; tRNA-4-demethylwyosine synthase activity [GO:0102521]"	TQGKNLQEK	0.99978	0	0	0	0	0	0	0	0	0	13.1976	0	0
P53007	TXTP_HUMAN	"Tricarboxylate transport protein, mitochondrial (Citrate transport protein) (CTP) (Mitochondrial citrate carrier) (CIC) (Solute carrier family 25 member 1) (Tricarboxylate carrier protein)"	SLC25A1 SLC20A3	Homo sapiens (Human)	fatty-acyl-CoA biosynthetic process [GO:0046949]; gluconeogenesis [GO:0006094]; mitochondrial citrate transmembrane transport [GO:0006843]	extracellular exosome [GO:0070062]; integral component of membrane [GO:0016021]; mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]; nucleus [GO:0005634]	citrate secondary active transmembrane transporter activity [GO:0071913]; citrate transmembrane transporter activity [GO:0015137]; tricarboxylic acid transmembrane transporter activity [GO:0015142]	GTVPRLGR	0.99977	0	13.1901	0	0	0	0	0	0	0	0	0	0
P08758	ANXA5_HUMAN	Annexin A5 (Anchorin CII) (Annexin V) (Annexin-5) (Calphobindin I) (CPB-I) (Endonexin II) (Lipocortin V) (Placental anticoagulant protein 4) (PP4) (Placental anticoagulant protein I) (PAP-I) (Thromboplastin inhibitor) (Vascular anticoagulant-alpha) (VAC-alpha)	ANXA5 ANX5 ENX2 PP4	Homo sapiens (Human)	blood coagulation [GO:0007596]; negative regulation of apoptotic process [GO:0043066]; negative regulation of coagulation [GO:0050819]; response to organic substance [GO:0010033]; signal transduction [GO:0007165]	collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endothelial microparticle [GO:0072563]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; focal adhesion [GO:0005925]; membrane [GO:0016020]	calcium ion binding [GO:0005509]; calcium-dependent phospholipid binding [GO:0005544]; phospholipase inhibitor activity [GO:0004859]; phospholipid binding [GO:0005543]	LIVALMKPSR	0.93754	0	0	0	13.1852	0	0	0	0	0	0	0	0
Q86WZ0	HEAT4_HUMAN	HEAT repeat-containing protein 4	HEATR4	Homo sapiens (Human)			oxidoreductase activity [GO:0016491]	IAVGPFR	0.46286	0	0	0	13.1852	0	0	0	0	0	0	0	0
Q8IYM2	SLN12_HUMAN	Ribonuclease SLFN12 (EC 3.1.-.-) (Schlafen family member 12)	SLFN12	Homo sapiens (Human)	apoptotic signaling pathway [GO:0097190]; rRNA catabolic process [GO:0016075]	cytosol [GO:0005829]; nucleus [GO:0005634]	ribonuclease activity [GO:0004540]; ribosome binding [GO:0043022]	MFKSCRR	0.9391	0	0	0	0	0	0	0	0	13.1828	0	0	0
Q9HCE5	MET14_HUMAN	N6-adenosine-methyltransferase non-catalytic subunit (Methyltransferase-like protein 14) (hMETTL14)	METTL14 KIAA1627	Homo sapiens (Human)	"forebrain radial glial cell differentiation [GO:0021861]; gliogenesis [GO:0042063]; mRNA catabolic process [GO:0006402]; mRNA destabilization [GO:0061157]; mRNA methylation [GO:0080009]; mRNA splicing, via spliceosome [GO:0000398]; negative regulation of hematopoietic progenitor cell differentiation [GO:1901533]; positive regulation of translation [GO:0045727]; spermatogenesis [GO:0007283]; stem cell population maintenance [GO:0019827]"	nucleoplasm [GO:0005654]; nucleus [GO:0005634]; RNA N6-methyladenosine methyltransferase complex [GO:0036396]	mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity [GO:0016422]; mRNA binding [GO:0003729]	GGRGGAHR	0.99977	0	13.1787	0	0	0	0	0	0	0	0	0	0
Q8WYP5	ELYS_HUMAN	Protein ELYS (Embryonic large molecule derived from yolk sac) (Protein MEL-28) (Putative AT-hook-containing transcription factor 1)	AHCTF1 ELYS TMBS62 MSTP108	Homo sapiens (Human)	cell cycle [GO:0007049]; cell division [GO:0051301]; mRNA transport [GO:0051028]; nuclear pore complex assembly [GO:0051292]; nucleocytoplasmic transport [GO:0006913]; protein transport [GO:0015031]; regulation of cytokinesis [GO:0032465]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; kinetochore [GO:0000776]; nuclear envelope [GO:0005635]; nuclear matrix [GO:0016363]; nuclear membrane [GO:0031965]; nuclear pore [GO:0005643]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	DNA binding [GO:0003677]	LRERSLAR	0.9959	0	0	0	0	0	0	0	0	0	13.1556	0	0
O95221	OR5F1_HUMAN	Olfactory receptor 5F1 (Olfactory receptor 11-10) (OR11-10) (Olfactory receptor OR11-167)	OR5F1	Homo sapiens (Human)	sensory perception of smell [GO:0007608]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; odorant binding [GO:0005549]; olfactory receptor activity [GO:0004984]	ALANVISRKR	0.96232	0	0	0	0	0	0	0	0	13.1488	0	0	0
Q0VAK6	LMOD3_HUMAN	"Leiomodin-3 (Leiomodin, fetal form)"	LMOD3	Homo sapiens (Human)	actin filament organization [GO:0007015]; actin nucleation [GO:0045010]; muscle contraction [GO:0006936]; myofibril assembly [GO:0030239]; pointed-end actin filament capping [GO:0051694]; positive regulation of skeletal muscle fiber development [GO:0048743]; skeletal muscle fiber development [GO:0048741]; skeletal muscle thin filament assembly [GO:0030240]; striated muscle contraction [GO:0006941]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; M band [GO:0031430]; myofibril [GO:0030016]; striated muscle thin filament [GO:0005865]	actin monomer binding [GO:0003785]; tropomyosin binding [GO:0005523]	EQRDRPEAQEQSEKK	0.99624	0	0	0	0	0	0	0	0	13.1488	0	0	0
Q92623	TTC9A_HUMAN	Tetratricopeptide repeat protein 9A (TPR repeat protein 9A)	TTC9 KIAA0227 TTC9A	Homo sapiens (Human)	bone development [GO:0060348]			CSQREKEAM	0.95734	0	0	0	0	0	0	13.1485	0	0	0	0	0
Q9UPS8	ANR26_HUMAN	Ankyrin repeat domain-containing protein 26	ANKRD26 KIAA1074	Homo sapiens (Human)	negative regulation of fat cell differentiation [GO:0045599]	centrosome [GO:0005813]		DLGKIHKAASAGNVAK	0.94855	0	13.0616	0	0	0	0	0	0	0	0	0	0
P0DJ07	PT100_HUMAN	"Protein PET100 homolog, mitochondrial"	PET100 C19orf79	Homo sapiens (Human)	mitochondrial cytochrome c oxidase assembly [GO:0033617]	integral component of mitochondrial inner membrane [GO:0031305]	unfolded protein binding [GO:0051082]	REEKLLR	0.94169	0	13.0401	0	0	0	0	0	0	0	0	0	0
Q8N2C7	UNC80_HUMAN	Protein unc-80 homolog	UNC80 C2orf21 KIAA1843	Homo sapiens (Human)	cation homeostasis [GO:0055080]	axon [GO:0030424]; cation channel complex [GO:0034703]; plasma membrane [GO:0005886]	cation channel activity [GO:0005261]	VILVCFER	0.51691	0	0	0	0	0	0	0	0	0	13.0278	0	0
P23378	GCSP_HUMAN	"Glycine dehydrogenase (decarboxylating), mitochondrial (EC 1.4.4.2) (Glycine cleavage system P protein) (Glycine decarboxylase) (Glycine dehydrogenase (aminomethyl-transferring))"	GLDC GCSP	Homo sapiens (Human)	cellular response to leukemia inhibitory factor [GO:1990830]; glycine catabolic process [GO:0006546]; glycine decarboxylation via glycine cleavage system [GO:0019464]; response to lipoic acid [GO:1903442]; response to methylamine [GO:0036255]	glycine cleavage complex [GO:0005960]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]	electron transfer activity [GO:0009055]; glycine binding [GO:0016594]; glycine dehydrogenase (decarboxylating) activity [GO:0004375]; lyase activity [GO:0016829]; protein homodimerization activity [GO:0042803]; pyridoxal binding [GO:0070280]; pyridoxal phosphate binding [GO:0030170]	HIGPGDK	0.93775	0	0	13.0272	0	0	0	0	0	0	0	0	0
P12755	SKI_HUMAN	Ski oncogene (Proto-oncogene c-Ski)	SKI	Homo sapiens (Human)	anterior/posterior axis specification [GO:0009948]; bone morphogenesis [GO:0060349]; camera-type eye development [GO:0043010]; camera-type eye morphogenesis [GO:0048593]; cardiac muscle cell proliferation [GO:0060038]; cell motility [GO:0048870]; embryonic limb morphogenesis [GO:0030326]; face morphogenesis [GO:0060325]; lens morphogenesis in camera-type eye [GO:0002089]; myelination in peripheral nervous system [GO:0022011]; myotube differentiation [GO:0014902]; negative regulation of activin receptor signaling pathway [GO:0032926]; negative regulation of BMP signaling pathway [GO:0030514]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of fibroblast proliferation [GO:0048147]; negative regulation of osteoblast differentiation [GO:0045668]; negative regulation of Schwann cell proliferation [GO:0010626]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transforming growth factor beta receptor signaling pathway [GO:0030512]; neural tube closure [GO:0001843]; nose morphogenesis [GO:0043585]; olfactory bulb development [GO:0021772]; positive regulation of DNA binding [GO:0043388]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of Wnt signaling pathway [GO:0030177]; retina development in camera-type eye [GO:0060041]; roof of mouth development [GO:0060021]; skeletal muscle fiber development [GO:0048741]; SMAD protein signal transduction [GO:0060395]; somatic stem cell population maintenance [GO:0035019]; transforming growth factor beta receptor signaling pathway [GO:0007179]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; PML body [GO:0016605]; protein-containing complex [GO:0032991]; transcription regulator complex [GO:0005667]; transcription repressor complex [GO:0017053]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription factor binding [GO:0140297]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; histone deacetylase inhibitor activity [GO:0046811]; identical protein binding [GO:0042802]; protein domain specific binding [GO:0019904]; protein kinase binding [GO:0019901]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; SMAD binding [GO:0046332]; ubiquitin protein ligase binding [GO:0031625]; zinc ion binding [GO:0008270]"	KEIERLR	0.93733	0	0	12.9794	0	0	0	0	0	0	0	0	0
Q86WJ1	CHD1L_HUMAN	Chromodomain-helicase-DNA-binding protein 1-like (EC 3.6.4.-) (Amplified in liver cancer protein 1)	CHD1L ALC1	Homo sapiens (Human)	cellular response to DNA damage stimulus [GO:0006974]; chromatin remodeling [GO:0006338]; DNA repair [GO:0006281]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; site of double-strand break [GO:0035861]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent chromatin remodeler activity [GO:0140658]; DNA helicase activity [GO:0003678]; histone reader activity [GO:0140566]; nucleosome binding [GO:0031491]; nucleotide binding [GO:0000166]; poly-ADP-D-ribose modification-dependent protein binding [GO:0160004]	LIGRDTVEEIVYRK	0.94484	0	0	12.9794	0	0	0	0	0	0	0	0	0
P09630	HXC6_HUMAN	Homeobox protein Hox-C6 (Homeobox protein CP25) (Homeobox protein HHO.C8) (Homeobox protein Hox-3C)	HOXC6 HOX3C	Homo sapiens (Human)	anterior/posterior pattern specification [GO:0009952]; embryonic skeletal system development [GO:0048706]; regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	GRQIYSRYQTLELEK	0.9367	0	0	12.9765	0	0	0	0	0	0	0	0	0
Q92824	PCSK5_HUMAN	Proprotein convertase subtilisin/kexin type 5 (EC 3.4.21.-) (Proprotein convertase 5) (PC5) (Proprotein convertase 6) (PC6) (hPC6) (Subtilisin/kexin-like protease PC5)	PCSK5 PC5 PC6	Homo sapiens (Human)	anterior/posterior pattern specification [GO:0009952]; cell-cell signaling [GO:0007267]; cytokine precursor processing [GO:0140447]; embryo implantation [GO:0007566]; embryonic digestive tract development [GO:0048566]; embryonic skeletal system development [GO:0048706]; heart development [GO:0007507]; kidney development [GO:0001822]; limb morphogenesis [GO:0035108]; peptide biosynthetic process [GO:0043043]; peptide hormone processing [GO:0016486]; protein processing [GO:0016485]; regulation of lipoprotein lipase activity [GO:0051004]; renin secretion into blood stream [GO:0002001]; respiratory tube development [GO:0030323]; signal peptide processing [GO:0006465]; viral life cycle [GO:0019058]	extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; Golgi lumen [GO:0005796]; integral component of Golgi membrane [GO:0030173]; membrane [GO:0016020]; trans-Golgi network [GO:0005802]	endopeptidase activity [GO:0004175]; peptidase activity [GO:0008233]; peptide binding [GO:0042277]; serine-type endopeptidase activity [GO:0004252]	VQPAAKAGYEK	1.0002	0	0	0	0	0	0	12.964	0	0	0	0	0
Q9NTG7	SIR3_HUMAN	"NAD-dependent protein deacetylase sirtuin-3, mitochondrial (hSIRT3) (EC 2.3.1.286) (Regulatory protein SIR2 homolog 3) (SIR2-like protein 3)"	SIRT3 SIR2L3	Homo sapiens (Human)	aerobic respiration [GO:0009060]; peptidyl-lysine deacetylation [GO:0034983]; positive regulation of catalase activity [GO:1902553]; positive regulation of ceramide biosynthetic process [GO:2000304]; positive regulation of superoxide dismutase activity [GO:1901671]; protein ADP-ribosylation [GO:0006471]; protein deacetylation [GO:0006476]	mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]	NAD+ ADP-ribosyltransferase activity [GO:0003950]; NAD+ binding [GO:0070403]; NAD-dependent histone deacetylase activity [GO:0017136]; NAD-dependent protein deacetylase activity [GO:0034979]; sequence-specific DNA binding [GO:0043565]; zinc ion binding [GO:0008270]	DLVQRETGK	0.99932	0	12.9487	0	0	0	0	0	0	0	0	0	0
O95490	AGRL2_HUMAN	Adhesion G protein-coupled receptor L2 (Calcium-independent alpha-latrotoxin receptor 2) (CIRL-2) (Latrophilin homolog 1) (Latrophilin-2) (Lectomedin-1)	ADGRL2 KIAA0786 LEC1 LPHH1 LPHN2	Homo sapiens (Human)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; brain development [GO:0007420]; cell surface receptor signaling pathway [GO:0007166]; G protein-coupled receptor signaling pathway [GO:0007186]	integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; neuron projection [GO:0043005]	carbohydrate binding [GO:0030246]; G protein-coupled receptor activity [GO:0004930]; latrotoxin receptor activity [GO:0016524]	AALPFGLVR	0.94094	0	0	0	0	0	0	0	0	0	0	12.8108	0
Q14CX7	NAA25_HUMAN	"N-alpha-acetyltransferase 25, NatB auxiliary subunit (Mitochondrial distribution and morphology protein 20) (N-terminal acetyltransferase B complex subunit MDM20) (NatB complex subunit MDM20) (N-terminal acetyltransferase B complex subunit NAA25) (p120)"	NAA25 C12orf30 MDM20 NAP1	Homo sapiens (Human)	N-terminal peptidyl-methionine acetylation [GO:0017196]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; NatB complex [GO:0031416]		NQKLSVVR	0.99862	0	0	0	0	0	0	0	0	0	0	12.8108	0
Q8NF91	SYNE1_HUMAN	Nesprin-1 (Enaptin) (KASH domain-containing protein 1) (KASH1) (Myocyte nuclear envelope protein 1) (Myne-1) (Nuclear envelope spectrin repeat protein 1) (Synaptic nuclear envelope protein 1) (Syne-1)	SYNE1 C6orf98 KIAA0796 KIAA1262 KIAA1756 MYNE1	Homo sapiens (Human)	Golgi organization [GO:0007030]; muscle cell differentiation [GO:0042692]; nuclear matrix anchoring at nuclear membrane [GO:0090292]; nucleus organization [GO:0006997]; spermatogenesis [GO:0007283]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; meiotic nuclear membrane microtubule tethering complex [GO:0034993]; nuclear envelope [GO:0005635]; nuclear membrane [GO:0031965]; nuclear outer membrane [GO:0005640]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; P-body [GO:0000932]; postsynaptic membrane [GO:0045211]; sarcomere [GO:0030017]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; cytoskeleton-nuclear membrane anchor activity [GO:0140444]; enzyme binding [GO:0019899]; identical protein binding [GO:0042802]; lamin binding [GO:0005521]; protein homodimerization activity [GO:0042803]; RNA binding [GO:0003723]	LEQHKDLLQNTDAHKR	0.99593	12.797	0	0	0	0	0	0	0	0	0	0	0
O14556	G3PT_HUMAN	"Glyceraldehyde-3-phosphate dehydrogenase, testis-specific (EC 1.2.1.12) (Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2) (GAPDH-2) (Spermatogenic glyceraldehyde-3-phosphate dehydrogenase)"	GAPDHS GAPD2 GAPDH2 GAPDS HSD-35 HSD35	Homo sapiens (Human)	flagellated sperm motility [GO:0030317]; glucose metabolic process [GO:0006006]; glycolytic process [GO:0006096]; positive regulation of glycolytic process [GO:0045821]	cytosol [GO:0005829]; nucleus [GO:0005634]	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity [GO:0004365]; NAD binding [GO:0051287]; NADP binding [GO:0050661]	AGIALNDNFVK	0.58915	0	0	0	0	0	0	0	0	12.6808	0	0	0
Q9NZ01	TECR_HUMAN	"Very-long-chain enoyl-CoA reductase (EC 1.3.1.93) (Synaptic glycoprotein SC2) (Trans-2,3-enoyl-CoA reductase) (TER)"	TECR GPSN2 SC2	Homo sapiens (Human)	fatty acid elongation [GO:0030497]; long-chain fatty-acyl-CoA biosynthetic process [GO:0035338]; sphingolipid metabolic process [GO:0006665]; very long-chain fatty acid biosynthetic process [GO:0042761]	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of endoplasmic reticulum membrane [GO:0030176]; nucleus [GO:0005634]	oxidoreductase activity [GO:0016491]; very-long-chain enoyl-CoA reductase activity [GO:0102758]; very-long-chain-acyl-CoA dehydrogenase activity [GO:0017099]	MPIIPFLL	0.99753	0	0	0	0	0	0	0	0	0	12.6641	0	0
Q15149	PLEC_HUMAN	Plectin (PCN) (PLTN) (Hemidesmosomal protein 1) (HD1) (Plectin-1)	PLEC PLEC1	Homo sapiens (Human)	actin cytoskeleton reorganization [GO:0031532]; actomyosin contractile ring assembly actin filament organization [GO:2000689]; adherens junction organization [GO:0034332]; cardiac muscle cell development [GO:0055013]; cell morphogenesis [GO:0000902]; cellular response to extracellular stimulus [GO:0031668]; cellular response to fluid shear stress [GO:0071498]; cellular response to hydrostatic pressure [GO:0071464]; cellular response to mechanical stimulus [GO:0071260]; establishment of skin barrier [GO:0061436]; fibroblast migration [GO:0010761]; gene expression [GO:0010467]; hemidesmosome assembly [GO:0031581]; intermediate filament cytoskeleton organization [GO:0045104]; intermediate filament organization [GO:0045109]; keratinocyte development [GO:0003334]; leukocyte migration involved in immune response [GO:0002522]; mitochondrion morphogenesis [GO:0070584]; multicellular organism growth [GO:0035264]; myoblast differentiation [GO:0045445]; negative regulation of protein kinase activity [GO:0006469]; nucleus organization [GO:0006997]; peripheral nervous system myelin maintenance [GO:0032287]; protein localization [GO:0008104]; protein-containing complex organization [GO:0043933]; regulation of ATP citrate synthase activity [GO:2000983]; regulation of vascular permeability [GO:0043114]; respiratory electron transport chain [GO:0022904]; response to food [GO:0032094]; sarcomere organization [GO:0045214]; skeletal muscle fiber development [GO:0048741]; skeletal myofibril assembly [GO:0014866]; T cell chemotaxis [GO:0010818]; tight junction organization [GO:0120193]; transmission of nerve impulse [GO:0019226]; wound healing [GO:0042060]	axon [GO:0030424]; brush border [GO:0005903]; costamere [GO:0043034]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; hemidesmosome [GO:0030056]; intermediate filament cytoskeleton [GO:0045111]; membrane [GO:0016020]; mitochondrial outer membrane [GO:0005741]; myelin sheath [GO:0043209]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; sarcolemma [GO:0042383]; sarcoplasm [GO:0016528]; Z disc [GO:0030018]	actin filament binding [GO:0051015]; ankyrin binding [GO:0030506]; cadherin binding [GO:0045296]; dystroglycan binding [GO:0002162]; protein self-association [GO:0043621]; RNA binding [GO:0003723]; structural constituent of cytoskeleton [GO:0005200]; structural constituent of muscle [GO:0008307]; structural molecule activity [GO:0005198]	LVASMEEAR	0.99906	0	12.6304	0	0	0	0	0	0	0	0	0	0
Q15208	STK38_HUMAN	Serine/threonine-protein kinase 38 (EC 2.7.11.1) (NDR1 protein kinase) (Nuclear Dbf2-related kinase 1)	STK38 NDR1	Homo sapiens (Human)	intracellular signal transduction [GO:0035556]; negative regulation of MAP kinase activity [GO:0043407]; peptidyl-serine phosphorylation [GO:0018105]; protein modification process [GO:0036211]; protein phosphorylation [GO:0006468]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleus [GO:0005634]	ATP binding [GO:0005524]; cadherin binding [GO:0045296]; magnesium ion binding [GO:0000287]; mitogen-activated protein kinase kinase kinase binding [GO:0031435]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	RSAHARK	0.67442	0	0	0	0	12.6046	0	0	0	0	0	0	0
O14966	RAB7L_HUMAN	Ras-related protein Rab-7L1 (Rab-7-like protein 1) (Ras-related protein Rab-29)	RAB29 RAB7L1	Homo sapiens (Human)	"cell differentiation [GO:0030154]; Golgi organization [GO:0007030]; intracellular protein transport [GO:0006886]; melanosome organization [GO:0032438]; mitochondrion organization [GO:0007005]; modulation by host of viral process [GO:0044788]; negative regulation of neuron projection development [GO:0010977]; positive regulation of intracellular protein transport [GO:0090316]; positive regulation of receptor recycling [GO:0001921]; positive regulation of T cell receptor signaling pathway [GO:0050862]; protein localization to ciliary membrane [GO:1903441]; protein localization to membrane [GO:0072657]; regulation of neuron death [GO:1901214]; regulation of retrograde transport, endosome to Golgi [GO:1905279]; response to bacterium [GO:0009617]; retrograde transport, endosome to Golgi [GO:0042147]; synapse assembly [GO:0007416]; T cell activation [GO:0042110]; toxin transport [GO:1901998]"	cis-Golgi network [GO:0005801]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; early endosome [GO:0005769]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; intracellular vesicle [GO:0097708]; melanosome [GO:0042470]; mitochondrion [GO:0005739]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]; trans-Golgi network [GO:0005802]; vacuole [GO:0005773]	dynein complex binding [GO:0070840]; GDP binding [GO:0019003]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; kinesin binding [GO:0019894]; small GTPase binding [GO:0031267]	DHLFKVLVVGDAAVGK	0.34783	0	0	0	0	0	0	0	0	12.5589	0	0	0
Q2TAC2	CCD57_HUMAN	Coiled-coil domain-containing protein 57	CCDC57	Homo sapiens (Human)	centriole replication [GO:0007099]; cilium assembly [GO:0060271]; G2/M transition of mitotic cell cycle [GO:0000086]; microtubule nucleation [GO:0007020]; positive regulation of mitotic cell cycle [GO:0045931]	centriolar satellite [GO:0034451]; centriole [GO:0005814]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; spindle microtubule [GO:0005876]		HQPRSAQVGSRLDALQGPK	0.49468	0	0	0	0	0	0	12.4504	0	0	0	0	0
Q99848	EBP2_HUMAN	Probable rRNA-processing protein EBP2 (EBNA1-binding protein 2) (Nucleolar protein p40)	EBNA1BP2 EBP2	Homo sapiens (Human)	ribosomal large subunit biogenesis [GO:0042273]; rRNA processing [GO:0006364]	"chromosome [GO:0005694]; nuclear periphery [GO:0034399]; nucleolus [GO:0005730]; preribosome, large subunit precursor [GO:0030687]"	RNA binding [GO:0003723]	RPGKRTR	0.93958	0	0	0	0	0	0	0	0	0	12.4393	0	0
Q5T1R4	ZEP3_HUMAN	Transcription factor HIVEP3 (Human immunodeficiency virus type I enhancer-binding protein 3) (Kappa-B and V(D)J recombination signal sequences-binding protein) (Kappa-binding protein 1) (KBP-1) (Zinc finger protein ZAS3)	HIVEP3 KBP1 KIAA1555 KRC ZAS3	Homo sapiens (Human)	positive regulation of DNA-templated transcription [GO:0045893]; regulation of transcription by RNA polymerase II [GO:0006357]; skeletal muscle cell differentiation [GO:0035914]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	LVPSSSR	0.92801	12.4351	0	0	0	0	0	0	0	0	0	0	0
P51878	CASP5_HUMAN	Caspase-5 (CASP-5) (EC 3.4.22.58) (ICE(rel)-III) (Protease ICH-3) (Protease TY) [Cleaved into: Caspase-5 subunit p20; Caspase-5 subunit p10]	CASP5 ICH3	Homo sapiens (Human)	apoptotic process [GO:0006915]; cellular response to mechanical stimulus [GO:0071260]; proteolysis [GO:0006508]; regulation of apoptotic process [GO:0042981]; regulation of inflammatory response [GO:0050727]; substantia nigra development [GO:0021762]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; NLRP1 inflammasome complex [GO:0072558]	cysteine-type endopeptidase activity [GO:0004197]; cysteine-type endopeptidase activity involved in apoptotic signaling pathway [GO:0097199]; cysteine-type peptidase activity [GO:0008234]	FDHLPAR	0.94901	12.4315	0	0	0	0	0	0	0	0	0	0	0
Q8NDW4	ZN248_HUMAN	Zinc finger protein 248	ZNF248	Homo sapiens (Human)	negative regulation of transcription by RNA polymerase II [GO:0000122]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; metal ion binding [GO:0046872]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	GFPSQCHPERK	0.93309	12.4015	0	0	0	0	0	0	0	0	0	0	0
P50993	AT1A2_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-2 (Na(+)/K(+) ATPase alpha-2 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-2)	ATP1A2 KIAA0778	Homo sapiens (Human)	"adult locomotory behavior [GO:0008344]; amygdala development [GO:0021764]; ATP metabolic process [GO:0046034]; behavioral fear response [GO:0001662]; cardiac muscle contraction [GO:0060048]; cation transmembrane transport [GO:0098655]; cell communication by electrical coupling involved in cardiac conduction [GO:0086064]; cellular potassium ion homeostasis [GO:0030007]; cellular response to mechanical stimulus [GO:0071260]; cellular response to steroid hormone stimulus [GO:0071383]; cellular sodium ion homeostasis [GO:0006883]; locomotion [GO:0040011]; locomotory exploration behavior [GO:0035641]; membrane depolarization during cardiac muscle cell action potential [GO:0086012]; membrane repolarization [GO:0086009]; negative regulation of calcium ion transmembrane transport [GO:1903170]; negative regulation of calcium:sodium antiporter activity [GO:1903280]; negative regulation of cytosolic calcium ion concentration [GO:0051481]; negative regulation of heart contraction [GO:0045822]; negative regulation of striated muscle contraction [GO:0045988]; neurotransmitter uptake [GO:0001504]; olfactory cortex development [GO:0021989]; positive regulation of heart contraction [GO:0045823]; potassium ion import across plasma membrane [GO:1990573]; potassium ion transmembrane transport [GO:0071805]; potassium ion transport [GO:0006813]; proton transmembrane transport [GO:1902600]; regulation of blood pressure [GO:0008217]; regulation of cardiac muscle cell contraction [GO:0086004]; regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion [GO:0010881]; regulation of glutamate uptake involved in transmission of nerve impulse [GO:0051946]; regulation of muscle contraction [GO:0006937]; regulation of respiratory gaseous exchange by nervous system process [GO:0002087]; regulation of smooth muscle contraction [GO:0006940]; regulation of striated muscle contraction [GO:0006942]; regulation of synaptic transmission, glutamatergic [GO:0051966]; regulation of the force of heart contraction [GO:0002026]; regulation of vasoconstriction [GO:0019229]; relaxation of cardiac muscle [GO:0055119]; response to auditory stimulus [GO:0010996]; response to glycoside [GO:1903416]; response to nicotine [GO:0035094]; sodium ion export across plasma membrane [GO:0036376]; sodium ion transmembrane transport [GO:0035725]; sodium ion transport [GO:0006814]; transport across blood-brain barrier [GO:0150104]; visual learning [GO:0008542]"	caveola [GO:0005901]; cell projection [GO:0042995]; cytoplasm [GO:0005737]; dendritic spine [GO:0043197]; endosome [GO:0005768]; extracellular vesicle [GO:1903561]; intercalated disc [GO:0014704]; membrane [GO:0016020]; neuronal cell body [GO:0043025]; organelle membrane [GO:0031090]; plasma membrane [GO:0005886]; sodium:potassium-exchanging ATPase complex [GO:0005890]; T-tubule [GO:0030315]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATPase-coupled cation transmembrane transporter activity [GO:0019829]; chaperone binding [GO:0051087]; P-type sodium:potassium-exchanging transporter activity [GO:0005391]; phosphatase activity [GO:0016791]; potassium ion binding [GO:0030955]; protein heterodimerization activity [GO:0046982]; sodium ion binding [GO:0031402]; steroid binding [GO:0005496]; steroid hormone binding [GO:1990239]	LNIPMSQVNPR	0.90175	0	0	0	0	0	0	12.3761	0	0	0	0	0
Q07864	DPOE1_HUMAN	DNA polymerase epsilon catalytic subunit A (EC 2.7.7.7) (3'-5' exodeoxyribonuclease) (EC 3.1.11.-) (DNA polymerase II subunit A)	POLE POLE1	Homo sapiens (Human)	"base-excision repair, gap-filling [GO:0006287]; DNA replication [GO:0006260]; DNA replication proofreading [GO:0045004]; DNA synthesis involved in DNA repair [GO:0000731]; DNA-templated DNA replication [GO:0006261]; embryonic organ development [GO:0048568]; G1/S transition of mitotic cell cycle [GO:0000082]; leading strand elongation [GO:0006272]; mitotic cell cycle [GO:0000278]; nucleotide-excision repair, DNA gap filling [GO:0006297]"	epsilon DNA polymerase complex [GO:0008622]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	"4 iron, 4 sulfur cluster binding [GO:0051539]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; nucleotide binding [GO:0000166]; single-stranded DNA 3'-5' exodeoxyribonuclease activity [GO:0008310]; zinc ion binding [GO:0008270]"	LADYCRKAYK	0.94324	12.3423	0	0	0	0	0	0	0	0	0	0	0
O75167	PHAR2_HUMAN	Phosphatase and actin regulator 2	PHACTR2 C6orf56 KIAA0680	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]	plasma membrane [GO:0005886]; platelet alpha granule membrane [GO:0031092]	actin binding [GO:0003779]; protein phosphatase inhibitor activity [GO:0004864]	LGNRPSKK	0.99902	0	0	0	0	0	0	0	0	0	0	0	12.3165
P31629	ZEP2_HUMAN	Transcription factor HIVEP2 (Human immunodeficiency virus type I enhancer-binding protein 2) (HIV-EP2) (MHC-binding protein 2) (MBP-2)	HIVEP2	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	LDVKMFEDPVSQLIPSK	0.86874	0	0	0	0	0	0	0	0	0	0	12.2831	0
Q96QE3	ATAD5_HUMAN	ATPase family AAA domain-containing protein 5 (Chromosome fragility-associated gene 1 protein)	ATAD5 C17orf41 Elg1 FRAG1	Homo sapiens (Human)	cell population proliferation [GO:0008283]; intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [GO:0042771]; isotype switching [GO:0045190]; negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [GO:1902166]; nuclear DNA replication [GO:0033260]; nucleic acid phosphodiester bond hydrolysis [GO:0090305]; positive regulation of B cell proliferation [GO:0030890]; positive regulation of cell cycle G2/M phase transition [GO:1902751]; positive regulation of DNA replication [GO:0045740]; positive regulation of isotype switching to IgG isotypes [GO:0048304]; regulation of mitotic cell cycle phase transition [GO:1901990]; signal transduction in response to DNA damage [GO:0042770]	Elg1 RFC-like complex [GO:0031391]; nucleus [GO:0005634]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; DNA binding [GO:0003677]; DNA clamp unloader activity [GO:0061860]	AESEASLLNVSTPKSTRR	0.94024	0	0	0	0	0	0	0	0	0	0	12.2831	0
Q8TC26	TM163_HUMAN	Transmembrane protein 163	TMEM163	Homo sapiens (Human)	zinc ion import into synaptic vesicle [GO:0099180]	anchoring junction [GO:0070161]; early endosome membrane [GO:0031901]; integral component of synaptic vesicle membrane [GO:0030285]; membrane [GO:0016020]	zinc ion binding [GO:0008270]	LKPHEAQNYRKK	0.95975	0	12.2512	0	0	0	0	0	0	0	0	0	0
Q16649	NFIL3_HUMAN	Nuclear factor interleukin-3-regulated protein (E4 promoter-binding protein 4) (Interleukin-3 promoter transcriptional activator) (Interleukin-3-binding protein 1) (Transcriptional activator NF-IL3A)	NFIL3 E4BP4 IL3BP1	Homo sapiens (Human)	cellular response to interleukin-4 [GO:0071353]; circadian rhythm [GO:0007623]; immune response [GO:0006955]; natural killer cell differentiation [GO:0001779]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of gene expression [GO:0010628]; regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase II [GO:0006357]; transcription by RNA polymerase II [GO:0006366]	chromatin [GO:0000785]; nucleus [GO:0005634]; RNA polymerase II transcription regulator complex [GO:0090575]	"DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; identical protein binding [GO:0042802]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	KREFIPDEK	0.86189	0	0	0	0	0	0	0	0	0	12.1876	0	0
Q6ZTA4	TRI67_HUMAN	Tripartite motif-containing protein 67 (TRIM9-like protein)	TRIM67 TNL	Homo sapiens (Human)	negative regulation of Ras protein signal transduction [GO:0046580]; positive regulation of neuron projection development [GO:0010976]; positive regulation of ubiquitin-dependent protein catabolic process [GO:2000060]; regulation of protein localization [GO:0032880]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	zinc ion binding [GO:0008270]	CRVPPVPLLQLEKCCTR	0.99906	0	12.1396	0	0	0	0	0	0	0	0	0	0
Q14444	CAPR1_HUMAN	Caprin-1 (Cell cycle-associated protein 1) (Cytoplasmic activation- and proliferation-associated protein 1) (GPI-anchored membrane protein 1) (GPI-anchored protein p137) (GPI-p137) (p137GPI) (Membrane component chromosome 11 surface marker 1) (RNA granule protein 105)	CAPRIN1 GPIAP1 GPIP137 M11S1 RNG105	Homo sapiens (Human)	cell differentiation [GO:0030154]; negative regulation of translation [GO:0017148]; positive regulation of dendrite morphogenesis [GO:0050775]; positive regulation of dendritic spine morphogenesis [GO:0061003]	cell leading edge [GO:0031252]; cytoplasm [GO:0005737]; cytoplasmic stress granule [GO:0010494]; cytosol [GO:0005829]; dendrite [GO:0030425]; glutamatergic synapse [GO:0098978]; lamellipodium [GO:0030027]; membrane [GO:0016020]; P-body [GO:0000932]; postsynapse [GO:0098794]	RNA binding [GO:0003723]	GGSRGAR	0.76	0	0	0	0	12.1302	0	0	0	0	0	0	0
Q9NR28	DBLOH_HUMAN	"Diablo IAP-binding mitochondrial protein (Diablo homolog, mitochondrial) (Direct IAP-binding protein with low pI) (Second mitochondria-derived activator of caspase) (Smac)"	DIABLO SMAC	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c [GO:0008635]; apoptotic process [GO:0006915]; extrinsic apoptotic signaling pathway via death domain receptors [GO:0008625]; intrinsic apoptotic signaling pathway [GO:0097193]; intrinsic apoptotic signaling pathway in response to oxidative stress [GO:0008631]; neuron apoptotic process [GO:0051402]; positive regulation of apoptotic process [GO:0043065]	CD40 receptor complex [GO:0035631]; cytoplasmic side of plasma membrane [GO:0009898]; cytosol [GO:0005829]; mitochondrial intermembrane space [GO:0005758]; mitochondrion [GO:0005739]		AVYTLTSLYR	0.94277	0	0	12.114	0	0	0	0	0	0	0	0	0
P78559	MAP1A_HUMAN	Microtubule-associated protein 1A (MAP-1A) (Proliferation-related protein p80) [Cleaved into: MAP1A heavy chain; MAP1 light chain LC2]	MAP1A MAP1L	Homo sapiens (Human)	anterograde axonal protein transport [GO:0099641]; associative learning [GO:0008306]; axonogenesis [GO:0007409]; dendrite development [GO:0016358]; memory [GO:0007613]; microtubule cytoskeleton organization [GO:0000226]; negative regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032435]; negative regulation of protein localization to microtubule [GO:1902817]; neuron cellular homeostasis [GO:0070050]; neuron projection maintenance [GO:1990535]; positive regulation of protein localization [GO:1903829]; positive regulation of protein localization to cell surface [GO:2000010]; regulation of microtubule depolymerization [GO:0031114]; regulation of synaptic plasticity [GO:0048167]; retrograde axonal protein transport [GO:0099642]; voluntary musculoskeletal movement [GO:0050882]	axon [GO:0030424]; axon cytoplasm [GO:1904115]; axon initial segment [GO:0043194]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; dendritic branch [GO:0044307]; dendritic microtubule [GO:1901588]; dendritic shaft [GO:0043198]; microtubule [GO:0005874]; microtubule associated complex [GO:0005875]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; primary dendrite [GO:0150001]; synapse [GO:0045202]	actin binding [GO:0003779]; cytoskeletal anchor activity [GO:0008093]; microtubule binding [GO:0008017]; structural molecule activity [GO:0005198]; tau protein binding [GO:0048156]; tubulin binding [GO:0015631]	EPEPKDEVLQQK	0.99757	0	0	0	0	11.9778	0	0	0	0	0	0	0
P11171	EPB41_HUMAN	Protein 4.1 (P4.1) (4.1R) (Band 4.1) (EPB4.1) (Erythrocyte membrane protein band 4.1)	EPB41 E41P	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; actomyosin structure organization [GO:0031032]; cell cycle [GO:0007049]; cell division [GO:0051301]; cortical actin cytoskeleton organization [GO:0030866]; positive regulation of protein binding [GO:0032092]; positive regulation of protein localization to cell cortex [GO:1904778]; regulation of calcium ion transport [GO:0051924]; regulation of cell shape [GO:0008360]; regulation of intestinal absorption [GO:1904478]	basolateral plasma membrane [GO:0016323]; cell cortex [GO:0005938]; cell junction [GO:0030054]; cortical cytoskeleton [GO:0030863]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; intercellular bridge [GO:0045171]; mitotic spindle [GO:0072686]; nuclear body [GO:0016604]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; spectrin-associated cytoskeleton [GO:0014731]	1-phosphatidylinositol binding [GO:0005545]; actin binding [GO:0003779]; calmodulin binding [GO:0005516]; phosphoprotein binding [GO:0051219]; protein C-terminus binding [GO:0008022]; protein N-terminus binding [GO:0047485]; spectrin binding [GO:0030507]; structural constituent of cytoskeleton [GO:0005200]	TVVPKAQK	0.99545	0	0	0	0	0	11.9704	0	0	0	0	0	0
Q504T8	MIDN_HUMAN	Midnolin (Midbrain nucleolar protein)	MIDN	Homo sapiens (Human)	negative regulation of glucokinase activity [GO:0033132]; negative regulation of insulin secretion [GO:0046676]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleolus [GO:0005730]; nucleus [GO:0005634]	kinase binding [GO:0019900]	SPLTLALR	0.92109	0	0	0	0	0	11.9704	0	0	0	0	0	0
Q8NEV8	EXPH5_HUMAN	Exophilin-5 (Synaptotagmin-like protein homolog lacking C2 domains b) (SlaC2-b) (Slp homolog lacking C2 domains b)	EXPH5 KIAA0624 SLAC2B	Homo sapiens (Human)	intracellular protein transport [GO:0006886]; keratinocyte development [GO:0003334]; multivesicular body sorting pathway [GO:0071985]; positive regulation of exocytosis [GO:0045921]; positive regulation of protein secretion [GO:0050714]	endosome [GO:0005768]	small GTPase binding [GO:0031267]	ILQVLER	0.87321	0	0	0	0	0	11.9704	0	0	0	0	0	0
Q6P9B6	MEAK7_HUMAN	"MTOR-associated protein MEAK7 (MEAK7) (MTOR associated protein, eak-7 homolog) (TBC/LysM-associated domain-containing protein 1) (TLD domain-containing protein 1)"	MEAK7 KIAA1609 TLDC1	Homo sapiens (Human)	negative regulation of oxidative stress-induced neuron death [GO:1903204]; positive regulation of protein localization to lysosome [GO:0150032]; regulation of cell migration [GO:0030334]; regulation of cell population proliferation [GO:0042127]; response to amino acid [GO:0043200]; response to insulin [GO:0032868]; response to nutrient levels [GO:0031667]; TOR signaling [GO:0031929]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]		RVDLTGKAK	0.95775	0	0	0	0	0	0	0	0	0	0	11.9642	0
Q86YR7	MF2L2_HUMAN	Probable guanine nucleotide exchange factor MCF2L2 (Dbs-related Rho family guanine nucleotide exchange factor) (MCF2-transforming sequence-like protein 2)	MCF2L2 DRG KIAA0861	Homo sapiens (Human)		cytoplasm [GO:0005737]	guanyl-nucleotide exchange factor activity [GO:0005085]	AGASTGR	0.53555	0	0	0	0	0	0	0	0	0	0	11.9642	0
Q8WWK9	CKAP2_HUMAN	Cytoskeleton-associated protein 2 (CTCL tumor antigen se20-10) (Tumor- and microtubule-associated protein)	CKAP2 LB1 TMAP	Homo sapiens (Human)	apoptotic process [GO:0006915]; mitotic cytokinesis [GO:0000281]; negative regulation of microtubule depolymerization [GO:0007026]; positive regulation of transcription by RNA polymerase II [GO:0045944]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; microtubule [GO:0005874]; microtubule cytoskeleton [GO:0015630]; mitotic spindle [GO:0072686]; spindle pole [GO:0000922]		LQEKTSK	0.99799	0	0	11.9382	0	0	0	0	0	0	0	0	0
P51170	SCNNG_HUMAN	Amiloride-sensitive sodium channel subunit gamma (Epithelial Na(+) channel subunit gamma) (ENaCG) (Gamma-ENaC) (Gamma-NaCH) (Nonvoltage-gated sodium channel 1 subunit gamma) (SCNEG)	SCNN1G	Homo sapiens (Human)	cellular response to acidic pH [GO:0071468]; cellular response to aldosterone [GO:1904045]; cellular response to amiloride [GO:0036254]; cellular response to vasopressin [GO:1904117]; cellular sodium ion homeostasis [GO:0006883]; multicellular organismal water homeostasis [GO:0050891]; regulation of blood pressure [GO:0008217]; sensory perception of salty taste [GO:0050914]; sensory perception of sour taste [GO:0050915]; sodium ion homeostasis [GO:0055078]; sodium ion import across plasma membrane [GO:0098719]; sodium ion transmembrane transport [GO:0035725]; sodium ion transport [GO:0006814]	apical plasma membrane [GO:0016324]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; integral component of plasma membrane [GO:0005887]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; sodium channel complex [GO:0034706]	ion channel activity [GO:0005216]; ligand-gated sodium channel activity [GO:0015280]; sodium channel activity [GO:0005272]; WW domain binding [GO:0050699]	QPRFSHR	0.99693	0	11.9236	0	0	0	0	0	0	0	0	0	0
P46100	ATRX_HUMAN	Transcriptional regulator ATRX (EC 3.6.4.12) (ATP-dependent helicase ATRX) (X-linked helicase II) (X-linked nuclear protein) (XNP) (Znf-HX)	ATRX RAD54L XH2	Homo sapiens (Human)	"cellular response to hydroxyurea [GO:0072711]; chromatin remodeling [GO:0006338]; chromosome organization involved in meiotic cell cycle [GO:0070192]; DNA damage response, signal transduction by p53 class mediator [GO:0030330]; DNA methylation [GO:0006306]; DNA repair [GO:0006281]; DNA replication-independent chromatin assembly [GO:0006336]; forebrain development [GO:0030900]; meiotic spindle organization [GO:0000212]; multicellular organism growth [GO:0035264]; negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric [GO:1904908]; negative regulation of telomeric RNA transcription from RNA pol II promoter [GO:1901581]; nucleosome assembly [GO:0006334]; positive regulation of nuclear cell cycle DNA replication [GO:0010571]; positive regulation of telomere maintenance [GO:0032206]; positive regulation of telomeric RNA transcription from RNA pol II promoter [GO:1901582]; positive regulation of transcription by RNA polymerase II [GO:0045944]; post-embryonic forelimb morphogenesis [GO:0035128]; protein localization to chromosome, telomeric region [GO:0070198]; regulation of DNA-templated transcription [GO:0006355]; regulation of histone H3-K9 trimethylation [GO:1900112]; replication fork processing [GO:0031297]; seminiferous tubule development [GO:0072520]; Sertoli cell development [GO:0060009]; spermatogenesis [GO:0007283]; transcription by RNA polymerase II [GO:0006366]"	"chromosome, subtelomeric region [GO:0099115]; chromosome, telomeric region [GO:0000781]; condensed chromosome, centromeric region [GO:0000779]; heterochromatin [GO:0000792]; nuclear body [GO:0016604]; nuclear chromosome [GO:0000228]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; pericentric heterochromatin [GO:0005721]; PML body [GO:0016605]"	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent chromatin remodeler activity [GO:0140658]; chromatin binding [GO:0003682]; chromatin DNA binding [GO:0031490]; chromo shadow domain binding [GO:0070087]; DNA helicase activity [GO:0003678]; DNA translocase activity [GO:0015616]; histone binding [GO:0042393]; metal ion binding [GO:0046872]; methylated histone binding [GO:0035064]	IQPLEDIISAVWK	0.92008	0	0	11.8932	0	0	0	0	0	0	0	0	0
Q9P2D7	DYH1_HUMAN	Dynein axonemal heavy chain 1 (Axonemal beta dynein heavy chain 1) (Ciliary dynein heavy chain 1) (Heat shock regulated protein 1) (HSRF-1) (hDHC7)	DNAH1 DHC7 DNAHC1 KIAA1410	Homo sapiens (Human)	cilium movement [GO:0003341]; cilium-dependent cell motility [GO:0060285]; epithelial cilium movement involved in extracellular fluid movement [GO:0003351]; flagellated sperm motility [GO:0030317]; inner dynein arm assembly [GO:0036159]; microtubule-based movement [GO:0007018]; sperm axoneme assembly [GO:0007288]	axonemal dynein complex [GO:0005858]; axoneme [GO:0005930]; dynein complex [GO:0030286]; extracellular region [GO:0005576]; inner dynein arm [GO:0036156]; microtubule [GO:0005874]; sperm flagellum [GO:0036126]	ATP binding [GO:0005524]; dynein intermediate chain binding [GO:0045505]; dynein light intermediate chain binding [GO:0051959]; microtubule motor activity [GO:0003777]; minus-end-directed microtubule motor activity [GO:0008569]	GLSEYLETK	0.41558	0	0	0	11.8482	0	0	0	0	0	0	0	0
Q96F24	NRBF2_HUMAN	Nuclear receptor-binding factor 2 (NRBF-2) (Comodulator of PPAR and RXR)	NRBF2 COPR	Homo sapiens (Human)	autophagy [GO:0006914]; regulation of lipid kinase activity [GO:0043550]; response to endoplasmic reticulum stress [GO:0034976]	"autophagosome [GO:0005776]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; nucleoplasm [GO:0005654]; phosphatidylinositol 3-kinase complex, class III [GO:0035032]"		QLKAEKAR	0.9421	0	0	0	0	0	0	0	11.8167	0	0	0	0
Q8TCY9	URGCP_HUMAN	Up-regulator of cell proliferation (HBV X protein up-regulated gene 4 protein) (HBxAg up-regulated gene 4 protein)	URGCP KIAA1507 URG4	Homo sapiens (Human)	cell cycle [GO:0007049]	cytosol [GO:0005829]; nucleus [GO:0005634]	GTP binding [GO:0005525]	GDIGSHWLQFK	0.9323	0	0	0	0	0	0	11.8001	0	0	0	0	0
Q9UKB3	DJC12_HUMAN	DnaJ homolog subfamily C member 12 (J domain-containing protein 1)	DNAJC12 JDP1	Homo sapiens (Human)		cytoplasm [GO:0005737]		EILTNEESR	0.86838	11.7596	0	0	0	0	0	0	0	0	0	0	0
Q4G0S4	C27C1_HUMAN	"Cytochrome P450 27C1 (EC 1.14.19.53) (All-trans retinol 3,4-desaturase)"	CYP27C1	Homo sapiens (Human)	retinal metabolic process [GO:0042574]; retinoic acid metabolic process [GO:0042573]; retinol metabolic process [GO:0042572]	intracellular membrane-bounded organelle [GO:0043231]; mitochondrial membrane [GO:0031966]; mitochondrion [GO:0005739]	"11-cis retinal binding [GO:0005502]; 11-cis-retinal 3,4-desaturase activity [GO:0061899]; all-trans retinal 3,4-desaturase activity [GO:0061897]; all-trans retinal binding [GO:0005503]; all-trans retinoic acid 3,4-desaturase activity [GO:0061898]; all-trans retinol 3,4-desaturase activity [GO:0061896]; all-trans-retinol binding [GO:1904768]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; retinoic acid binding [GO:0001972]"	SLAAMPGPR	0.94337	11.7184	0	0	0	0	0	0	0	0	0	0	0
Q6P2E9	EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 (Autoantigen Ge-1) (Autoantigen RCD-8) (Human enhancer of decapping large subunit) (Hedls)	EDC4 HEDLS	Homo sapiens (Human)	deadenylation-independent decapping of nuclear-transcribed mRNA [GO:0031087]	cytoplasm [GO:0005737]; cytoplasmic ribonucleoprotein granule [GO:0036464]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; P-body [GO:0000932]		KQDPDVPFWR	0.99882	0	11.6583	0	0	0	0	0	0	0	0	0	0
P78332	RBM6_HUMAN	RNA-binding protein 6 (Lung cancer antigen NY-LU-12) (Protein G16) (RNA-binding motif protein 6) (RNA-binding protein DEF-3)	RBM6 DEF3	Homo sapiens (Human)	"mRNA splicing, via spliceosome [GO:0000398]; RNA processing [GO:0006396]"	nucleus [GO:0005634]	DNA binding [GO:0003677]; RNA binding [GO:0003723]	KPTSQGK	0.93817	0	0	0	0	0	0	0	0	0	0	11.6424	0
Q6F5E8	CARL2_HUMAN	"Capping protein, Arp2/3 and myosin-I linker protein 2 (Capping protein regulator and myosin 1 linker 2) (F-actin-uncapping protein RLTPR) (Leucine-rich repeat-containing protein 16C) (RGD, leucine-rich repeat, tropomodulin and proline-rich-containing protein)"	CARMIL2 LRRC16C RLTPR	Homo sapiens (Human)	"actin filament network formation [GO:0051639]; cell migration [GO:0016477]; establishment or maintenance of cell polarity [GO:0007163]; establishment or maintenance of monopolar cell polarity [GO:0061339]; maintenance of cell polarity [GO:0030011]; negative regulation of barbed-end actin filament capping [GO:2000813]; positive regulation of cell migration [GO:0030335]; positive regulation of extracellular matrix disassembly [GO:0090091]; positive regulation of lamellipodium assembly [GO:0010592]; positive regulation of lamellipodium organization [GO:1902745]; positive regulation of ruffle assembly [GO:1900029]; regulation of actin cytoskeleton reorganization [GO:2000249]; regulation of Arp2/3 complex-mediated actin nucleation [GO:0034315]; wound healing, spreading of cells [GO:0044319]"	actin cytoskeleton [GO:0015629]; cell leading edge [GO:0031252]; cytoplasm [GO:0005737]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]; intermediate filament cytoskeleton [GO:0045111]; lamellipodium [GO:0030027]; macropinosome [GO:0044354]; membrane [GO:0016020]; plasma membrane [GO:0005886]; ruffle [GO:0001726]	phospholipid binding [GO:0005543]; protein-containing complex binding [GO:0044877]	HLGLAGCK	0.84932	0	0	0	0	0	0	0	0	0	11.6338	0	0
Q96LB8	PGRP4_HUMAN	Peptidoglycan recognition protein 4 (Peptidoglycan recognition protein I-beta) (PGLYRPIbeta) (PGRP-I-beta) (Peptidoglycan recognition protein intermediate beta)	PGLYRP4 PGRPIB SBBI67	Homo sapiens (Human)	antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; defense response to Gram-positive bacterium [GO:0050830]; detection of bacterium [GO:0016045]; innate immune response [GO:0045087]; killing of cells of another organism [GO:0031640]; peptidoglycan catabolic process [GO:0009253]	extracellular region [GO:0005576]; membrane [GO:0016020]; protein-containing complex [GO:0032991]	N-acetylmuramoyl-L-alanine amidase activity [GO:0008745]; peptidoglycan binding [GO:0042834]; peptidoglycan immune receptor activity [GO:0016019]; protein heterodimerization activity [GO:0046982]; zinc ion binding [GO:0008270]	ACPGVVPR	0.93621	0	0	0	0	0	0	0	0	0	0	0	11.6332
P48449	LSS_HUMAN	"Lanosterol synthase (EC 5.4.99.7) (2,3-epoxysqualene--lanosterol cyclase) (Oxidosqualene--lanosterol cyclase) (OSC) (hOSC)"	LSS OSC	Homo sapiens (Human)	cholesterol biosynthetic process [GO:0006695]; regulation of protein stability [GO:0031647]; steroid biosynthetic process [GO:0006694]; triterpenoid biosynthetic process [GO:0016104]	endoplasmic reticulum membrane [GO:0005789]; lipid droplet [GO:0005811]; membrane [GO:0016020]	lanosterol synthase activity [GO:0000250]	RRGGPYK	1.0005	0	0	0	0	0	0	0	0	0	0	11.613	0
P59046	NAL12_HUMAN	"NACHT, LRR and PYD domains-containing protein 12 (Monarch-1) (PYRIN-containing APAF1-like protein 7) (Regulated by nitric oxide)"	NLRP12 NALP12 PYPAF7 RNO	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; cellular response to cytokine stimulus [GO:0071345]; dendritic cell migration [GO:0036336]; ERK1 and ERK2 cascade [GO:0070371]; negative regulation of cytokine production [GO:0001818]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; negative regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043124]; negative regulation of inflammatory response [GO:0050728]; negative regulation of interleukin-1 production [GO:0032692]; negative regulation of interleukin-6 production [GO:0032715]; negative regulation of NF-kappaB transcription factor activity [GO:0032088]; negative regulation of NIK/NF-kappaB signaling [GO:1901223]; negative regulation of protein autophosphorylation [GO:0031953]; negative regulation of signal transduction [GO:0009968]; negative regulation of Toll signaling pathway [GO:0045751]; NIK/NF-kappaB signaling [GO:0038061]; positive regulation of inflammatory response [GO:0050729]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of MHC class I biosynthetic process [GO:0045345]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043281]; regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043122]; regulation of inflammatory response [GO:0050727]; regulation of interleukin-18 production [GO:0032661]; signal transduction [GO:0007165]	cytoplasm [GO:0005737]; cytosol [GO:0005829]	ATP binding [GO:0005524]; cysteine-type endopeptidase activator activity involved in apoptotic process [GO:0008656]	SHLEKSLCWK	0.99688	0	0	0	0	0	0	0	11.566	0	0	0	0
E9PAV3	NACAM_HUMAN	"Nascent polypeptide-associated complex subunit alpha, muscle-specific form (Alpha-NAC, muscle-specific form) (skNAC)"	NACA	Homo sapiens (Human)	protein targeting to membrane [GO:0006612]	cytoplasm [GO:0005737]; nascent polypeptide-associated complex [GO:0005854]; nucleus [GO:0005634]	DNA binding [GO:0003677]; unfolded protein binding [GO:0051082]	GGPATPSPK	0.94876	0	0	0	0	0	0	0	11.5474	0	0	0	0
Q0VDD8	DYH14_HUMAN	Dynein axonemal heavy chain 14 (Axonemal beta dynein heavy chain 14) (Ciliary dynein heavy chain 14)	DNAH14 C1orf67	Homo sapiens (Human)	cilium-dependent cell motility [GO:0060285]; microtubule-based movement [GO:0007018]	axonemal dynein complex [GO:0005858]; dynein complex [GO:0030286]; microtubule [GO:0005874]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; dynein intermediate chain binding [GO:0045505]; dynein light intermediate chain binding [GO:0051959]; minus-end-directed microtubule motor activity [GO:0008569]	HSSEELLPK	0.93634	0	0	0	0	0	0	0	11.5474	0	0	0	0
Q86W24	NAL14_HUMAN	"NACHT, LRR and PYD domains-containing protein 14 (Nucleotide-binding oligomerization domain protein 5)"	NLRP14 NALP14 NOD5	Homo sapiens (Human)	cell differentiation [GO:0030154]; regulation of inflammatory response [GO:0050727]; spermatogenesis [GO:0007283]	cytoplasm [GO:0005737]	ATP binding [GO:0005524]	GSDIGDNGVK	0.93833	11.5376	0	0	0	0	0	0	0	0	0	0	0
A8MVW5	HECA2_HUMAN	HEPACAM family member 2 (Mitotic kinetics regulator)	HEPACAM2 MIKI UNQ305/PRO346	Homo sapiens (Human)	cell division [GO:0051301]; centrosome cycle [GO:0007098]	centrosome [GO:0005813]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; midbody [GO:0030496]; mitotic spindle [GO:0072686]; nucleoplasm [GO:0005654]; spindle [GO:0005819]		LAYQWLK	0.8838	0	0	0	0	0	0	0	0	0	0	0	11.5331
Q8WZ84	OR8D1_HUMAN	Olfactory receptor 8D1 (OST004) (Olfactory receptor 8D3) (Olfactory receptor OR11-301) (Olfactory receptor-like protein JCG9)	OR8D1 OR8D3	Homo sapiens (Human)	G protein-coupled receptor signaling pathway [GO:0007186]; sensory perception of smell [GO:0007608]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; odorant binding [GO:0005549]; olfactory receptor activity [GO:0004984]	MLVNFLGK	0.93895	0	0	0	0	0	0	0	0	0	0	0	11.5331
O75751	S22A3_HUMAN	Solute carrier family 22 member 3 (Extraneuronal monoamine transporter) (EMT) (Organic cation transporter 3)	SLC22A3 EMTH OCT3	Homo sapiens (Human)	dopamine uptake [GO:0090494]; epinephrine uptake [GO:0051625]; histamine metabolic process [GO:0001692]; histamine uptake [GO:0051615]; monoamine transport [GO:0015844]; monocarboxylic acid transport [GO:0015718]; neurotransmitter transport [GO:0006836]; norepinephrine uptake [GO:0051620]; organic anion transport [GO:0015711]; organic cation transport [GO:0015695]; purine-containing compound transmembrane transport [GO:0072530]; quaternary ammonium group transport [GO:0015697]; regulation of appetite [GO:0032098]; serotonin uptake [GO:0051610]; toxin transport [GO:1901998]; transport across blood-brain barrier [GO:0150104]; xenobiotic transport [GO:0042908]	integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886]; presynapse [GO:0098793]	monoamine transmembrane transporter activity [GO:0008504]; neurotransmitter transmembrane transporter activity [GO:0005326]; organic anion transmembrane transporter activity [GO:0008514]; organic cation transmembrane transporter activity [GO:0015101]; quaternary ammonium group transmembrane transporter activity [GO:0015651]; toxin transmembrane transporter activity [GO:0019534]	SAPLVPCR	0.93892	0	0	11.5329	0	0	0	0	0	0	0	0	0
P54317	LIPR2_HUMAN	Pancreatic lipase-related protein 2 (PL-RP2) (Cytotoxic T lymphocyte lipase) (Galactolipase) (EC 3.1.1.26) (Triacylglycerol lipase) (EC 3.1.1.3)	PNLIPRP2 PLRP2	Homo sapiens (Human)	galactolipid catabolic process [GO:0019376]; lipid catabolic process [GO:0016042]; lipid digestion [GO:0044241]; phosphatidylcholine catabolic process [GO:0034638]; phospholipid catabolic process [GO:0009395]; triglyceride catabolic process [GO:0019433]; triglyceride metabolic process [GO:0006641]	cytoplasmic vesicle [GO:0031410]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; membrane [GO:0016020]; neuron projection [GO:0043005]	1-18:1-2-16:0-monogalactosyldiacylglycerol lipase activity [GO:0102549]; acylglycerol lipase activity [GO:0047372]; calcium ion binding [GO:0005509]; galactolipase activity [GO:0047714]; lipase activity [GO:0016298]; phospholipase activity [GO:0004620]; triglyceride lipase activity [GO:0004806]	VGHLDFFPNGGK	0.94065	0	0	0	0	0	0	0	0	11.5314	0	0	0
Q96QS6	KPSH2_HUMAN	Serine/threonine-protein kinase H2 (EC 2.7.11.1) (Protein serine kinase H2) (PSK-H2)	PSKH2	Homo sapiens (Human)	protein phosphorylation [GO:0006468]		ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	VEQKTTK	0.99859	0	0	0	0	0	0	0	0	0	11.5128	0	0
Q9UBZ9	REV1_HUMAN	DNA repair protein REV1 (EC 2.7.7.-) (Alpha integrin-binding protein 80) (AIBP80) (Rev1-like terminal deoxycytidyl transferase)	REV1 REV1L	Homo sapiens (Human)	DNA replication [GO:0006260]; error-free translesion synthesis [GO:0070987]; error-prone translesion synthesis [GO:0042276]; response to UV [GO:0009411]	nucleoplasm [GO:0005654]	damaged DNA binding [GO:0003684]; deoxycytidyl transferase activity [GO:0017125]; DNA-directed DNA polymerase activity [GO:0003887]; metal ion binding [GO:0046872]	LHHISMWK	0.93552	11.5112	0	0	0	0	0	0	0	0	0	0	0
Q8ND04	SMG8_HUMAN	Nonsense-mediated mRNA decay factor SMG8 (Amplified in breast cancer gene 2 protein) (Protein smg-8 homolog)	SMG8 ABC2 C17orf71	Homo sapiens (Human)	"nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]; regulation of protein kinase activity [GO:0045859]"	cytosol [GO:0005829]		FMCSGPDK	0.8683	0	0	11.5068	0	0	0	0	0	0	0	0	0
Q6ZN17	LN28B_HUMAN	Protein lin-28 homolog B (Lin-28B)	LIN28B CSDD2	Homo sapiens (Human)	miRNA catabolic process [GO:0010587]; negative regulation of pre-miRNA processing [GO:2000632]; negative regulation of primary miRNA processing [GO:2000635]; positive regulation of miRNA catabolic process [GO:2000627]; pre-miRNA processing [GO:0031054]; RNA 3'-end processing [GO:0031123]; RNA destabilization [GO:0050779]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	mRNA binding [GO:0003729]; RNA binding [GO:0003723]; sequence-specific double-stranded DNA binding [GO:1990837]; zinc ion binding [GO:0008270]	KGPSVQKR	0.94156	0	0	0	0	11.4973	0	0	0	0	0	0	0
P0DO97	CC192_HUMAN	Coiled-coil domain-containing protein 192	CCDC192 LINC01183	Homo sapiens (Human)				LEAVDHK	0.89951	0	0	0	0	0	0	11.4873	0	0	0	0	0
Q9NTK5	OLA1_HUMAN	Obg-like ATPase 1 (DNA damage-regulated overexpressed in cancer 45) (DOC45) (GTP-binding protein 9)	OLA1 GTPBP9 PRO2455 PTD004	Homo sapiens (Human)	ATP metabolic process [GO:0046034]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; membrane [GO:0016020]; nucleolus [GO:0005730]; platelet alpha granule lumen [GO:0031093]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cadherin binding [GO:0045296]; GTP binding [GO:0005525]; metal ion binding [GO:0046872]; ribosomal large subunit binding [GO:0043023]; ribosome binding [GO:0043022]	VPVPDER	0.9313	0	0	0	0	0	0	11.4873	0	0	0	0	0
O15072	ATS3_HUMAN	A disintegrin and metalloproteinase with thrombospondin motifs 3 (ADAM-TS 3) (ADAM-TS3) (ADAMTS-3) (EC 3.4.24.-) (Procollagen II N-proteinase) (PC II-NP) (Procollagen II amino propeptide-processing enzyme)	ADAMTS3 KIAA0366	Homo sapiens (Human)	collagen biosynthetic process [GO:0032964]; collagen catabolic process [GO:0030574]; collagen fibril organization [GO:0030199]; extracellular matrix organization [GO:0030198]; in utero embryonic development [GO:0001701]; positive regulation of vascular endothelial growth factor signaling pathway [GO:1900748]; protein processing [GO:0016485]; supramolecular fiber organization [GO:0097435]; vascular endothelial growth factor production [GO:0010573]	extracellular exosome [GO:0070062]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]	endopeptidase activity [GO:0004175]; heparin binding [GO:0008201]; metalloendopeptidase activity [GO:0004222]; zinc ion binding [GO:0008270]	VPCPAQWK	0.9184	0	0	0	0	11.4734	0	0	0	0	0	0	0
Q08174	PCDH1_HUMAN	Protocadherin-1 (Cadherin-like protein 1) (Protocadherin-42) (PC42)	PCDH1	Homo sapiens (Human)	cell adhesion [GO:0007155]; cell-cell signaling [GO:0007267]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; nervous system development [GO:0007399]	cell junction [GO:0030054]; cell-cell junction [GO:0005911]; integral component of plasma membrane [GO:0005887]; intracellular membrane-bounded organelle [GO:0043231]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]	QASETGSDSKKK	0.89447	0	0	11.4277	0	0	0	0	0	0	0	0	0
Q6PHR2	ULK3_HUMAN	Serine/threonine-protein kinase ULK3 (EC 2.7.11.1) (Unc-51-like kinase 3)	ULK3	Homo sapiens (Human)	autophagosome organization [GO:1905037]; autophagy [GO:0006914]; cellular senescence [GO:0090398]; fibroblast activation [GO:0072537]; negative regulation of smoothened signaling pathway [GO:0045879]; peptidyl-serine phosphorylation [GO:0018105]; positive regulation of smoothened signaling pathway [GO:0045880]; protein autophosphorylation [GO:0046777]; smoothened signaling pathway [GO:0007224]	autophagosome [GO:0005776]; ciliary tip [GO:0097542]; cytoplasm [GO:0005737]; phagophore assembly site [GO:0000407]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	LGSGTYATVYKAYAK	0.99978	0	0	0	0	0	0	0	11.4004	0	0	0	0
P00540	MOS_HUMAN	Proto-oncogene serine/threonine-protein kinase mos (EC 2.7.11.1) (Oocyte maturation factor mos) (Proto-oncogene c-Mos)	MOS	Homo sapiens (Human)	chromatin organization [GO:0006325]; establishment of meiotic spindle orientation [GO:0051296]; MAPK cascade [GO:0000165]; meiotic spindle organization [GO:0000212]; negative regulation of metaphase/anaphase transition of meiotic cell cycle [GO:1902103]; positive regulation of MAPK cascade [GO:0043410]; protein autophosphorylation [GO:0046777]; regulation of meiotic nuclear division [GO:0040020]; signal transduction [GO:0007165]	cytoplasm [GO:0005737]; cytosol [GO:0005829]	ATP binding [GO:0005524]; MAP kinase kinase kinase activity [GO:0004709]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	LGAGGFGSVYKATYR	0.86944	0	11.3897	0	0	0	0	0	0	0	0	0	0
Q5T0N5	FBP1L_HUMAN	Formin-binding protein 1-like (Transducer of Cdc42-dependent actin assembly protein 1) (Toca-1)	FNBP1L C1orf39 TOCA1	Homo sapiens (Human)	autophagy [GO:0006914]; cilium assembly [GO:0060271]; clathrin-dependent endocytosis [GO:0072583]; membrane invagination [GO:0010324]; plasma membrane tubulation [GO:0097320]; positive regulation of filopodium assembly [GO:0051491]; signal transduction [GO:0007165]; vesicle budding from membrane [GO:0006900]; vesicle organization [GO:0016050]; vesicle transport along actin filament [GO:0030050]	cell cortex [GO:0005938]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; plasma membrane [GO:0005886]	cadherin binding [GO:0045296]; GTPase binding [GO:0051020]; lipid binding [GO:0008289]	QLQEMDERRTIK	0.93841	0	11.3897	0	0	0	0	0	0	0	0	0	0
Q8N264	RHG24_HUMAN	Rho GTPase-activating protein 24 (Filamin-A-associated RhoGAP) (FilGAP) (RAC1- and CDC42-specific GTPase-activating protein of 72 kDa) (RC-GAP72) (Rho-type GTPase-activating protein 24) (RhoGAP of 73 kDa) (Sarcoma antigen NY-SAR-88) (p73RhoGAP)	ARHGAP24 FILGAP	Homo sapiens (Human)	"activation of GTPase activity [GO:0090630]; angiogenesis [GO:0001525]; cell differentiation [GO:0030154]; negative regulation of Rac protein signal transduction [GO:0035021]; negative regulation of ruffle assembly [GO:1900028]; signal transduction [GO:0007165]; wound healing, spreading of epidermal cells [GO:0035313]"	adherens junction [GO:0005912]; cell projection [GO:0042995]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; focal adhesion [GO:0005925]	GTPase activator activity [GO:0005096]	SPPLMVKK	0.99832	0	0	0	11.3044	0	0	0	0	0	0	0	0
Q9P219	DAPLE_HUMAN	Protein Daple (Coiled-coil domain-containing protein 88C) (Dvl-associating protein with a high frequency of leucine residues) (hDaple) (Hook-related protein 2) (HkRP2)	CCDC88C DAPLE KIAA1509	Homo sapiens (Human)	apical constriction [GO:0003383]; cytoplasmic microtubule organization [GO:0031122]; cytoskeleton-dependent intracellular transport [GO:0030705]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; non-canonical Wnt signaling pathway [GO:0035567]; protein destabilization [GO:0031648]; regulation of protein phosphorylation [GO:0001932]; small GTPase mediated signal transduction [GO:0007264]; stress-activated protein kinase signaling cascade [GO:0031098]	anchoring junction [GO:0070161]; cell junction [GO:0030054]; centrosome [GO:0005813]; cytoplasm [GO:0005737]	dynein light intermediate chain binding [GO:0051959]; frizzled binding [GO:0005109]; G-protein alpha-subunit binding [GO:0001965]; guanyl-nucleotide exchange factor activity [GO:0005085]; identical protein binding [GO:0042802]; microtubule binding [GO:0008017]; PDZ domain binding [GO:0030165]; protein self-association [GO:0043621]	EASTPGR	0.92655	0	0	0	0	0	0	0	0	0	0	0	11.2866
Q8N5I4	DHRSX_HUMAN	Dehydrogenase/reductase SDR family member on chromosome X (EC 1.1.-.-) (DHRSXY) (Short chain dehydrogenase/reductase family 46C member 1) (Short chain dehydrogenase/reductase family 7C member 6)	DHRSX CXorf11 DHRS5X SDR46C1 SDR7C6 UNQ6508/PRO21433	Homo sapiens (Human)	positive regulation of autophagy [GO:0010508]	extracellular region [GO:0005576]	oxidoreductase activity [GO:0016491]	SPLSAAR	0.93635	0	0	0	0	0	0	0	0	0	0	11.2674	0
Q3LI63	KR201_HUMAN	Keratin-associated protein 20-1	KRTAP20-1 KAP20.1	Homo sapiens (Human)		cytosol [GO:0005829]; intermediate filament [GO:0005882]		YWSYGFY	0.93782	0	11.2005	0	0	0	0	0	0	0	0	0	0
O43186	CRX_HUMAN	Cone-rod homeobox protein	CRX CORD2	Homo sapiens (Human)	animal organ morphogenesis [GO:0009887]; cell differentiation [GO:0030154]; nervous system development [GO:0007399]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase II [GO:0006357]; response to stimulus [GO:0050896]; visual perception [GO:0007601]	chromatin [GO:0000785]; nucleus [GO:0005634]; RNA polymerase II transcription regulator complex [GO:0090575]	"DNA-binding transcription activator activity [GO:0001216]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; leucine zipper domain binding [GO:0043522]; nuclear receptor binding [GO:0016922]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; sequence-specific double-stranded DNA binding [GO:1990837]"	QQRQQQK	0.99859	0	0	0	0	0	0	0	0	0	0	11.1844	0
Q6ZSR9	YJ005_HUMAN	Uncharacterized protein FLJ45252		Homo sapiens (Human)				IVSQTNK	0.93296	0	0	0	0	0	0	0	0	11.1647	0	0	0
Q75N90	FBN3_HUMAN	Fibrillin-3 [Cleaved into: Fibrillin-3 C-terminal peptide]	FBN3 KIAA1776	Homo sapiens (Human)	anatomical structure morphogenesis [GO:0009653]	collagen-containing extracellular matrix [GO:0062023]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; microfibril [GO:0001527]	calcium ion binding [GO:0005509]; extracellular matrix structural constituent [GO:0005201]	FHAYCCPGWR	0.93718	0	11.1509	0	0	0	0	0	0	0	0	0	0
Q8TEW0	PARD3_HUMAN	Partitioning defective 3 homolog (PAR-3) (PARD-3) (Atypical PKC isotype-specific-interacting protein) (ASIP) (CTCL tumor antigen se2-5) (PAR3-alpha)	PARD3 PAR3 PAR3A	Homo sapiens (Human)	asymmetric cell division [GO:0008356]; axonogenesis [GO:0007409]; bicellular tight junction assembly [GO:0070830]; cell adhesion [GO:0007155]; cell cycle [GO:0007049]; establishment of cell polarity [GO:0030010]; establishment of centrosome localization [GO:0051660]; establishment of epithelial cell polarity [GO:0090162]; establishment or maintenance of cell polarity [GO:0007163]; establishment or maintenance of epithelial cell apical/basal polarity [GO:0045197]; microtubule cytoskeleton organization [GO:0000226]; myelination in peripheral nervous system [GO:0022011]; negative regulation of peptidyl-threonine phosphorylation [GO:0010801]; positive regulation of myelination [GO:0031643]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]; protein localization [GO:0008104]; protein targeting to membrane [GO:0006612]; protein-containing complex assembly [GO:0065003]	adherens junction [GO:0005912]; apical junction complex [GO:0043296]; apical plasma membrane [GO:0016324]; bicellular tight junction [GO:0005923]; cell cortex [GO:0005938]; cell junction [GO:0030054]; cell-cell junction [GO:0005911]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; endomembrane system [GO:0012505]; internode region of axon [GO:0033269]; PAR polarity complex [GO:0120157]; plasma membrane [GO:0005886]; tight junction [GO:0070160]	"phosphatidylinositol binding [GO:0035091]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547]; phosphatidylinositol-3-phosphate binding [GO:0032266]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]"	DNARSSLSASHPMVGKWLEK	0.93929	11.1478	0	0	0	0	0	0	0	0	0	0	0
Q5UAW9	GP157_HUMAN	G-protein coupled receptor 157	GPR157	Homo sapiens (Human)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; cell surface receptor signaling pathway [GO:0007166]; circadian behavior [GO:0048512]; G protein-coupled receptor signaling pathway [GO:0007186]; positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway [GO:0051482]; radial glial cell differentiation [GO:0060019]	ciliary membrane [GO:0060170]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]	SPAGTPK	0.75942	11.1229	0	0	0	0	0	0	0	0	0	0	0
Q9UBT3	DKK4_HUMAN	Dickkopf-related protein 4 (Dickkopf-4) (Dkk-4) (hDkk-4) [Cleaved into: Dickkopf-related protein 4 short form]	DKK4	Homo sapiens (Human)	negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of hair follicle placode formation [GO:0061170]; negative regulation of Wnt signaling pathway [GO:0030178]; Wnt signaling pathway [GO:0016055]	extracellular space [GO:0005615]	co-receptor binding [GO:0039706]; receptor antagonist activity [GO:0048019]	SQLTSNR	0.99842	11.0888	0	0	0	0	0	0	0	0	0	0	0
Q8WXG1	RSAD2_HUMAN	"Radical S-adenosyl methionine domain-containing protein 2 (EC 4.2.-.-) (Cytomegalovirus-induced gene 5 protein) (Viperin) (Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible)"	RSAD2 CIG5	Homo sapiens (Human)	"CD4-positive, alpha-beta T cell activation [GO:0035710]; CD4-positive, alpha-beta T cell differentiation [GO:0043367]; defense response to virus [GO:0051607]; innate immune response [GO:0045087]; negative regulation of protein secretion [GO:0050709]; negative regulation of viral genome replication [GO:0045071]; positive regulation of immune response [GO:0050778]; positive regulation of T-helper 2 cell cytokine production [GO:2000553]; positive regulation of toll-like receptor 7 signaling pathway [GO:0034157]; positive regulation of toll-like receptor 9 signaling pathway [GO:0034165]; response to virus [GO:0009615]"	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; fibrillar center [GO:0001650]; Golgi apparatus [GO:0005794]; lipid droplet [GO:0005811]; mitochondrial inner membrane [GO:0005743]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]	"4 iron, 4 sulfur cluster binding [GO:0051539]; lyase activity [GO:0016829]; metal ion binding [GO:0046872]; protein self-association [GO:0043621]"	ALNPVRWK	0.99668	0	0	0	0	0	0	11.0623	0	0	0	0	0
Q49AN0	CRY2_HUMAN	Cryptochrome-2	CRY2 KIAA0658	Homo sapiens (Human)	blue light signaling pathway [GO:0009785]; circadian regulation of gene expression [GO:0032922]; circadian rhythm [GO:0007623]; entrainment of circadian clock by photoperiod [GO:0043153]; glucose homeostasis [GO:0042593]; lipid storage [GO:0019915]; negative regulation of circadian rhythm [GO:0042754]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of glucocorticoid receptor signaling pathway [GO:2000323]; negative regulation of glucocorticoid secretion [GO:2000850]; negative regulation of phosphoprotein phosphatase activity [GO:0032515]; negative regulation of transcription by RNA polymerase II [GO:0000122]; protein import into nucleus [GO:0006606]; regulation of circadian rhythm [GO:0042752]; regulation of sodium-dependent phosphate transport [GO:2000118]; response to activity [GO:0014823]; response to insulin [GO:0032868]; response to light stimulus [GO:0009416]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular region [GO:0005576]; mitochondrion [GO:0005739]; nuclear speck [GO:0016607]; nucleus [GO:0005634]	blue light photoreceptor activity [GO:0009882]; damaged DNA binding [GO:0003684]; DNA binding [GO:0003677]; FAD binding [GO:0071949]; nuclear receptor binding [GO:0016922]; phosphatase binding [GO:0019902]; protein kinase binding [GO:0019901]; single-stranded DNA binding [GO:0003697]; transcription cis-regulatory region binding [GO:0000976]	LWDLYKK	0.99926	0	11.0592	0	0	0	0	0	0	0	0	0	0
Q96PQ6	ZN317_HUMAN	Zinc finger protein 317	ZNF317 KIAA1588	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	LFVSSVWK	0.93718	0	11.0592	0	0	0	0	0	0	0	0	0	0
Q69YN4	VIR_HUMAN	Protein virilizer homolog	VIRMA KIAA1429 MSTP054	Homo sapiens (Human)	mRNA alternative polyadenylation [GO:0110104]; mRNA methylation [GO:0080009]; mRNA processing [GO:0006397]; RNA splicing [GO:0008380]	cytosol [GO:0005829]; nuclear body [GO:0016604]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; RNA N6-methyladenosine methyltransferase complex [GO:0036396]	RNA binding [GO:0003723]	LLQEIVR	0.60839	11.0402	0	0	0	0	0	0	0	0	0	0	0
Q3ZCW2	LEGL_HUMAN	Galectin-related protein (Galectin-like protein) (Lectin galactoside-binding-like protein)	LGALSL GRP HSPC159	Homo sapiens (Human)			carbohydrate binding [GO:0030246]	AGSVADSDAVVK	0.94351	0	11.03	0	0	0	0	0	0	0	0	0	0
Q9Y5K8	VATD_HUMAN	V-type proton ATPase subunit D (V-ATPase subunit D) (V-ATPase 28 kDa accessory protein) (Vacuolar proton pump subunit D)	ATP6V1D ATP6M VATD	Homo sapiens (Human)	cilium assembly [GO:0060271]; endosomal lumen acidification [GO:0048388]; Golgi lumen acidification [GO:0061795]; intracellular pH reduction [GO:0051452]; lysosomal lumen acidification [GO:0007042]; protein localization to cilium [GO:0061512]; proton transmembrane transport [GO:1902600]; regulation of macroautophagy [GO:0016241]; vacuolar acidification [GO:0007035]	"cilium [GO:0005929]; clathrin-coated vesicle membrane [GO:0030665]; cytosol [GO:0005829]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; Golgi membrane [GO:0000139]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; microtubule organizing center [GO:0005815]; plasma membrane [GO:0005886]; proton-transporting V-type ATPase complex [GO:0033176]; specific granule membrane [GO:0035579]; vacuolar proton-transporting V-type ATPase, V1 domain [GO:0000221]"	"proton-transporting ATPase activity, rotational mechanism [GO:0046961]"	DRIEIFPSR	0.99727	0	0	11.0287	0	0	0	0	0	0	0	0	0
Q02218	ODO1_HUMAN	"2-oxoglutarate dehydrogenase complex component E1 (E1o) (OGDC-E1) (OGDH-E1) (EC 1.2.4.2) (2-oxoglutarate dehydrogenase, mitochondrial) (Alpha-ketoglutarate dehydrogenase) (Alpha-KGDH-E1) (Thiamine diphosphate (ThDP)-dependent 2-oxoglutarate dehydrogenase)"	OGDH	Homo sapiens (Human)	2-oxoglutarate metabolic process [GO:0006103]; cerebellar cortex development [GO:0021695]; generation of precursor metabolites and energy [GO:0006091]; glycolytic process [GO:0006096]; hippocampus development [GO:0021766]; histone succinylation [GO:0106077]; NADH metabolic process [GO:0006734]; olfactory bulb mitral cell layer development [GO:0061034]; pyramidal neuron development [GO:0021860]; striatum development [GO:0021756]; succinyl-CoA metabolic process [GO:0006104]; tangential migration from the subventricular zone to the olfactory bulb [GO:0022028]; thalamus development [GO:0021794]; tricarboxylic acid cycle [GO:0006099]	mitochondrial matrix [GO:0005759]; mitochondrial membrane [GO:0031966]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; oxoglutarate dehydrogenase complex [GO:0045252]	chaperone binding [GO:0051087]; heat shock protein binding [GO:0031072]; metal ion binding [GO:0046872]; oxoglutarate dehydrogenase (NAD+) activity [GO:0034602]; oxoglutarate dehydrogenase (succinyl-transferring) activity [GO:0004591]; thiamine pyrophosphate binding [GO:0030976]	DEKILHIK	0.99977	0	11.013	0	0	0	0	0	0	0	0	0	0
Q12766	HMGX3_HUMAN	HMG domain-containing protein 3 (HMG box-containing protein 3) (Protein SMF)	HMGXB3 KIAA0194 SMF	Homo sapiens (Human)		nucleus [GO:0005634]	DNA binding [GO:0003677]	LTTTYTR	0.92227	0	0	0	0	0	0	0	0	11.0081	0	0	0
Q13478	IL18R_HUMAN	Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)	IL18R1 IL1RRP	Homo sapiens (Human)	immune response [GO:0006955]; inflammatory response [GO:0006954]; interleukin-18-mediated signaling pathway [GO:0035655]; natural killer cell activation [GO:0030101]; negative regulation of cold-induced thermogenesis [GO:0120163]; NIK/NF-kappaB signaling [GO:0038061]; positive regulation of interferon-gamma production [GO:0032729]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of T-helper 1 cell cytokine production [GO:2000556]; signal transduction [GO:0007165]; T-helper 1 cell differentiation [GO:0045063]	interleukin-18 receptor complex [GO:0045092]; plasma membrane [GO:0005886]	"interleukin-1 receptor activity [GO:0004908]; interleukin-18 binding [GO:0042007]; interleukin-18 receptor activity [GO:0042008]; NAD(P)+ nucleosidase activity [GO:0050135]; NAD+ nucleotidase, cyclic ADP-ribose generating [GO:0061809]; signaling receptor activity [GO:0038023]"	VLKWKADK	0.94601	0	0	0	0	0	11.008	0	0	0	0	0	0
Q5TDP6	LGSN_HUMAN	Lengsin (Glutamate-ammonia ligase domain-containing protein 1) (Lens glutamine synthase-like)	LGSN GLULD1 LGS	Homo sapiens (Human)	nitrogen compound metabolic process [GO:0006807]	cytoplasm [GO:0005737]; membrane [GO:0016020]; plasma membrane [GO:0005886]	catalytic activity [GO:0003824]	TGVKEVARK	0.95571	0	0	0	0	0	0	10.9846	0	0	0	0	0
Q8IXT2	DMRTD_HUMAN	Doublesex- and mab-3-related transcription factor C2	DMRTC2	Homo sapiens (Human)	germ cell development [GO:0007281]; histone H3-K9 dimethylation [GO:0036123]; histone H3-K9 trimethylation [GO:0036124]; male meiosis I [GO:0007141]; positive regulation of histone H3-K9 dimethylation [GO:1900111]; positive regulation of histone H3-K9 trimethylation [GO:1900114]; regulation of transcription by RNA polymerase II [GO:0006357]; sex differentiation [GO:0007548]; spermatid nucleus elongation [GO:0007290]	chromatin [GO:0000785]; nucleus [GO:0005634]; XY body [GO:0001741]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific double-stranded DNA binding [GO:1990837]"	AISRSPTCAR	0.99529	0	0	10.9835	0	0	0	0	0	0	0	0	0
P21333	FLNA_HUMAN	Filamin-A (FLN-A) (Actin-binding protein 280) (ABP-280) (Alpha-filamin) (Endothelial actin-binding protein) (Filamin-1) (Non-muscle filamin)	FLNA FLN FLN1	Homo sapiens (Human)	"actin crosslink formation [GO:0051764]; actin cytoskeleton reorganization [GO:0031532]; adenylate cyclase-inhibiting dopamine receptor signaling pathway [GO:0007195]; angiogenesis [GO:0001525]; blood coagulation, intrinsic pathway [GO:0007597]; blood vessel remodeling [GO:0001974]; cell-cell junction organization [GO:0045216]; cilium assembly [GO:0060271]; cytoplasmic sequestering of protein [GO:0051220]; early endosome to late endosome transport [GO:0045022]; epithelial to mesenchymal transition [GO:0001837]; establishment of protein localization [GO:0045184]; heart morphogenesis [GO:0003007]; megakaryocyte development [GO:0035855]; mitotic spindle assembly [GO:0090307]; negative regulation of apoptotic process [GO:0043066]; negative regulation of DNA-binding transcription factor activity [GO:0043433]; negative regulation of neuron projection development [GO:0010977]; negative regulation of protein catabolic process [GO:0042177]; negative regulation of transcription by RNA polymerase I [GO:0016479]; platelet aggregation [GO:0070527]; positive regulation of axon regeneration [GO:0048680]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of integrin-mediated signaling pathway [GO:2001046]; positive regulation of platelet activation [GO:0010572]; positive regulation of potassium ion transmembrane transport [GO:1901381]; positive regulation of protein import into nucleus [GO:0042307]; positive regulation of substrate adhesion-dependent cell spreading [GO:1900026]; protein localization to cell surface [GO:0034394]; protein localization to plasma membrane [GO:0072659]; protein stabilization [GO:0050821]; receptor clustering [GO:0043113]; regulation of actin filament bundle assembly [GO:0032231]; regulation of cell migration [GO:0030334]; regulation of membrane repolarization during atrial cardiac muscle cell action potential [GO:1905000]; regulation of membrane repolarization during cardiac muscle cell action potential [GO:1905031]; release of sequestered calcium ion into cytosol [GO:0051209]; semaphorin-plexin signaling pathway [GO:0071526]; synapse organization [GO:0050808]; tubulin deacetylation [GO:0090042]; wound healing, spreading of cells [GO:0044319]"	actin cytoskeleton [GO:0015629]; actin filament bundle [GO:0032432]; axonal growth cone [GO:0044295]; brush border [GO:0005903]; cell cortex [GO:0005938]; cell-cell junction [GO:0005911]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; focal adhesion [GO:0005925]; glycoprotein Ib-IX-V complex [GO:1990779]; membrane [GO:0016020]; Myb complex [GO:0031523]; nucleolus [GO:0005730]; nucleus [GO:0005634]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]; trans-Golgi network [GO:0005802]; Z disc [GO:0030018]	actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; DNA-binding transcription factor binding [GO:0140297]; Fc-gamma receptor I complex binding [GO:0034988]; G protein-coupled receptor binding [GO:0001664]; GTPase binding [GO:0051020]; kinase binding [GO:0019900]; potassium channel regulator activity [GO:0015459]; protein homodimerization activity [GO:0042803]; protein kinase C binding [GO:0005080]; RNA binding [GO:0003723]; small GTPase binding [GO:0031267]; transmembrane transporter binding [GO:0044325]	VKVYGPGVAK	0.99807	0	0	0	0	0	0	0	0	0	0	10.9788	0
Q9BWD1	THIC_HUMAN	"Acetyl-CoA acetyltransferase, cytosolic (EC 2.3.1.9) (Acetyl-CoA transferase-like protein) (Cytosolic acetoacetyl-CoA thiolase)"	ACAT2 ACTL	Homo sapiens (Human)	fatty acid beta-oxidation [GO:0006635]; lipid metabolic process [GO:0006629]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; mitochondrion [GO:0005739]	acetyl-CoA C-acetyltransferase activity [GO:0003985]	ELGLNPEK	0.93364	0	0	0	0	0	0	0	0	0	0	10.9709	0
P60866	RS20_HUMAN	40S ribosomal protein S20 (Small ribosomal subunit protein uS10)	RPS20	Homo sapiens (Human)	cytoplasmic translation [GO:0002181]; positive regulation of signal transduction by p53 class mediator [GO:1901798]; translation [GO:0006412]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; cytosolic ribosome [GO:0022626]; cytosolic small ribosomal subunit [GO:0022627]; extracellular exosome [GO:0070062]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; small ribosomal subunit [GO:0015935]; synapse [GO:0045202]	MDM2/MDM4 family protein binding [GO:0097371]; RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]; ubiquitin ligase inhibitor activity [GO:1990948]	ITLTSRNVK	0.99733	0	10.9682	0	0	0	0	0	0	0	0	0	0
Q9C009	FOXQ1_HUMAN	Forkhead box protein Q1 (HNF-3/forkhead-like protein 1) (HFH-1) (Hepatocyte nuclear factor 3 forkhead homolog 1)	FOXQ1 HFH1	Homo sapiens (Human)	anatomical structure morphogenesis [GO:0009653]; cell differentiation [GO:0030154]; hair follicle morphogenesis [GO:0031069]; negative regulation of neuron apoptotic process [GO:0043524]; regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific double-stranded DNA binding [GO:1990837]"	KLEVFVPR	0.99878	0	0	0	0	10.9446	0	0	0	0	0	0	0
Q8WUA4	TF3C2_HUMAN	General transcription factor 3C polypeptide 2 (TF3C-beta) (Transcription factor IIIC 110 kDa subunit) (TFIIIC 110 kDa subunit) (TFIIIC110) (Transcription factor IIIC subunit beta)	GTF3C2 KIAA0011	Homo sapiens (Human)	5S class rRNA transcription by RNA polymerase III [GO:0042791]; transcription by RNA polymerase III [GO:0006383]; tRNA transcription by RNA polymerase III [GO:0042797]	nucleoplasm [GO:0005654]; transcription factor TFIIIC complex [GO:0000127]	RNA polymerase III general transcription initiation factor activity [GO:0000995]	EGLPEDGTLYR	0.93853	10.9391	0	0	0	0	0	0	0	0	0	0	0
Q9Y3Y2	CHTOP_HUMAN	Chromatin target of PRMT1 protein (Friend of PRMT1 protein) (Small arginine- and glycine-rich protein) (SRAG)	CHTOP C1orf77 FOP HT031 PP7704	Homo sapiens (Human)	in utero embryonic development [GO:0001701]; mRNA export from nucleus [GO:0006406]; positive regulation of ATP-dependent activity [GO:0032781]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of helicase activity [GO:0051096]; positive regulation of histone methylation [GO:0031062]	cytoplasmic ribonucleoprotein granule [GO:0036464]; nuclear speck [GO:0016607]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription export complex [GO:0000346]	methyl-CpG binding [GO:0008327]; mRNA binding [GO:0003729]; RNA binding [GO:0003723]	ASMQQQQQLASARNRR	0.95163	0	0	10.9116	0	0	0	0	0	0	0	0	0
Q8IV33	K0825_HUMAN	Uncharacterized protein KIAA0825	KIAA0825 C5orf36	Homo sapiens (Human)				FCSDIMEK	0.57576	10.8666	0	0	0	0	0	0	0	0	0	0	0
Q8TE73	DYH5_HUMAN	Dynein axonemal heavy chain 5 (Axonemal beta dynein heavy chain 5) (Ciliary dynein heavy chain 5)	DNAH5 DNAHC5 HL1 KIAA1603	Homo sapiens (Human)	cilium assembly [GO:0060271]; cilium movement [GO:0003341]; determination of left/right symmetry [GO:0007368]; epithelial cilium movement involved in extracellular fluid movement [GO:0003351]; establishment of localization in cell [GO:0051649]; flagellated sperm motility [GO:0030317]; heart development [GO:0007507]; lateral ventricle development [GO:0021670]; microtubule-based movement [GO:0007018]; outer dynein arm assembly [GO:0036158]	9+0 motile cilium [GO:0097728]; 9+2 motile cilium [GO:0097729]; axoneme [GO:0005930]; cytoplasm [GO:0005737]; dynein complex [GO:0030286]; extracellular region [GO:0005576]; microtubule [GO:0005874]; motile cilium [GO:0031514]; outer dynein arm [GO:0036157]	ATP binding [GO:0005524]; dynein intermediate chain binding [GO:0045505]; dynein light intermediate chain binding [GO:0051959]; minus-end-directed microtubule motor activity [GO:0008569]	LASCGFIDNVVLAR	0.99709	0	0	0	0	0	0	0	0	0	10.8374	0	0
Q8NBF1	GLIS1_HUMAN	Zinc finger protein GLIS1 (GLI-similar 1)	GLIS1	Homo sapiens (Human)	cell differentiation [GO:0030154]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific double-stranded DNA binding [GO:1990837]"	HVKAHSAK	0.97956	0	0	0	0	0	0	0	0	0	0	10.831	0
Q8N5Q1	GAR5B_HUMAN	Golgi-associated RAB2 interactor protein 5B	GARIN5B C19orf16 FAM71E2	Homo sapiens (Human)				APAASAPPRK	0.9984	0	0	0	0	0	0	0	0	0	0	10.8248	0
Q969T7	5NT3B_HUMAN	7-methylguanosine phosphate-specific 5'-nucleotidase (7-methylguanosine nucleotidase) (EC 3.1.3.91) (Cytosolic 5'-nucleotidase 3B) (Cytosolic 5'-nucleotidase III-like protein) (cN-III-like protein) (EC 3.1.3.5) (N(7)-methylguanylate 5'-phosphatase)	NT5C3B NT5C3L	Homo sapiens (Human)	exonucleolytic catabolism of deadenylated mRNA [GO:0043928]; nucleotide metabolic process [GO:0009117]	cytoplasm [GO:0005737]; cytosol [GO:0005829]	5'-nucleotidase activity [GO:0008253]; magnesium ion binding [GO:0000287]; nucleotide binding [GO:0000166]	FAYNGKR	0.97967	0	0	0	10.8077	0	0	0	0	0	0	0	0
Q5TEC6	H37_HUMAN	Histone H3-7	H3-7 H3-2 HIST2H3PS2	Homo sapiens (Human)		nucleosome [GO:0000786]; nucleus [GO:0005634]	DNA binding [GO:0003677]; protein heterodimerization activity [GO:0046982]; structural constituent of chromatin [GO:0030527]	ARTKQTAR	0.94903	0	0	0	0	0	0	0	0	0	10.8054	0	0
Q9HC62	SENP2_HUMAN	Sentrin-specific protease 2 (EC 3.4.22.-) (Axam2) (SMT3-specific isopeptidase 2) (Smt3ip2) (Sentrin/SUMO-specific protease SENP2)	SENP2 KIAA1331	Homo sapiens (Human)	fat cell differentiation [GO:0045444]; mRNA transport [GO:0051028]; negative regulation of protein ubiquitination [GO:0031397]; positive regulation of protein ubiquitination [GO:0031398]; protein destabilization [GO:0031648]; protein desumoylation [GO:0016926]; protein transport [GO:0015031]; regulation of Wnt signaling pathway [GO:0030111]; Wnt signaling pathway [GO:0016055]	cytosol [GO:0005829]; nuclear membrane [GO:0031965]; nuclear pore [GO:0005643]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	deSUMOylase activity [GO:0016929]; SUMO-specific endopeptidase activity [GO:0070139]	SQMDTLKTK	0.87269	0	0	0	0	0	10.8002	0	0	0	0	0	0
Q9H9L4	KANL2_HUMAN	KAT8 regulatory NSL complex subunit 2 (NSL complex protein NSL2) (Non-specific lethal 2 homolog)	KANSL2 C12orf41 NSL2	Homo sapiens (Human)	chromatin organization [GO:0006325]; histone H4-K16 acetylation [GO:0043984]; histone H4-K5 acetylation [GO:0043981]; histone H4-K8 acetylation [GO:0043982]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of histone H3-K4 methylation [GO:0051571]; regulation of dosage compensation by inactivation of X chromosome [GO:1900095]	actin cytoskeleton [GO:0015629]; cytosol [GO:0005829]; histone acetyltransferase complex [GO:0000123]; NSL complex [GO:0044545]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]		RLQHLLKEK	0.96434	0	0	0	0	0	10.7917	0	0	0	0	0	0
Q8WXX5	DNJC9_HUMAN	DnaJ homolog subfamily C member 9 (HDJC9) (DnaJ protein SB73)	DNAJC9	Homo sapiens (Human)	nucleosome assembly [GO:0006334]; positive regulation of ATP-dependent activity [GO:0032781]	chaperone complex [GO:0101031]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular space [GO:0005615]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	chaperone binding [GO:0051087]; heat shock protein binding [GO:0031072]; histone binding [GO:0042393]	RRAQEEAK	0.94673	0	10.7766	0	0	0	0	0	0	0	0	0	0
Q5TAT6	CODA1_HUMAN	Collagen alpha-1(XIII) chain (COLXIIIA1)	COL13A1	Homo sapiens (Human)	cell differentiation [GO:0030154]; cell-cell adhesion [GO:0098609]; cell-matrix adhesion [GO:0007160]; collagen fibril organization [GO:0030199]; endochondral ossification [GO:0001958]; extracellular matrix organization [GO:0030198]; morphogenesis of a branching structure [GO:0001763]; notochord development [GO:0030903]; skeletal system development [GO:0001501]	cell-cell junction [GO:0005911]; collagen trimer [GO:0005581]; collagen type XIII trimer [GO:0005600]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum lumen [GO:0005788]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]; postsynaptic membrane [GO:0045211]	extracellular matrix structural constituent [GO:0005201]; heparin binding [GO:0008201]	GEPGIPGTK	0.95817	0	0	0	0	0	0	10.7684	0	0	0	0	0
Q86UK7	ZN598_HUMAN	E3 ubiquitin-protein ligase ZNF598 (EC 2.3.2.27) (Zinc finger protein 598)	ZNF598	Homo sapiens (Human)	protein monoubiquitination [GO:0006513]; protein ubiquitination [GO:0016567]; regulation of translation [GO:0006417]; rescue of stalled ribosome [GO:0072344]; ribosome-associated ubiquitin-dependent protein catabolic process [GO:1990116]	cytosol [GO:0005829]	metal ion binding [GO:0046872]; ribosome binding [GO:0043022]; RNA binding [GO:0003723]; ubiquitin protein ligase activity [GO:0061630]	GPRRSPR	0.94372	0	0	0	0	0	0	10.7569	0	0	0	0	0
Q7L1V2	MON1B_HUMAN	Vacuolar fusion protein MON1 homolog B (HSV-1 stimulation-related gene 1 protein) (HSV-I stimulating-related protein)	MON1B HSRG1 KIAA0872 SAND2	Homo sapiens (Human)	early viral transcription [GO:0019085]; late viral transcription [GO:0019086]; protein targeting to vacuole [GO:0006623]; vesicle-mediated transport [GO:0016192]	cytoplasm [GO:0005737]; Mon1-Ccz1 complex [GO:0035658]		CVPLARPLR	0.86758	0	0	0	0	0	10.7559	0	0	0	0	0	0
O43516	WIPF1_HUMAN	WAS/WASL-interacting protein family member 1 (Protein PRPL-2) (Wiskott-Aldrich syndrome protein-interacting protein) (WASP-interacting protein)	WIPF1 WASPIP WIP	Homo sapiens (Human)	actin filament-based movement [GO:0030048]; actin polymerization or depolymerization [GO:0008154]; protein-containing complex assembly [GO:0065003]; response to other organism [GO:0051707]	actin cytoskeleton [GO:0015629]; actin filament [GO:0005884]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; ruffle [GO:0001726]	actin binding [GO:0003779]; profilin binding [GO:0005522]; protein folding chaperone [GO:0044183]; SH3 domain binding [GO:0017124]	SGVDSPR	0.93569	0	0	0	0	0	0	0	0	10.7311	0	0	0
Q9UJT9	FBXL7_HUMAN	F-box/LRR-repeat protein 7 (F-box and leucine-rich repeat protein 7) (F-box protein FBL6/FBL7)	FBXL7 FBL6 FBL7 KIAA0840	Homo sapiens (Human)	cell division [GO:0051301]; G2/M transition of mitotic cell cycle [GO:0000086]; mitotic cell cycle [GO:0000278]; protein polyubiquitination [GO:0000209]; protein ubiquitination [GO:0016567]; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146]; ubiquitin-dependent protein catabolic process [GO:0006511]	centrosome [GO:0005813]; cytosol [GO:0005829]; SCF ubiquitin ligase complex [GO:0019005]; ubiquitin ligase complex [GO:0000151]		LTGETINVDR	0.67308	10.6855	0	0	0	0	0	0	0	0	0	0	0
Q9H6N6	MYH16_HUMAN	Putative uncharacterized protein MYH16 (Myosin heavy chain 16 pseudogene) (myosin heavy polypeptide 5)	MYH16 MYH5	Homo sapiens (Human)		centriole [GO:0005814]; centrosome [GO:0005813]; myosin complex [GO:0016459]		CEELQVEVDSSQKECRMYMTESFK	0.12903	0	0	0	0	10.6526	0	0	0	0	0	0	0
O60609	GFRA3_HUMAN	GDNF family receptor alpha-3 (GDNF receptor alpha-3) (GDNFR-alpha-3) (GFR-alpha-3)	GFRA3 UNQ339/PRO538/PRO3664	Homo sapiens (Human)	nervous system development [GO:0007399]; neuron migration [GO:0001764]; peripheral nervous system development [GO:0007422]; signal transduction [GO:0007165]; sympathetic nervous system development [GO:0048485]	anchored component of membrane [GO:0031225]; cytosol [GO:0005829]; external side of plasma membrane [GO:0009897]; extrinsic component of membrane [GO:0019898]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]	axon guidance receptor activity [GO:0008046]; glial cell-derived neurotrophic factor receptor activity [GO:0016167]; signaling receptor activity [GO:0038023]; signaling receptor binding [GO:0005102]	LNMLKPDSDLCLK	0.83151	0	0	0	10.6494	0	0	0	0	0	0	0	0
Q14202	ZMYM3_HUMAN	Zinc finger MYM-type protein 3 (Zinc finger protein 261)	ZMYM3 DXS6673E KIAA0385 ZNF261	Homo sapiens (Human)	cytoskeleton organization [GO:0007010]; regulation of cell morphogenesis [GO:0022604]	nucleoplasm [GO:0005654]	DNA binding [GO:0003677]; zinc ion binding [GO:0008270]	GRDTGPGKR	0.99956	0	0	0	0	0	0	10.6476	0	0	0	0	0
Q9NP58	ABCB6_HUMAN	ATP-binding cassette sub-family B member 6 (ABC-type heme transporter ABCB6) (EC 7.6.2.5) (Mitochondrial ABC transporter 3) (Mt-ABC transporter 3) (P-glycoprotein-related protein) (Ubiquitously-expressed mammalian ABC half transporter)	ABCB6 MTABC3 PRP UMAT	Homo sapiens (Human)	brain development [GO:0007420]; cellular copper ion homeostasis [GO:0006878]; cellular detoxification of cadmium ion [GO:0098849]; cellular iron ion homeostasis [GO:0006879]; heme metabolic process [GO:0042168]; heme transmembrane transport [GO:0035351]; heme transport [GO:0015886]; melanosome assembly [GO:1903232]; porphyrin-containing compound biosynthetic process [GO:0006779]; porphyrin-containing compound metabolic process [GO:0006778]; skin development [GO:0043588]; tetrapyrrole metabolic process [GO:0033013]; transmembrane transport [GO:0055085]	ATP-binding cassette (ABC) transporter complex [GO:0043190]; cytosol [GO:0005829]; early endosome membrane [GO:0031901]; endolysosome membrane [GO:0036020]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; endosome [GO:0005768]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; integral component of mitochondrial outer membrane [GO:0031307]; lysosomal membrane [GO:0005765]; melanosome membrane [GO:0033162]; mitochondrial envelope [GO:0005740]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; multivesicular body membrane [GO:0032585]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; vacuolar membrane [GO:0005774]	ABC-type heme transporter activity [GO:0015439]; ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; efflux transmembrane transporter activity [GO:0015562]; heme binding [GO:0020037]; tetrapyrrole binding [GO:0046906]	LAMGIWIK	0.93785	0	0	0	0	0	0	0	0	10.6399	0	0	0
Q9NUN5	LMBD1_HUMAN	Lysosomal cobalamin transport escort protein LMBD1 (LMBD1) (HDAg-L-interacting protein NESI) (LMBR1 domain-containing protein 1) (Nuclear export signal-interacting protein)	LMBRD1 C6orf209 NESI BM-021 CD001 MSTP044	Homo sapiens (Human)	clathrin-dependent endocytosis [GO:0072583]; gastrulation [GO:0007369]; insulin receptor internalization [GO:0038016]; protein localization to lysosome [GO:0061462]; protein localization to vacuole [GO:0072665]	clathrin-coated endocytic vesicle [GO:0045334]; clathrin-coated vesicle [GO:0030136]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; plasma membrane [GO:0005886]; vacuolar membrane [GO:0005774]	AP-2 adaptor complex binding [GO:0035612]; clathrin heavy chain binding [GO:0032050]; cobalamin binding [GO:0031419]; insulin receptor binding [GO:0005158]; protein transporter activity [GO:0140318]	TYLFLHK	0.93243	0	0	0	0	0	0	0	10.6306	0	0	0	0
Q9NQ90	ANO2_HUMAN	Anoctamin-2 (Transmembrane protein 16B)	ANO2 C12orf3 TMEM16B	Homo sapiens (Human)	chloride transmembrane transport [GO:1902476]; ion transmembrane transport [GO:0034220]; transmembrane transport [GO:0055085]	chloride channel complex [GO:0034707]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]	chloride channel activity [GO:0005254]; intracellular calcium activated chloride channel activity [GO:0005229]; protein dimerization activity [GO:0046983]	LLYQEWARYGVFYK	0.87342	0	10.6208	0	0	0	0	0	0	0	0	0	0
O95780	ZN682_HUMAN	Zinc finger protein 682	ZNF682	Homo sapiens (Human)	regulation of DNA-templated transcription [GO:0006355]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	AFHWCSPFVR	0.99495	0	0	0	0	0	0	10.6131	0	0	0	0	0
Q9UNY5	ZN232_HUMAN	Zinc finger protein 232 (Zinc finger and SCAN domain-containing protein 11)	ZNF232 ZSCAN11	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; nucleoplasm [GO:0005654]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	DHECSECGK	0.9685	0	0	0	0	0	0	0	10.5958	0	0	0	0
Q96B70	LENG9_HUMAN	Leukocyte receptor cluster member 9	LENG9	Homo sapiens (Human)			metal ion binding [GO:0046872]	TDLVFGSGSAAGR	0.91989	10.5787	0	0	0	0	0	0	0	0	0	0	0
Q9HBE1	PATZ1_HUMAN	"POZ-, AT hook-, and zinc finger-containing protein 1 (BTB/POZ domain zinc finger transcription factor) (Protein kinase A RI subunit alpha-associated protein) (Zinc finger and BTB domain-containing protein 19) (Zinc finger protein 278) (Zinc finger sarcoma gene protein)"	PATZ1 PATZ RIAZ ZBTB19 ZNF278 ZSG	Homo sapiens (Human)	male gonad development [GO:0008584]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of endothelial cell migration [GO:0010596]; positive regulation of DNA-templated transcription [GO:0045893]; regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase II [GO:0006357]; spermatogenesis [GO:0007283]; T cell differentiation [GO:0030217]	male germ cell nucleus [GO:0001673]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; ubiquitin protein ligase binding [GO:0031625]"	SYLNKHIQKVHVR	0.94307	0	0	0	0	0	0	0	10.5602	0	0	0	0
O75900	MMP23_HUMAN	"Matrix metalloproteinase-23 (MMP-23) (EC 3.4.24.-) (Femalysin) (MIFR-1) (Matrix metalloproteinase-21) (MMP-21) (Matrix metalloproteinase-22) (MMP-22) [Cleaved into: Matrix metalloproteinase-23, soluble form]"	MMP23B MMP21 MMP22	Homo sapiens (Human)	collagen catabolic process [GO:0030574]; extracellular matrix organization [GO:0030198]; proteolysis [GO:0006508]; reproduction [GO:0000003]	collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum membrane [GO:0005789]; extracellular matrix [GO:0031012]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]	metalloendopeptidase activity [GO:0004222]; metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270]	GKVYWYK	0.99718	0	0	0	0	0	0	0	10.5379	0	0	0	0
Q86VF2	IGFN1_HUMAN	Immunoglobulin-like and fibronectin type III domain-containing protein 1 (EEF1A2-binding protein 1) (KY-interacting protein 1)	IGFN1 EEF1A2BP1 KYIP1	Homo sapiens (Human)	homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; retina layer formation [GO:0010842]; synapse assembly [GO:0007416]	nucleus [GO:0005634]; synapse [GO:0045202]; Z disc [GO:0030018]		LQSRRSGK	0.82969	0	10.5241	0	0	0	0	0	0	0	0	0	0
Q99487	PAFA2_HUMAN	"Platelet-activating factor acetylhydrolase 2, cytoplasmic (EC 3.1.1.47) (PAF:lysophospholipid transacetylase) (PAF:sphingosine transacetylase) (Platelet-activating factor acetyltransferase PAFAH2) (EC 2.3.1.149) (Serine-dependent phospholipase A2) (SD-PLA2) (hSD-PLA2)"	PAFAH2	Homo sapiens (Human)	blood coagulation [GO:0007596]; lipid catabolic process [GO:0016042]; lipid metabolic process [GO:0006629]	cytoplasm [GO:0005737]; endoplasmic reticulum membrane [GO:0005789]	1-alkyl-2-acetylglycerophosphocholine esterase activity [GO:0003847]; phospholipid binding [GO:0005543]; platelet-activating factor acetyltransferase activity [GO:0047179]	AMLAFLQK	0.93698	0	0	0	10.5241	0	0	0	0	0	0	0	0
Q9BUV0	RSRP1_HUMAN	Arginine/serine-rich protein 1	RSRP1 C1orf63 HT033 NPD014	Homo sapiens (Human)				SNYVNDMWPGSPQEKDSPSTSRSGGSSR	0.14286	0	0	0	10.5209	0	0	0	0	0	0	0	0
Q15643	TRIPB_HUMAN	Thyroid receptor-interacting protein 11 (TR-interacting protein 11) (TRIP-11) (Clonal evolution-related gene on chromosome 14 protein) (Golgi-associated microtubule-binding protein 210) (GMAP-210) (Trip230)	TRIP11 CEV14	Homo sapiens (Human)	cartilage development [GO:0051216]; chondrocyte differentiation involved in endochondral bone morphogenesis [GO:0003413]; endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; Golgi organization [GO:0007030]; Golgi ribbon formation [GO:0090161]; inner ear receptor cell stereocilium organization [GO:0060122]; protein glycosylation [GO:0006486]; transcription by RNA polymerase II [GO:0006366]; ventricular septum development [GO:0003281]; vesicle tethering to Golgi [GO:0099041]	cis-Golgi network [GO:0005801]; cytoskeleton [GO:0005856]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; inner acrosomal membrane [GO:0002079]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; outer acrosomal membrane [GO:0002081]; transport vesicle [GO:0030133]	small GTPase binding [GO:0031267]; transcription coactivator activity [GO:0003713]	KLMSLANSSEGKVDK	1	0	0	0	10.5152	0	0	0	0	0	0	0	0
Q7Z2E3	APTX_HUMAN	Aprataxin (EC 3.6.1.71) (EC 3.6.1.72) (Forkhead-associated domain histidine triad-like protein) (FHA-HIT)	APTX AXA1	Homo sapiens (Human)	cellular response to DNA damage stimulus [GO:0006974]; DNA ligation [GO:0006266]; double-strand break repair [GO:0006302]; regulation of protein stability [GO:0031647]; response to hydrogen peroxide [GO:0042542]; single strand break repair [GO:0000012]	chromatin [GO:0000785]; cytoplasm [GO:0005737]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	chromatin binding [GO:0003682]; damaged DNA binding [GO:0003684]; DNA 5'-adenosine monophosphate hydrolase activity [GO:0033699]; DNA-3'-diphospho-5'-guanosine diphosphatase [GO:0120108]; double-stranded DNA binding [GO:0003690]; double-stranded RNA binding [GO:0003725]; metal ion binding [GO:0046872]; mismatched DNA binding [GO:0030983]; phosphoglycolate phosphatase activity [GO:0008967]; phosphoprotein binding [GO:0051219]; polynucleotide 3'-phosphatase activity [GO:0046403]; protein N-terminus binding [GO:0047485]; single-strand break-containing DNA binding [GO:1990165]; single-stranded DNA binding [GO:0003697]	KGKDAPIK	0.94251	0	10.5092	0	0	0	0	0	0	0	0	0	0
P41218	MNDA_HUMAN	Myeloid cell nuclear differentiation antigen	MNDA	Homo sapiens (Human)	activation of innate immune response [GO:0002218]; B cell receptor signaling pathway [GO:0050853]; cellular defense response [GO:0006968]; cellular response to DNA damage stimulus [GO:0006974]; cellular response to interferon-beta [GO:0035458]; negative regulation of B cell proliferation [GO:0030889]; positive regulation of apoptotic process [GO:0043065]; positive regulation of interleukin-1 beta production [GO:0032731]	azurophil granule lumen [GO:0035578]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; ficolin-1-rich granule lumen [GO:1904813]; intracellular membrane-bounded organelle [GO:0043231]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	double-stranded DNA binding [GO:0003690]	ITDLMEK	0.92746	0	10.4814	0	0	0	0	0	0	0	0	0	0
Q6UWR7	ENPP6_HUMAN	Glycerophosphocholine cholinephosphodiesterase ENPP6 (GPC-Cpde) (EC 3.1.4.-) (EC 3.1.4.38) (Choline-specific glycerophosphodiester phosphodiesterase) (Ectonucleotide pyrophosphatase/phosphodiesterase family member 6) (E-NPP 6) (NPP-6)	ENPP6 UNQ1889/PRO4334	Homo sapiens (Human)	choline metabolic process [GO:0019695]; glycerophospholipid catabolic process [GO:0046475]; lipid metabolic process [GO:0006629]	anchored component of membrane [GO:0031225]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; plasma membrane [GO:0005886]	glycerophosphocholine cholinephosphodiesterase activity [GO:0047390]; glycerophosphodiester phosphodiesterase activity [GO:0008889]; metal ion binding [GO:0046872]; phosphoric diester hydrolase activity [GO:0008081]	FYYKKGK	0.93944	0	10.4809	0	0	0	0	0	0	0	0	0	0
Q9UP83	COG5_HUMAN	Conserved oligomeric Golgi complex subunit 5 (COG complex subunit 5) (13S Golgi transport complex 90 kDa subunit) (GTC-90) (Component of oligomeric Golgi complex 5) (Golgi transport complex 1)	COG5 GOLTC1 GTC90	Homo sapiens (Human)	"glycosylation [GO:0070085]; Golgi organization [GO:0007030]; inter-Golgi cisterna vesicle-mediated transport [GO:0048219]; intra-Golgi vesicle-mediated transport [GO:0006891]; protein transport [GO:0015031]; retrograde transport, vesicle recycling within Golgi [GO:0000301]"	cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; Golgi transport complex [GO:0017119]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; trans-Golgi network membrane [GO:0032588]		ELQGFIAR	0.93409	0	10.4809	0	0	0	0	0	0	0	0	0	0
Q9Y235	ABEC2_HUMAN	C->U-editing enzyme APOBEC-2 (EC 3.5.4.36) (mRNA(cytosine(6666)) deaminase 2)	APOBEC2	Homo sapiens (Human)	cytidine to uridine editing [GO:0016554]; DNA demethylation [GO:0080111]; mRNA modification [GO:0016556]; mRNA processing [GO:0006397]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	cytidine deaminase activity [GO:0004126]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]	KLKEAGCK	0.94973	0	10.4809	0	0	0	0	0	0	0	0	0	0
P15408	FOSL2_HUMAN	Fos-related antigen 2 (FRA-2)	FOSL2 FRA2	Homo sapiens (Human)	cell death [GO:0008219]; keratinocyte development [GO:0003334]; positive regulation of fibroblast proliferation [GO:0048146]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; RNA polymerase II transcription regulator complex [GO:0090575]	"chromatin binding [GO:0003682]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	TIGTTVGRR	0.99837	0	10.48	0	0	0	0	0	0	0	0	0	0
Q8IWT6	LRC8A_HUMAN	Volume-regulated anion channel subunit LRRC8A (Leucine-rich repeat-containing protein 8A) (HsLRRC8A) (Swelling protein 1)	LRRC8A KIAA1437 LRRC8 SWELL1 UNQ221/PRO247	Homo sapiens (Human)	anion transmembrane transport [GO:0098656]; anion transport [GO:0006820]; aspartate transmembrane transport [GO:0015810]; cell volume homeostasis [GO:0006884]; cellular glucose homeostasis [GO:0001678]; chloride transmembrane transport [GO:1902476]; cyclic-GMP-AMP transmembrane import across plasma membrane [GO:0140361]; positive regulation of insulin secretion [GO:0032024]; positive regulation of myoblast differentiation [GO:0045663]; pre-B cell differentiation [GO:0002329]; protein hexamerization [GO:0034214]; response to osmotic stress [GO:0006970]; spermatogenesis [GO:0007283]; taurine transport [GO:0015734]	cell surface [GO:0009986]; integral component of lysosomal membrane [GO:1905103]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; ion channel complex [GO:0034702]; membrane [GO:0016020]; plasma membrane [GO:0005886]	cyclic-GMP-AMP transmembrane transporter activity [GO:0140360]; identical protein binding [GO:0042802]; volume-sensitive anion channel activity [GO:0005225]	LYLNRNKIEK	0.99977	10.4736	0	0	0	0	0	0	0	0	0	0	0
Q8NHL6	LIRB1_HUMAN	Leukocyte immunoglobulin-like receptor subfamily B member 1 (LIR-1) (Leukocyte immunoglobulin-like receptor 1) (CD85 antigen-like family member J) (Immunoglobulin-like transcript 2) (ILT-2) (Monocyte/macrophage immunoglobulin-like receptor 7) (MIR-7) (CD antigen CD85j)	LILRB1 ILT2 LIR1 MIR7	Homo sapiens (Human)	"adaptive immune response [GO:0002250]; cellular response to lipopolysaccharide [GO:0071222]; cytokine-mediated signaling pathway [GO:0019221]; defense response to virus [GO:0051607]; dendritic cell differentiation [GO:0097028]; Fc receptor mediated inhibitory signaling pathway [GO:0002774]; immune response-inhibiting cell surface receptor signaling pathway [GO:0002767]; negative regulation of alpha-beta T cell activation [GO:0046636]; negative regulation of calcium ion transport [GO:0051926]; negative regulation of CD8-positive, alpha-beta T cell activation [GO:2001186]; negative regulation of cell cycle [GO:0045786]; negative regulation of cytokine production involved in immune response [GO:0002719]; negative regulation of dendritic cell apoptotic process [GO:2000669]; negative regulation of dendritic cell differentiation [GO:2001199]; negative regulation of endocytosis [GO:0045806]; negative regulation of interferon-beta production [GO:0032688]; negative regulation of interferon-gamma production [GO:0032689]; negative regulation of interleukin-10 production [GO:0032693]; negative regulation of interleukin-12 production [GO:0032695]; negative regulation of mononuclear cell proliferation [GO:0032945]; negative regulation of natural killer cell mediated cytotoxicity [GO:0045953]; negative regulation of osteoclast development [GO:2001205]; negative regulation of serotonin secretion [GO:0014063]; negative regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell [GO:2001189]; negative regulation of T cell mediated cytotoxicity [GO:0001915]; negative regulation of T cell proliferation [GO:0042130]; negative regulation of transforming growth factor beta production [GO:0071635]; negative regulation of tumor necrosis factor production [GO:0032720]; positive regulation of apoptotic process [GO:0043065]; positive regulation of defense response to virus by host [GO:0002230]; positive regulation of gamma-delta T cell activation involved in immune response [GO:2001193]; positive regulation of gene expression [GO:0010628]; positive regulation of interferon-gamma production [GO:0032729]; positive regulation of macrophage cytokine production [GO:0060907]; positive regulation of transcription by RNA polymerase II [GO:0045944]; receptor internalization [GO:0031623]; response to virus [GO:0009615]; signal transduction [GO:0007165]; T cell proliferation involved in immune response [GO:0002309]"	cytoplasm [GO:0005737]; external side of plasma membrane [GO:0009897]; extracellular region [GO:0005576]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	HLA-A specific inhibitory MHC class I receptor activity [GO:0030107]; HLA-B specific inhibitory MHC class I receptor activity [GO:0030109]; inhibitory MHC class I receptor activity [GO:0032396]; MHC class I protein binding [GO:0042288]; MHC class I receptor activity [GO:0032393]; MHC class Ib protein binding [GO:0023029]; MHC class Ib protein complex binding [GO:0023025]; MHC class Ib receptor activity [GO:0032394]; protein homodimerization activity [GO:0042803]; protein phosphatase 1 binding [GO:0008157]; SH2 domain binding [GO:0042169]	HTQPEDGVEMDTR	0.94248	10.4736	0	0	0	0	0	0	0	0	0	0	0
Q9UBC5	MYO1A_HUMAN	Unconventional myosin-Ia (Brush border myosin I) (BBM-I) (BBMI) (Myosin I heavy chain) (MIHC)	MYO1A MYHL	Homo sapiens (Human)	actin filament organization [GO:0007015]; microvillus assembly [GO:0030033]; sensory perception of sound [GO:0007605]; vesicle localization [GO:0051648]; vesicle transport along actin filament [GO:0030050]	actin cytoskeleton [GO:0015629]; apical plasma membrane [GO:0016324]; basolateral plasma membrane [GO:0016323]; brush border [GO:0005903]; cortical actin cytoskeleton [GO:0030864]; cytoplasm [GO:0005737]; filamentous actin [GO:0031941]; lateral plasma membrane [GO:0016328]; microvillus [GO:0005902]; myosin complex [GO:0016459]; plasma membrane [GO:0005886]; plasma membrane raft [GO:0044853]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; calmodulin binding [GO:0005516]; microfilament motor activity [GO:0000146]	ASVLLIQAFVR	0.57399	10.4736	0	0	0	0	0	0	0	0	0	0	0
Q969R8	ITFG2_HUMAN	KICSTOR complex protein ITFG2 (Integrin-alpha FG-GAP repeat-containing protein 2)	ITFG2	Homo sapiens (Human)	cellular response to amino acid starvation [GO:0034198]; cellular response to glucose starvation [GO:0042149]; germinal center B cell differentiation [GO:0002314]; negative regulation of TORC1 signaling [GO:1904262]; regulation of TOR signaling [GO:0032006]	cytosol [GO:0005829]; KICSTOR complex [GO:0140007]; lysosomal membrane [GO:0005765]; nucleoplasm [GO:0005654]		EGRNSPCLVYVTFNQK	0.86047	0	0	0	0	0	0	10.47	0	0	0	0	0
Q86XW9	TXND6_HUMAN	Thioredoxin domain-containing protein 6 (Thioredoxin-like protein 2) (Txl-2)	NME9 TXL2 TXNDC6	Homo sapiens (Human)	CTP biosynthetic process [GO:0006241]; GTP biosynthetic process [GO:0006183]; nucleoside diphosphate phosphorylation [GO:0006165]; UTP biosynthetic process [GO:0006228]	cell projection [GO:0042995]; cytoskeleton [GO:0005856]; dynein axonemal particle [GO:0120293]	nucleoside diphosphate kinase activity [GO:0004550]	IEVGLDLLHFALAEADR	0.5	0	0	0	0	0	0	0	0	10.4464	0	0	0
P78423	X3CL1_HUMAN	Fractalkine (C-X3-C motif chemokine 1) (CX3C membrane-anchored chemokine) (Neurotactin) (Small-inducible cytokine D1) [Cleaved into: Processed fractalkine]	CX3CL1 FKN NTT SCYD1 A-152E5.2	Homo sapiens (Human)	aging [GO:0007568]; angiogenesis involved in wound healing [GO:0060055]; autocrine signaling [GO:0035425]; cell adhesion [GO:0007155]; cell chemotaxis [GO:0060326]; cell-cell adhesion [GO:0098609]; cell-cell signaling [GO:0007267]; cellular response to interferon-gamma [GO:0071346]; cellular response to interleukin-1 [GO:0071347]; cellular response to tumor necrosis factor [GO:0071356]; chemokine-mediated signaling pathway [GO:0070098]; chemotaxis [GO:0006935]; cytokine-mediated signaling pathway [GO:0019221]; defense response [GO:0006952]; eosinophil chemotaxis [GO:0048245]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; G protein-coupled receptor signaling pathway [GO:0007186]; immune response [GO:0006955]; inflammatory response [GO:0006954]; integrin activation [GO:0033622]; leukocyte adhesive activation [GO:0050902]; leukocyte chemotaxis [GO:0030595]; leukocyte migration involved in inflammatory response [GO:0002523]; lymphocyte chemotaxis [GO:0048247]; microglial cell activation [GO:0001774]; microglial cell proliferation [GO:0061518]; monocyte chemotaxis [GO:0002548]; negative regulation of apoptotic process [GO:0043066]; negative regulation of apoptotic signaling pathway [GO:2001234]; negative regulation of cell migration [GO:0030336]; negative regulation of cell-substrate adhesion [GO:0010812]; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001240]; negative regulation of glutamate receptor signaling pathway [GO:1900450]; negative regulation of hippocampal neuron apoptotic process [GO:0110091]; negative regulation of interleukin-1 alpha production [GO:0032690]; negative regulation of interleukin-1 beta production [GO:0032691]; negative regulation of interleukin-6 production [GO:0032715]; negative regulation of microglial cell activation [GO:1903979]; negative regulation of neuron migration [GO:2001223]; negative regulation of tumor necrosis factor production [GO:0032720]; neuron cellular homeostasis [GO:0070050]; neuron remodeling [GO:0016322]; neutrophil chemotaxis [GO:0030593]; positive chemotaxis [GO:0050918]; positive regulation of actin filament bundle assembly [GO:0032233]; positive regulation of calcium-independent cell-cell adhesion [GO:0051041]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of cell-matrix adhesion [GO:0001954]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of GTPase activity [GO:0043547]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of I-kappaB phosphorylation [GO:1903721]; positive regulation of inflammatory response [GO:0050729]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of microglial cell migration [GO:1904141]; positive regulation of neuroblast proliferation [GO:0002052]; positive regulation of neuron projection development [GO:0010976]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of protein kinase B signaling [GO:0051897]; positive regulation of release of sequestered calcium ion into cytosol [GO:0051281]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of transforming growth factor beta1 production [GO:0032914]; regulation of lipopolysaccharide-mediated signaling pathway [GO:0031664]; regulation of neurogenesis [GO:0050767]; regulation of synaptic plasticity [GO:0048167]; response to ischemia [GO:0002931]; synapse pruning [GO:0098883]	cell projection [GO:0042995]; cell surface [GO:0009986]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; neuron projection [GO:0043005]; neuronal cell body [GO:0043025]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]	CCR chemokine receptor binding [GO:0048020]; chemoattractant activity [GO:0042056]; chemokine activity [GO:0008009]; CX3C chemokine receptor binding [GO:0031737]; CXCR1 chemokine receptor binding [GO:0045237]; integrin binding [GO:0005178]; signaling receptor binding [GO:0005102]	LGVLITPVPDAQAATR	0.80788	0	0	0	0	0	10.4395	0	0	0	0	0	0
Q13370	PDE3B_HUMAN	"cGMP-inhibited 3',5'-cyclic phosphodiesterase 3B (EC 3.1.4.17) (CGIPDE1) (CGIP1) (Cyclic GMP-inhibited phosphodiesterase B) (CGI-PDE B)"	PDE3B	Homo sapiens (Human)	angiogenesis [GO:0001525]; cellular response to insulin stimulus [GO:0032869]; G protein-coupled receptor signaling pathway [GO:0007186]; negative regulation of angiogenesis [GO:0016525]; negative regulation of cAMP-mediated signaling [GO:0043951]; negative regulation of cell adhesion [GO:0007162]; negative regulation of cell adhesion mediated by integrin [GO:0033629]; negative regulation of lipid catabolic process [GO:0050995]; signal transduction [GO:0007165]	cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; guanyl-nucleotide exchange factor complex [GO:0032045]; integral component of membrane [GO:0016021]; membrane [GO:0016020]	"3',5'-cyclic-AMP phosphodiesterase activity [GO:0004115]; 3',5'-cyclic-nucleotide phosphodiesterase activity [GO:0004114]; cGMP-inhibited cyclic-nucleotide phosphodiesterase activity [GO:0004119]; metal ion binding [GO:0046872]; protein kinase B binding [GO:0043422]"	GLNRNSLPTPQLRR	0.94328	0	0	0	0	0	10.4395	0	0	0	0	0	0
Q96CW5	GCP3_HUMAN	Gamma-tubulin complex component 3 (GCP-3) (hGCP3) (Gamma-ring complex protein 104 kDa) (h104p) (hGrip104) (Spindle pole body protein Spc98 homolog) (hSpc98)	TUBGCP3 GCP3	Homo sapiens (Human)	cytoplasmic microtubule organization [GO:0031122]; meiotic cell cycle [GO:0051321]; microtubule nucleation [GO:0007020]; mitotic cell cycle [GO:0000278]; single fertilization [GO:0007338]; spindle assembly [GO:0051225]	centriole [GO:0005814]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; equatorial microtubule organizing center [GO:0000923]; gamma-tubulin complex [GO:0000930]; gamma-tubulin small complex [GO:0008275]; membrane [GO:0016020]; polar microtubule [GO:0005827]; spindle [GO:0005819]	gamma-tubulin binding [GO:0043015]; structural constituent of cytoskeleton [GO:0005200]; structural molecule activity [GO:0005198]	GGELASAVHAYTK	0.92176	0	0	0	0	0	10.4395	0	0	0	0	0	0
A6NIK2	LR10B_HUMAN	Leucine-rich repeat-containing protein 10B	LRRC10B	Homo sapiens (Human)				ALEAAPGLGT	0.94395	0	0	0	0	0	0	10.4328	0	0	0	0	0
Q8IYB3	SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 (SR-related nuclear matrix protein of 160 kDa) (SRm160) (Ser/Arg-related nuclear matrix protein)	SRRM1 SRM160	Homo sapiens (Human)	"localization [GO:0051179]; mRNA splicing, via spliceosome [GO:0000398]; regulation of mRNA splicing, via spliceosome [GO:0048024]; RNA splicing [GO:0008380]; RNA splicing, via transesterification reactions [GO:0000375]"	catalytic step 2 spliceosome [GO:0071013]; cytosol [GO:0005829]; nuclear matrix [GO:0016363]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; spliceosomal complex [GO:0005681]	DNA binding [GO:0003677]; RNA binding [GO:0003723]	LSPSASPPR	0.93291	0	0	0	0	10.4295	0	0	0	0	0	0	0
H3BV12	GOG8Q_HUMAN	Golgin subfamily A member 8Q	GOLGA8Q	Homo sapiens (Human)	Golgi organization [GO:0007030]	cis-Golgi network [GO:0005801]; Golgi cis cisterna [GO:0000137]; Golgi cisterna membrane [GO:0032580]		KANNERQK	0.94676	0	0	0	0	0	0	0	0	0	10.4287	0	0
Q5D1E8	ZC12A_HUMAN	Endoribonuclease ZC3H12A (EC 3.1.-.-) (Monocyte chemotactic protein-induced protein 1) (MCP-induced protein 1) (MCPIP-1) (Regnase-1) (Reg1) (Zinc finger CCCH domain-containing protein 12A)	ZC3H12A MCPIP MCPIP1	Homo sapiens (Human)	"3'-UTR-mediated mRNA destabilization [GO:0061158]; angiogenesis [GO:0001525]; apoptotic process [GO:0006915]; cell differentiation [GO:0030154]; cellular response to chemokine [GO:1990869]; cellular response to DNA damage stimulus [GO:0006974]; cellular response to glucose starvation [GO:0042149]; cellular response to interleukin-1 [GO:0071347]; cellular response to ionomycin [GO:1904637]; cellular response to lipopolysaccharide [GO:0071222]; cellular response to oxidative stress [GO:0034599]; cellular response to sodium arsenite [GO:1903936]; cellular response to tumor necrosis factor [GO:0071356]; cellular response to virus [GO:0098586]; defense response to virus [GO:0051607]; immune response-activating signal transduction [GO:0002757]; inflammatory response [GO:0006954]; miRNA catabolic process [GO:0010587]; negative regulation by host of viral genome replication [GO:0044828]; negative regulation of cardiac muscle contraction [GO:0055118]; negative regulation of cytokine production involved in inflammatory response [GO:1900016]; negative regulation of gene expression [GO:0010629]; negative regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043124]; negative regulation of interferon-gamma production [GO:0032689]; negative regulation of interleukin-1 beta production [GO:0032691]; negative regulation of interleukin-6 production [GO:0032715]; negative regulation of macrophage activation [GO:0043031]; negative regulation of miRNA maturation [GO:1903799]; negative regulation of muscle cell apoptotic process [GO:0010656]; negative regulation of NF-kappaB transcription factor activity [GO:0032088]; negative regulation of NIK/NF-kappaB signaling [GO:1901223]; negative regulation of nitric oxide biosynthetic process [GO:0045019]; negative regulation of protein phosphorylation [GO:0001933]; negative regulation of T-helper 17 cell differentiation [GO:2000320]; negative regulation of tumor necrosis factor production [GO:0032720]; nervous system development [GO:0007399]; nuclear-transcribed mRNA catabolic process, endonucleolytic cleavage-dependent decay [GO:0000294]; positive regulation of angiogenesis [GO:0045766]; positive regulation of autophagy [GO:0010508]; positive regulation of cell death [GO:0010942]; positive regulation of defense response to virus by host [GO:0002230]; positive regulation of endothelial cell migration [GO:0010595]; positive regulation of execution phase of apoptosis [GO:1900119]; positive regulation of fat cell differentiation [GO:0045600]; positive regulation of gene expression [GO:0010628]; positive regulation of lipid storage [GO:0010884]; positive regulation of miRNA catabolic process [GO:2000627]; positive regulation of mRNA catabolic process [GO:0061014]; positive regulation of p38MAPK cascade [GO:1900745]; positive regulation of protein deubiquitination [GO:1903003]; positive regulation of protein import into nucleus [GO:0042307]; positive regulation of reactive oxygen species metabolic process [GO:2000379]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein complex oligomerization [GO:0051259]; protein deubiquitination [GO:0016579]; regulation of gene expression [GO:0010468]; RNA phosphodiester bond hydrolysis [GO:0090501]; RNA phosphodiester bond hydrolysis, endonucleolytic [GO:0090502]; T cell receptor signaling pathway [GO:0050852]"	cytoplasm [GO:0005737]; cytoplasmic ribonucleoprotein granule [GO:0036464]; cytoskeleton [GO:0005856]; extrinsic component of endoplasmic reticulum membrane [GO:0042406]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; P-body [GO:0000932]; protein-containing complex [GO:0032991]; rough endoplasmic reticulum [GO:0005791]; rough endoplasmic reticulum membrane [GO:0030867]	chromatin binding [GO:0003682]; DNA binding [GO:0003677]; endoribonuclease activity [GO:0004521]; exoribonuclease activity [GO:0004532]; metal ion binding [GO:0046872]; miRNA binding [GO:0035198]; mRNA 3'-UTR AU-rich region binding [GO:0035925]; mRNA 3'-UTR binding [GO:0003730]; mRNA binding [GO:0003729]; ribonuclease activity [GO:0004540]; ribosome binding [GO:0043022]; RNA binding [GO:0003723]; RNA stem-loop binding [GO:0035613]	VGGKRVVCYDDR	0.94518	0	0	0	0	0	0	0	0	0	0	10.4211	0
O15553	MEFV_HUMAN	Pyrin (Marenostrin)	MEFV MEF TRIM20	Homo sapiens (Human)	inflammatory response [GO:0006954]; innate immune response [GO:0045087]; negative regulation of cytokine production involved in inflammatory response [GO:1900016]; negative regulation of inflammatory response [GO:0050728]; negative regulation of interleukin-1 beta production [GO:0032691]; negative regulation of interleukin-12 production [GO:0032695]; negative regulation of macrophage inflammatory protein 1 alpha production [GO:0071641]; negative regulation of NLRP3 inflammasome complex assembly [GO:1900226]; pattern recognition receptor signaling pathway [GO:0002221]; positive regulation of autophagy [GO:0010508]; positive regulation of cysteine-type endopeptidase activity [GO:2001056]; positive regulation of interleukin-1 beta production [GO:0032731]; protein ubiquitination [GO:0016567]; pyroptosis [GO:0070269]; pyroptosome complex assembly [GO:1904270]; regulation of gene expression [GO:0010468]; regulation of interleukin-1 beta production [GO:0032651]; response to interferon-gamma [GO:0034341]	autophagosome [GO:0005776]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; inflammasome complex [GO:0061702]; lamellipodium [GO:0030027]; microtubule [GO:0005874]; microtubule associated complex [GO:0005875]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; ruffle [GO:0001726]	actin binding [GO:0003779]; identical protein binding [GO:0042802]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]	QLEHLKKLR	0.96595	0	10.3758	0	0	0	0	0	0	0	0	0	0
Q8IW36	ZN695_HUMAN	Zinc finger protein 695 (Zinc finger protein SBZF3)	ZNF695	Homo sapiens (Human)	regulation of DNA-templated transcription [GO:0006355]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	CCLEKLR	0.99836	0	10.3519	0	0	0	0	0	0	0	0	0	0
O14776	TCRG1_HUMAN	Transcription elongation regulator 1 (TATA box-binding protein-associated factor 2S) (Transcription factor CA150)	TCERG1 CA150 TAF2S	Homo sapiens (Human)	mRNA processing [GO:0006397]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transcription elongation by RNA polymerase II [GO:0034244]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of transcription elongation by RNA polymerase II [GO:0032968]; RNA splicing [GO:0008380]	nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	identical protein binding [GO:0042802]; RNA binding [GO:0003723]; RNA polymerase binding [GO:0070063]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; transcription coactivator activity [GO:0003713]; transcription coregulator activity [GO:0003712]; transcription corepressor activity [GO:0003714]; transcription elongation factor activity [GO:0003711]; ubiquitin-like protein conjugating enzyme binding [GO:0044390]	EEAIQNFK	0.93278	0	0	10.3198	0	0	0	0	0	0	0	0	0
Q8TBY8	PMFBP_HUMAN	Polyamine-modulated factor 1-binding protein 1 (PMF-1-binding protein)	PMFBP1	Homo sapiens (Human)	spermatogenesis [GO:0007283]	cytoplasm [GO:0005737]; sperm connecting piece [GO:0097224]		TESTQREK	0.99884	0	0	10.3198	0	0	0	0	0	0	0	0	0
P05546	HEP2_HUMAN	Heparin cofactor 2 (Heparin cofactor II) (HC-II) (Protease inhibitor leuserpin-2) (HLS2) (Serpin D1)	SERPIND1 HCF2	Homo sapiens (Human)	blood coagulation [GO:0007596]; chemotaxis [GO:0006935]; negative regulation of endopeptidase activity [GO:0010951]	endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]	endopeptidase inhibitor activity [GO:0004866]; heparin binding [GO:0008201]; serine-type endopeptidase inhibitor activity [GO:0004867]	GPLDQLEK	0.93896	0	0	0	0	10.2501	0	0	0	0	0	0	0
Q9NUX5	POTE1_HUMAN	Protection of telomeres protein 1 (hPot1) (POT1-like telomere end-binding protein)	POT1	Homo sapiens (Human)	DNA duplex unwinding [GO:0032508]; establishment of protein localization to telomere [GO:0070200]; negative regulation of telomerase activity [GO:0051974]; negative regulation of telomere maintenance via telomerase [GO:0032211]; positive regulation of DNA helicase activity [GO:1905776]; positive regulation of DNA strand elongation [GO:0060383]; positive regulation of helicase activity [GO:0051096]; positive regulation of telomerase activity [GO:0051973]; positive regulation of telomere maintenance [GO:0032206]; positive regulation of telomere maintenance via telomerase [GO:0032212]; regulation of DNA helicase activity [GO:1905774]; regulation of double-strand break repair via nonhomologous end joining [GO:2001032]; regulation of telomere maintenance via telomerase [GO:0032210]; telomere assembly [GO:0032202]; telomere capping [GO:0016233]; telomere maintenance via telomerase [GO:0007004]; telomeric D-loop disassembly [GO:0061820]	"chromosome, telomeric region [GO:0000781]; nuclear telomere cap complex [GO:0000783]; nucleoplasm [GO:0005654]; shelterin complex [GO:0070187]"	8-hydroxy-2'-deoxyguanosine DNA binding [GO:1905773]; DEAD/H-box RNA helicase binding [GO:0017151]; G-rich single-stranded DNA binding [GO:1990955]; G-rich strand telomeric DNA binding [GO:0098505]; single-stranded telomeric DNA binding [GO:0043047]; telomerase inhibitor activity [GO:0010521]; telomeric D-loop binding [GO:0061821]; telomeric DNA binding [GO:0042162]	GRKVAVHFVK	0.95847	0	0	0	0	0	0	0	0	0	10.2175	0	0
P51790	CLCN3_HUMAN	H(+)/Cl(-) exchange transporter 3 (Chloride channel protein 3) (ClC-3) (Chloride transporter ClC-3)	CLCN3	Homo sapiens (Human)	"adult locomotory behavior [GO:0008344]; chloride transmembrane transport [GO:1902476]; endosomal lumen acidification [GO:0048388]; negative regulation of cell volume [GO:0045794]; phagocytosis, engulfment [GO:0006911]; photoreceptor cell maintenance [GO:0045494]; positive regulation of reactive oxygen species biosynthetic process [GO:1903428]; regulation of pH [GO:0006885]; synaptic transmission, GABAergic [GO:0051932]; synaptic transmission, glutamatergic [GO:0035249]; synaptic vesicle lumen acidification [GO:0097401]"	apical plasma membrane [GO:0016324]; axon terminus [GO:0043679]; cell surface [GO:0009986]; cytoplasmic vesicle [GO:0031410]; early endosome [GO:0005769]; early endosome membrane [GO:0031901]; endosome membrane [GO:0010008]; external side of plasma membrane [GO:0009897]; GABA-ergic synapse [GO:0098982]; glutamatergic synapse [GO:0098978]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; inhibitory synapse [GO:0060077]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; integral component of postsynaptic membrane [GO:0099055]; integral component of synaptic vesicle membrane [GO:0030285]; intracellular membrane-bounded organelle [GO:0043231]; late endosome [GO:0005770]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; phagocytic vesicle [GO:0045335]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]; ruffle membrane [GO:0032587]; secretory granule [GO:0030141]; specific granule [GO:0042581]; synaptic vesicle [GO:0008021]; vesicle membrane [GO:0012506]	antiporter activity [GO:0015297]; ATP binding [GO:0005524]; chloride channel activity [GO:0005254]; PDZ domain binding [GO:0030165]; solute:proton antiporter activity [GO:0015299]; voltage-gated chloride channel activity [GO:0005247]; volume-sensitive chloride channel activity [GO:0072320]	DKCPQWK	0.99685	0	10.2123	0	0	0	0	0	0	0	0	0	0
Q8IYI0	SHLD1_HUMAN	Shieldin complex subunit 1 (RINN1-REV7-interacting novel NHEJ regulator 3) (Shield complex subunit 1)	SHLD1 C20orf196 RINN3	Homo sapiens (Human)	DNA repair [GO:0006281]; negative regulation of double-strand break repair via homologous recombination [GO:2000042]; positive regulation of double-strand break repair via nonhomologous end joining [GO:2001034]; positive regulation of isotype switching [GO:0045830]; somatic diversification of immunoglobulins involved in immune response [GO:0002208]; telomere maintenance in response to DNA damage [GO:0043247]	chromatin [GO:0000785]; chromosome [GO:0005694]; site of double-strand break [GO:0035861]		EEDDGLRK	0.99904	0	10.2123	0	0	0	0	0	0	0	0	0	0
Q8NFY9	KBTB8_HUMAN	Kelch repeat and BTB domain-containing protein 8 (T-cell activation kelch repeat protein) (TA-KRP)	KBTBD8 KIAA1842 TAKRP	Homo sapiens (Human)	neural crest cell development [GO:0014032]; neural crest formation [GO:0014029]; protein monoubiquitination [GO:0006513]; regulation of translation [GO:0006417]	Cul3-RING ubiquitin ligase complex [GO:0031463]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; spindle [GO:0005819]		HFECAVAK	0.93236	0	10.2123	0	0	0	0	0	0	0	0	0	0
Q9NP59	S40A1_HUMAN	Solute carrier family 40 member 1 (Ferroportin-1) (Iron-regulated transporter 1)	SLC40A1 FPN1 IREG1 SLC11A3 MSTP079	Homo sapiens (Human)	apoptotic process [GO:0006915]; cellular iron ion homeostasis [GO:0006879]; endothelium development [GO:0003158]; establishment of localization in cell [GO:0051649]; iron ion export across plasma membrane [GO:1903988]; iron ion homeostasis [GO:0055072]; iron ion transmembrane transport [GO:0034755]; lymphocyte homeostasis [GO:0002260]; multicellular organismal iron ion homeostasis [GO:0060586]; negative regulation of apoptotic process [GO:0043066]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of transcription from RNA polymerase II promoter in response to iron [GO:0034395]; spleen trabecula formation [GO:0060345]; transcription by RNA polymerase II [GO:0006366]	basolateral plasma membrane [GO:0016323]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; synaptic vesicle [GO:0008021]	ferrous iron transmembrane transporter activity [GO:0015093]; identical protein binding [GO:0042802]; iron ion transmembrane transporter activity [GO:0005381]; metal ion binding [GO:0046872]; peptide hormone binding [GO:0017046]	ENQANTSVV	0.94669	0	10.2123	0	0	0	0	0	0	0	0	0	0
Q15306	IRF4_HUMAN	Interferon regulatory factor 4 (IRF-4) (Lymphocyte-specific interferon regulatory factor) (LSIRF) (Multiple myeloma oncogene 1) (NF-EM5)	IRF4 MUM1	Homo sapiens (Human)	defense response to protozoan [GO:0042832]; histone H3 acetylation [GO:0043966]; histone H4 acetylation [GO:0043967]; immune system process [GO:0002376]; myeloid dendritic cell differentiation [GO:0043011]; negative regulation of toll-like receptor signaling pathway [GO:0034122]; positive regulation of cold-induced thermogenesis [GO:0120162]; positive regulation of DNA binding [GO:0043388]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of interleukin-10 production [GO:0032733]; positive regulation of interleukin-13 production [GO:0032736]; positive regulation of interleukin-2 production [GO:0032743]; positive regulation of interleukin-4 production [GO:0032753]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of T-helper cell differentiation [GO:0045622]; regulation of transcription by RNA polymerase II [GO:0006357]; T cell activation [GO:0042110]; T-helper 17 cell lineage commitment [GO:0072540]	chromatin [GO:0000785]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; nucleosome [GO:0000786]; nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]; sequence-specific double-stranded DNA binding [GO:1990837]; transcription coactivator activity [GO:0003713]"	SAEALAFSDCR	0.9369	10.1936	0	0	0	0	0	0	0	0	0	0	0
Q8NBU5	ATAD1_HUMAN	Outer mitochondrial transmembrane helix translocase (EC 7.4.2.-) (ATPase family AAA domain-containing protein 1) (hATAD1) (Thorase)	ATAD1 FNP001	Homo sapiens (Human)	"extraction of mislocalized protein from mitochondrial outer membrane [GO:0140570]; learning [GO:0007612]; memory [GO:0007613]; negative regulation of synaptic transmission, glutamatergic [GO:0051967]; positive regulation of receptor internalization [GO:0002092]; regulation of postsynaptic neurotransmitter receptor internalization [GO:0099149]"	anchoring junction [GO:0070161]; cytosol [GO:0005829]; glutamatergic synapse [GO:0098978]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; mitochondrial outer membrane [GO:0005741]; peroxisomal membrane [GO:0005778]; postsynaptic membrane [GO:0045211]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; transmembrane protein dislocase activity [GO:0140567]	VEAQKQAEK	0.99862	0	0	10.1903	0	0	0	0	0	0	0	0	0
O15041	SEM3E_HUMAN	Semaphorin-3E	SEMA3E KIAA0331 SEMAH	Homo sapiens (Human)	axon guidance [GO:0007411]; branching involved in blood vessel morphogenesis [GO:0001569]; gonadotrophin-releasing hormone neuronal migration to the hypothalamus [GO:0021828]; negative chemotaxis [GO:0050919]; negative regulation of angiogenesis [GO:0016525]; negative regulation of axon extension involved in axon guidance [GO:0048843]; negative regulation of cell-matrix adhesion [GO:0001953]; negative regulation of neuron apoptotic process [GO:0043524]; neural crest cell migration [GO:0001755]; positive regulation of cell migration [GO:0030335]; positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; regulation of actin cytoskeleton reorganization [GO:2000249]; regulation of cell shape [GO:0008360]; semaphorin-plexin signaling pathway [GO:0071526]; sprouting angiogenesis [GO:0002040]; synapse organization [GO:0050808]	extracellular region [GO:0005576]; extracellular space [GO:0005615]; integral component of plasma membrane [GO:0005887]	chemorepellent activity [GO:0045499]; receptor ligand activity [GO:0048018]; semaphorin receptor binding [GO:0030215]	DAGECANYVR	0.87523	0	10.1852	0	0	0	0	0	0	0	0	0	0
Q8NEY1	NAV1_HUMAN	Neuron navigator 1 (Pore membrane and/or filament-interacting-like protein 3) (Steerin-1) (Unc-53 homolog 1) (unc53H1)	NAV1 KIAA1151 KIAA1213 POMFIL3 STEERIN1	Homo sapiens (Human)	microtubule bundle formation [GO:0001578]; nervous system development [GO:0007399]; neuron migration [GO:0001764]	axon initial segment [GO:0043194]; cytoplasm [GO:0005737]; microtubule [GO:0005874]; microtubule cytoskeleton [GO:0015630]		APEAAVSEDGK	0.46328	10.1736	0	0	0	0	0	0	0	0	0	0	0
Q7L0X2	ERIP6_HUMAN	Glutamate-rich protein 6 (Protein FAM194A)	ERICH6 C3orf44 FAM194A	Homo sapiens (Human)				CEFCGSDLR	0.93685	0	10.1697	0	0	0	0	0	0	0	0	0	0
Q9Y275	TN13B_HUMAN	"Tumor necrosis factor ligand superfamily member 13B (B lymphocyte stimulator) (BLyS) (B-cell-activating factor) (BAFF) (Dendritic cell-derived TNF-like molecule) (TNF- and APOL-related leukocyte expressed ligand 1) (TALL-1) (CD antigen CD257) [Cleaved into: Tumor necrosis factor ligand superfamily member 13b, membrane form; Tumor necrosis factor ligand superfamily member 13b, soluble form]"	TNFSF13B BAFF BLYS TALL1 TNFSF20 ZTNF4 UNQ401/PRO738	Homo sapiens (Human)	B cell costimulation [GO:0031296]; B cell differentiation [GO:0030183]; B cell homeostasis [GO:0001782]; B cell proliferation [GO:0042100]; germinal center formation [GO:0002467]; positive regulation of B cell proliferation [GO:0030890]; positive regulation of germinal center formation [GO:0002636]; positive regulation of T cell proliferation [GO:0042102]; signal transduction [GO:0007165]; T cell costimulation [GO:0031295]; T cell proliferation [GO:0042098]; tumor necrosis factor-mediated signaling pathway [GO:0033209]	cytoplasm [GO:0005737]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; focal adhesion [GO:0005925]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]	cytokine activity [GO:0005125]; receptor ligand activity [GO:0048018]; signaling receptor binding [GO:0005102]; tumor necrosis factor receptor binding [GO:0005164]	MDDSTER	0.93746	0	0	0	10.1614	0	0	0	0	0	0	0	0
P05166	PCCB_HUMAN	"Propionyl-CoA carboxylase beta chain, mitochondrial (PCCase subunit beta) (EC 6.4.1.3) (Propanoyl-CoA:carbon dioxide ligase subunit beta)"	PCCB	Homo sapiens (Human)	branched-chain amino acid metabolic process [GO:0009081]; fatty acid metabolic process [GO:0006631]; short-chain fatty acid catabolic process [GO:0019626]	catalytic complex [GO:1902494]; cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]	ATP binding [GO:0005524]; propionyl-CoA carboxylase activity [GO:0004658]	THTTMSGVAHR	0.94069	0	10.1606	0	0	0	0	0	0	0	0	0	0
Q9BVM2	DPCD_HUMAN	Protein DPCD	DPCD	Homo sapiens (Human)	determination of left/right symmetry [GO:0007368]; epithelial cilium movement involved in extracellular fluid movement [GO:0003351]; establishment of localization in cell [GO:0051649]; flagellated sperm motility [GO:0030317]; lateral ventricle development [GO:0021670]; left/right pattern formation [GO:0060972]; spermatogenesis [GO:0007283]; third ventricle development [GO:0021678]	extracellular region [GO:0005576]; nucleus [GO:0005634]		EMAEEYDEK	0.94541	0	0	10.1542	0	0	0	0	0	0	0	0	0
P78352	DLG4_HUMAN	Disks large homolog 4 (Postsynaptic density protein 95) (PSD-95) (Synapse-associated protein 90) (SAP-90) (SAP90)	DLG4 PSD95	Homo sapiens (Human)	AMPA glutamate receptor clustering [GO:0097113]; cell-cell adhesion [GO:0098609]; cellular response to potassium ion [GO:0035865]; chemical synaptic transmission [GO:0007268]; dendritic spine morphogenesis [GO:0060997]; establishment of protein localization [GO:0045184]; establishment or maintenance of epithelial cell apical/basal polarity [GO:0045197]; learning [GO:0007612]; locomotory exploration behavior [GO:0035641]; negative regulation of receptor internalization [GO:0002091]; nervous system development [GO:0007399]; neuromuscular process controlling balance [GO:0050885]; neurotransmitter receptor localization to postsynaptic specialization membrane [GO:0099645]; positive regulation of AMPA glutamate receptor clustering [GO:1904719]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of excitatory postsynaptic potential [GO:2000463]; positive regulation of neuron projection arborization [GO:0150012]; positive regulation of protein tyrosine kinase activity [GO:0061098]; positive regulation of synaptic transmission [GO:0050806]; postsynaptic neurotransmitter receptor diffusion trapping [GO:0098970]; protein localization to synapse [GO:0035418]; protein-containing complex assembly [GO:0065003]; receptor clustering [GO:0043113]; receptor localization to synapse [GO:0097120]; regulation of grooming behavior [GO:2000821]; regulation of long-term neuronal synaptic plasticity [GO:0048169]; regulation of NMDA receptor activity [GO:2000310]; signal transduction [GO:0007165]; social behavior [GO:0035176]; synaptic vesicle maturation [GO:0016188]; vocalization behavior [GO:0071625]	adherens junction [GO:0005912]; AMPA glutamate receptor complex [GO:0032281]; anchored component of postsynaptic density membrane [GO:0099031]; cell junction [GO:0030054]; cerebellar mossy fiber [GO:0044300]; cortical cytoskeleton [GO:0030863]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite cytoplasm [GO:0032839]; dendritic spine [GO:0043197]; endocytic vesicle membrane [GO:0030666]; endoplasmic reticulum [GO:0005783]; excitatory synapse [GO:0060076]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]; glutamatergic synapse [GO:0098978]; juxtaparanode region of axon [GO:0044224]; neuromuscular junction [GO:0031594]; neuron projection [GO:0043005]; neuron projection terminus [GO:0044306]; neuron spine [GO:0044309]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; postsynaptic density membrane [GO:0098839]; postsynaptic membrane [GO:0045211]; synapse [GO:0045202]; synaptic membrane [GO:0097060]; synaptic vesicle [GO:0008021]; voltage-gated potassium channel complex [GO:0008076]	acetylcholine receptor binding [GO:0033130]; beta-1 adrenergic receptor binding [GO:0031697]; beta-2 adrenergic receptor binding [GO:0031698]; D1 dopamine receptor binding [GO:0031748]; frizzled binding [GO:0005109]; immunoglobulin binding [GO:0019865]; ionotropic glutamate receptor binding [GO:0035255]; kinase binding [GO:0019900]; kinesin binding [GO:0019894]; neuroligin family protein binding [GO:0097109]; P2Y1 nucleotide receptor binding [GO:0031812]; PDZ domain binding [GO:0030165]; protein C-terminus binding [GO:0008022]; protein kinase binding [GO:0019901]; protein phosphatase binding [GO:0019903]; protein-containing complex binding [GO:0044877]; scaffold protein binding [GO:0097110]; structural constituent of postsynaptic density [GO:0098919]	VERREWSR	0.9056	0	10.1453	0	0	0	0	0	0	0	0	0	0
Q9NQZ7	ENTP7_HUMAN	Ectonucleoside triphosphate diphosphohydrolase 7 (NTPDase 7) (EC 3.6.1.15) (Lysosomal apyrase-like protein 1)	ENTPD7 LALP1	Homo sapiens (Human)	CTP catabolic process [GO:0006254]; GTP metabolic process [GO:0046039]; nucleobase-containing small molecule catabolic process [GO:0034656]; nucleoside diphosphate catabolic process [GO:0009134]; regulation of immune response [GO:0050776]; T-helper 17 cell differentiation [GO:0072539]; UDP catabolic process [GO:0006256]; UTP catabolic process [GO:0046052]	cytoplasmic vesicle membrane [GO:0030659]; endocytic vesicle membrane [GO:0030666]; Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; membrane [GO:0016020]	CTPase activity [GO:0043273]; GDP phosphatase activity [GO:0004382]; GTPase activity [GO:0003924]; metal ion binding [GO:0046872]; nucleoside diphosphate phosphatase activity [GO:0017110]; ribonucleoside triphosphate phosphatase activity [GO:0017111]; UDP phosphatase activity [GO:0045134]	NRLLGQK	0.9974	0	10.1438	0	0	0	0	0	0	0	0	0	0
Q5T8P6	RBM26_HUMAN	RNA-binding protein 26 (CTCL tumor antigen se70-2) (RNA-binding motif protein 26)	RBM26 C13orf10 PRO1777	Homo sapiens (Human)	mRNA processing [GO:0006397]	nucleus [GO:0005634]	metal ion binding [GO:0046872]; RNA binding [GO:0003723]	AISSTEAVLNNRFIK	0.83368	0	0	0	0	0	0	0	10.1412	0	0	0	0
Q03468	ERCC6_HUMAN	DNA excision repair protein ERCC-6 (EC 3.6.4.-) (ATP-dependent helicase ERCC6) (Cockayne syndrome protein CSB)	ERCC6 CSB	Homo sapiens (Human)	"base-excision repair [GO:0006284]; chromatin remodeling [GO:0006338]; DNA damage checkpoint signaling [GO:0000077]; DNA protection [GO:0042262]; DNA repair [GO:0006281]; double-strand break repair via classical nonhomologous end joining [GO:0097680]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; JNK cascade [GO:0007254]; multicellular organism growth [GO:0035264]; negative regulation of double-strand break repair via nonhomologous end joining [GO:2001033]; neurogenesis [GO:0022008]; neuron differentiation [GO:0030182]; neuron projection development [GO:0031175]; photoreceptor cell maintenance [GO:0045494]; positive regulation of DNA repair [GO:0045739]; positive regulation of DNA-templated transcription, elongation [GO:0032786]; positive regulation of double-strand break repair via homologous recombination [GO:1905168]; positive regulation of histone acetylation [GO:0035066]; positive regulation of transcription by RNA polymerase I [GO:0045943]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of transcription by RNA polymerase III [GO:0045945]; positive regulation of transcription initiation by RNA polymerase II [GO:0060261]; pyrimidine dimer repair [GO:0006290]; regulation of DNA-templated transcription elongation [GO:0032784]; regulation of transcription elongation by RNA polymerase II [GO:0034243]; response to gamma radiation [GO:0010332]; response to oxidative stress [GO:0006979]; response to superoxide [GO:0000303]; response to toxic substance [GO:0009636]; response to UV [GO:0009411]; response to UV-B [GO:0010224]; response to X-ray [GO:0010165]; single strand break repair [GO:0000012]; transcription by RNA polymerase II [GO:0006366]; transcription elongation by RNA polymerase I [GO:0006362]; transcription-coupled nucleotide-excision repair [GO:0006283]"	B-WICH complex [GO:0110016]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; site of DNA damage [GO:0090734]; transcription elongation factor complex [GO:0008023]	"ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent activity, acting on DNA [GO:0008094]; ATP-dependent chromatin remodeler activity [GO:0140658]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; helicase activity [GO:0004386]; protein C-terminus binding [GO:0008022]; protein N-terminus binding [GO:0047485]; protein tyrosine kinase activator activity [GO:0030296]; protein-containing complex binding [GO:0044877]; RNA polymerase binding [GO:0070063]"	DDPHMSSNVTSNDR	0.93819	0	0	0	0	0	0	10.1073	0	0	0	0	0
O75962	TRIO_HUMAN	Triple functional domain protein (EC 2.7.11.1) (PTPRF-interacting protein)	TRIO	Homo sapiens (Human)	axon guidance [GO:0007411]; central nervous system development [GO:0007417]; negative regulation of fat cell differentiation [GO:0045599]; neuron projection morphogenesis [GO:0048812]; protein phosphorylation [GO:0006468]; regulation of small GTPase mediated signal transduction [GO:0051056]; transmembrane receptor protein tyrosine phosphatase signaling pathway [GO:0007185]	cell projection [GO:0042995]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extrinsic component of membrane [GO:0019898]	ATP binding [GO:0005524]; guanyl-nucleotide exchange factor activity [GO:0005085]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	DSSGRSKYLYK	0.87593	0	0	0	0	0	10.0916	0	0	0	0	0	0
O60244	MED14_HUMAN	Mediator of RNA polymerase II transcription subunit 14 (Activator-recruited cofactor 150 kDa component) (ARC150) (Cofactor required for Sp1 transcriptional activation subunit 2) (CRSP complex subunit 2) (Mediator complex subunit 14) (RGR1 homolog) (hRGR1) (Thyroid hormone receptor-associated protein complex 170 kDa component) (Trap170) (Transcriptional coactivator CRSP150) (Vitamin D3 receptor-interacting protein complex 150 kDa component) (DRIP150)	MED14 ARC150 CRSP2 CXorf4 DRIP150 EXLM1 RGR1 TRAP170	Homo sapiens (Human)	positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of transcription elongation by RNA polymerase II [GO:0032968]; positive regulation of transcription initiation by RNA polymerase II [GO:0060261]; regulation of transcription by RNA polymerase II [GO:0006357]; RNA polymerase II preinitiation complex assembly [GO:0051123]; somatic stem cell population maintenance [GO:0035019]	core mediator complex [GO:0070847]; mediator complex [GO:0016592]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	nuclear receptor coactivator activity [GO:0030374]; nuclear vitamin D receptor binding [GO:0042809]; transcription coactivator activity [GO:0003713]; transcription coregulator activity [GO:0003712]	FAEMNPPR	0.94197	0	0	0	0	0	0	0	10.0772	0	0	0	0
Q8IZ21	PHAR4_HUMAN	Phosphatase and actin regulator 4	PHACTR4 PRO2963	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; closure of optic fissure [GO:0061386]; enteric nervous system development [GO:0048484]; negative regulation of integrin-mediated signaling pathway [GO:2001045]; neural crest cell migration [GO:0001755]; neural tube closure [GO:0001843]; positive regulation of catalytic activity [GO:0043085]; regulation of cell cycle [GO:0051726]; Rho protein signal transduction [GO:0007266]	cytoplasm [GO:0005737]; lamellipodium [GO:0030027]	actin binding [GO:0003779]; protein phosphatase 1 binding [GO:0008157]; protein phosphatase activator activity [GO:0072542]	TPSDEREK	1.0005	0	0	0	0	0	0	0	10.0772	0	0	0	0
Q13127	REST_HUMAN	RE1-silencing transcription factor (Neural-restrictive silencer factor) (X2 box repressor)	REST NRSF XBR	Homo sapiens (Human)	"auditory receptor cell stereocilium organization [GO:0060088]; cardiac muscle cell myoblast differentiation [GO:0060379]; cellular response to electrical stimulus [GO:0071257]; cellular response to glucocorticoid stimulus [GO:0071385]; cellular response to xenobiotic stimulus [GO:0071466]; detection of mechanical stimulus involved in sensory perception of sound [GO:0050910]; hematopoietic progenitor cell differentiation [GO:0002244]; histone H4 deacetylation [GO:0070933]; modification of synaptic structure [GO:0099563]; negative regulation by host of viral transcription [GO:0043922]; negative regulation of aldosterone biosynthetic process [GO:0032348]; negative regulation of amniotic stem cell differentiation [GO:2000798]; negative regulation of calcium ion-dependent exocytosis [GO:0045955]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cortisol biosynthetic process [GO:2000065]; negative regulation of dense core granule biogenesis [GO:2000706]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of gene expression [GO:0010629]; negative regulation of insulin secretion [GO:0046676]; negative regulation of mesenchymal stem cell differentiation [GO:2000740]; negative regulation of miRNA transcription [GO:1902894]; negative regulation of neurogenesis [GO:0050768]; negative regulation of neuron differentiation [GO:0045665]; negative regulation of oxidative stress-induced neuron death [GO:1903204]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of transcription regulatory region DNA binding [GO:2000678]; neuromuscular process controlling balance [GO:0050885]; neuronal stem cell population maintenance [GO:0097150]; positive regulation of apoptotic process [GO:0043065]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of gene expression [GO:0010628]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of oxidative stress-induced neuron death [GO:1903223]; positive regulation of stem cell population maintenance [GO:1902459]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]; regulation of DNA-templated transcription [GO:0006355]; regulation of gene expression [GO:0010468]; regulation of osteoblast differentiation [GO:0045667]; regulation of oxidative stress-induced neuron death [GO:1903203]; response to hypoxia [GO:0001666]; response to ischemia [GO:0002931]; somatic stem cell population maintenance [GO:0035019]"	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription repressor complex [GO:0017053]	"chromatin binding [GO:0003682]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II core promoter sequence-specific DNA binding [GO:0000979]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; transcription cis-regulatory region binding [GO:0000976]"	KCNLQYHFK	1	0	0	10.067	0	0	0	0	0	0	0	0	0
P21580	TNAP3_HUMAN	Tumor necrosis factor alpha-induced protein 3 (TNF alpha-induced protein 3) (EC 2.3.2.-) (EC 3.4.19.12) (OTU domain-containing protein 7C) (Putative DNA-binding protein A20) (Zinc finger protein A20) [Cleaved into: A20p50; A20p37]	TNFAIP3 OTUD7C	Homo sapiens (Human)	apoptotic process [GO:0006915]; B-1 B cell homeostasis [GO:0001922]; cell migration [GO:0016477]; cellular response to hydrogen peroxide [GO:0070301]; cellular response to lipopolysaccharide [GO:0071222]; cytoskeleton organization [GO:0007010]; establishment of protein localization to vacuole [GO:0072666]; inflammatory response [GO:0006954]; negative regulation of B cell activation [GO:0050869]; negative regulation of bone resorption [GO:0045779]; negative regulation of CD40 signaling pathway [GO:2000349]; negative regulation of chronic inflammatory response [GO:0002677]; negative regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0045736]; negative regulation of endothelial cell apoptotic process [GO:2000352]; negative regulation of extrinsic apoptotic signaling pathway via death domain receptors [GO:1902042]; negative regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043124]; negative regulation of inflammatory response [GO:0050728]; negative regulation of innate immune response [GO:0045824]; negative regulation of interleukin-1 beta production [GO:0032691]; negative regulation of interleukin-2 production [GO:0032703]; negative regulation of interleukin-6 production [GO:0032715]; negative regulation of NF-kappaB transcription factor activity [GO:0032088]; negative regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway [GO:0070429]; negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway [GO:0070433]; negative regulation of osteoclast proliferation [GO:0090291]; negative regulation of protein ubiquitination [GO:0031397]; negative regulation of smooth muscle cell proliferation [GO:0048662]; negative regulation of toll-like receptor 2 signaling pathway [GO:0034136]; negative regulation of toll-like receptor 3 signaling pathway [GO:0034140]; negative regulation of toll-like receptor 4 signaling pathway [GO:0034144]; negative regulation of toll-like receptor 5 signaling pathway [GO:0034148]; negative regulation of tumor necrosis factor production [GO:0032720]; nucleotide-binding oligomerization domain containing signaling pathway [GO:0070423]; positive regulation of hepatocyte proliferation [GO:2000347]; positive regulation of protein catabolic process [GO:0045732]; positive regulation of Wnt signaling pathway [GO:0030177]; protein deubiquitination [GO:0016579]; protein deubiquitination involved in ubiquitin-dependent protein catabolic process [GO:0071947]; protein K11-linked deubiquitination [GO:0035871]; protein K29-linked deubiquitination [GO:0035523]; protein K33-linked deubiquitination [GO:1990168]; protein K48-linked deubiquitination [GO:0071108]; protein K48-linked ubiquitination [GO:0070936]; protein K63-linked deubiquitination [GO:0070536]; regulation of defense response to virus by host [GO:0050691]; regulation of germinal center formation [GO:0002634]; regulation of tumor necrosis factor-mediated signaling pathway [GO:0010803]; regulation of vascular wound healing [GO:0061043]; response to molecule of bacterial origin [GO:0002237]; response to muramyl dipeptide [GO:0032495]; tolerance induction to lipopolysaccharide [GO:0072573]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; lysosome [GO:0005764]; nucleus [GO:0005634]	cysteine-type deubiquitinase activity [GO:0004843]; DNA binding [GO:0003677]; identical protein binding [GO:0042802]; K63-linked polyubiquitin modification-dependent protein binding [GO:0070530]; kinase binding [GO:0019900]; Lys63-specific deubiquitinase activity [GO:0061578]; protease binding [GO:0002020]; protein C-terminus binding [GO:0008022]; protein self-association [GO:0043621]; ubiquitin binding [GO:0043130]; ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]	AVPLVNRDR	0.99618	0	10.0653	0	0	0	0	0	0	0	0	0	0
P49588	SYAC_HUMAN	"Alanine--tRNA ligase, cytoplasmic (EC 6.1.1.7) (Alanyl-tRNA synthetase) (AlaRS) (Renal carcinoma antigen NY-REN-42)"	AARS1 AARS	Homo sapiens (Human)	alanyl-tRNA aminoacylation [GO:0006419]; cerebellar Purkinje cell layer development [GO:0021680]; negative regulation of neuron apoptotic process [GO:0043524]; neuromuscular process controlling balance [GO:0050885]; neuron apoptotic process [GO:0051402]; regulation of cytoplasmic translational fidelity [GO:0140018]; tRNA aminoacylation for protein translation [GO:0006418]; tRNA modification [GO:0006400]; tRNA processing [GO:0008033]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; membrane [GO:0016020]; mitochondrion [GO:0005739]	alanine-tRNA ligase activity [GO:0004813]; amino acid binding [GO:0016597]; aminoacyl-tRNA editing activity [GO:0002161]; ATP binding [GO:0005524]; Ser-tRNA(Ala) hydrolase activity [GO:0002196]; translation regulator activity [GO:0045182]; tRNA binding [GO:0000049]; zinc ion binding [GO:0008270]	ASEWVQQVSGLMDGKGGGK	0.85997	0	10.0653	0	0	0	0	0	0	0	0	0	0
Q9Y4G6	TLN2_HUMAN	Talin-2	TLN2 KIAA0320	Homo sapiens (Human)	cell adhesion [GO:0007155]; cell-cell adhesion [GO:0098609]; cell-cell junction assembly [GO:0007043]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; focal adhesion [GO:0005925]; plasma membrane [GO:0005886]; ruffle [GO:0001726]; synapse [GO:0045202]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; integrin binding [GO:0005178]; structural constituent of cytoskeleton [GO:0005200]; structural molecule activity [GO:0005198]	DVPEKTSSPEESIRMTK	0.86716	0	10.0653	0	0	0	0	0	0	0	0	0	0
Q8N4P2	TT30B_HUMAN	Tetratricopeptide repeat protein 30B (TPR repeat protein 30B)	TTC30B	Homo sapiens (Human)	cilium assembly [GO:0060271]; intraciliary anterograde transport [GO:0035720]; intraciliary transport [GO:0042073]	axonemal microtubule [GO:0005879]; ciliary tip [GO:0097542]; cilium [GO:0005929]; intraciliary transport particle B [GO:0030992]	intraciliary transport particle B binding [GO:0120170]	HNRDDEAIKK	0.94329	0	0	0	0	0	0	0	10.0618	0	0	0	0
Q9P2P1	NYNRI_HUMAN	Protein NYNRIN (NYN domain and retroviral integrase catalytic domain-containing protein) (Protein cousin of GIN1)	NYNRIN CGIN1 KIAA1305	Homo sapiens (Human)	"DNA integration [GO:0015074]; DNA repair [GO:0006281]; RNA phosphodiester bond hydrolysis, endonucleolytic [GO:0090502]"	cytoplasmic ribonucleoprotein granule [GO:0036464]; integral component of membrane [GO:0016021]; nucleus [GO:0005634]	endoribonuclease activity [GO:0004521]; mRNA binding [GO:0003729]; RNA-DNA hybrid ribonuclease activity [GO:0004523]	GQGQAGR	0.84749	0	0	0	0	0	10.0531	0	0	0	0	0	0
Q8WW33	GTSF1_HUMAN	Gametocyte-specific factor 1 (Protein FAM112B)	GTSF1 FAM112B	Homo sapiens (Human)	cell differentiation [GO:0030154]; spermatogenesis [GO:0007283]	cytoplasm [GO:0005737]	metal ion binding [GO:0046872]	EETYTDSLDPEK	0.87006	10.043	0	0	0	0	0	0	0	0	0	0	0
Q14008	CKAP5_HUMAN	Cytoskeleton-associated protein 5 (Colonic and hepatic tumor overexpressed gene protein) (Ch-TOG)	CKAP5 KIAA0097	Homo sapiens (Human)	cell division [GO:0051301]; centrosome cycle [GO:0007098]; centrosome duplication [GO:0051298]; establishment or maintenance of microtubule cytoskeleton polarity [GO:0030951]; microtubule depolymerization [GO:0007019]; microtubule polymerization [GO:0046785]; mitotic spindle organization [GO:0007052]; positive regulation of microtubule nucleation [GO:0090063]; RNA transport [GO:0050658]; spindle organization [GO:0007051]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; kinetochore [GO:0000776]; membrane [GO:0016020]; nucleolus [GO:0005730]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; spindle pole [GO:0000922]	cadherin binding [GO:0045296]; microtubule binding [GO:0008017]; microtubule plus end polymerase [GO:0061863]; microtubule plus-end binding [GO:0051010]; ribonucleoprotein complex binding [GO:0043021]	AVELMDR	0.94357	0	0	0	0	0	0	0	10.0311	0	0	0	0
O14686	KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D (Lysine N-methyltransferase 2D) (EC 2.1.1.364) (ALL1-related protein) (Myeloid/lymphoid or mixed-lineage leukemia protein 2)	KMT2D ALR MLL2 MLL4	Homo sapiens (Human)	beta-catenin-TCF complex assembly [GO:1904837]; heterochromatin assembly [GO:0031507]; histone H3-K4 dimethylation [GO:0044648]; histone H3-K4 methylation [GO:0051568]; histone H3-K4 monomethylation [GO:0097692]; histone H3-K4 trimethylation [GO:0080182]; oocyte growth [GO:0001555]; oogenesis [GO:0048477]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of intracellular estrogen receptor signaling pathway [GO:0033148]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of DNA-templated transcription [GO:0006355]; response to estrogen [GO:0043627]	histone methyltransferase complex [GO:0035097]; MLL3/4 complex [GO:0044666]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	DNA binding [GO:0003677]; histone binding [GO:0042393]; histone methyltransferase activity (H3-K4 specific) [GO:0042800]; metal ion binding [GO:0046872]; transcription cis-regulatory region binding [GO:0000976]; transcription coactivator activity [GO:0003713]	EVAEFMEQLGTALRPDK	0.58407	0	0	0	0	0	0	0	0	10.0272	0	0	0
Q68DE3	USF3_HUMAN	Basic helix-loop-helix domain-containing protein USF3 (Upstream transcription factor 3)	USF3 KIAA2018	Homo sapiens (Human)	negative regulation of epithelial to mesenchymal transition [GO:0010719]; positive regulation of transcription by RNA polymerase II [GO:0045944]	nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; protein dimerization activity [GO:0046983]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	LSYPPVQSIPTGNGIPSR	0.58871	0	0	0	10.0158	0	0	0	0	0	0	0	0
Q86T82	UBP37_HUMAN	Ubiquitin carboxyl-terminal hydrolase 37 (EC 3.4.19.12) (Deubiquitinating enzyme 37) (Ubiquitin thioesterase 37) (Ubiquitin-specific-processing protease 37)	USP37 KIAA1594	Homo sapiens (Human)	cell division [GO:0051301]; G1/S transition of mitotic cell cycle [GO:0000082]; protein deubiquitination [GO:0016579]; protein K11-linked deubiquitination [GO:0035871]; protein K48-linked deubiquitination [GO:0071108]; regulation of DNA replication [GO:0006275]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; protein kinase binding [GO:0019901]	ENKVSLVVHYNTGGIPR	0.87966	0	0	0	10.0158	0	0	0	0	0	0	0	0
P30532	ACHA5_HUMAN	Neuronal acetylcholine receptor subunit alpha-5	CHRNA5 NACHRA5	Homo sapiens (Human)	"behavioral response to nicotine [GO:0035095]; chemical synaptic transmission [GO:0007268]; ion transmembrane transport [GO:0034220]; membrane depolarization [GO:0051899]; nervous system process [GO:0050877]; regulation of membrane potential [GO:0042391]; regulation of synaptic vesicle exocytosis [GO:2000300]; response to nicotine [GO:0035094]; signal transduction [GO:0007165]; synaptic transmission, cholinergic [GO:0007271]"	acetylcholine-gated channel complex [GO:0005892]; anchoring junction [GO:0070161]; dopaminergic synapse [GO:0098691]; integral component of plasma membrane [GO:0005887]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]; postsynaptic membrane [GO:0045211]; synapse [GO:0045202]	acetylcholine receptor activity [GO:0015464]; acetylcholine-gated cation-selective channel activity [GO:0022848]; excitatory extracellular ligand-gated ion channel activity [GO:0005231]; ligand-gated ion channel activity [GO:0015276]; neurotransmitter receptor activity [GO:0030594]; transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential [GO:1904315]	FGLAISQLVDVDEK	0.67931	0	0	0	0	0	0	0	0	10.0079	0	0	0
P50851	LRBA_HUMAN	Lipopolysaccharide-responsive and beige-like anchor protein (Beige-like protein) (CDC4-like protein)	LRBA BGL CDC4L LBA	Homo sapiens (Human)	mitophagy [GO:0000423]; protein localization [GO:0008104]; protein localization to phagophore assembly site [GO:0034497]	cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; plasma membrane [GO:0005886]	protein kinase binding [GO:0019901]	YGPDAFFNFPGK	0.99881	10.002	0	0	0	0	0	0	0	0	0	0	0
P21399	ACOHC_HUMAN	Cytoplasmic aconitate hydratase (Aconitase) (EC 4.2.1.3) (Citrate hydro-lyase) (Ferritin repressor protein) (Iron regulatory protein 1) (IRP1) (Iron-responsive element-binding protein 1) (IRE-BP 1)	ACO1 IREB1	Homo sapiens (Human)	cellular iron ion homeostasis [GO:0006879]; citrate metabolic process [GO:0006101]; intestinal absorption [GO:0050892]; post-embryonic development [GO:0009791]; regulation of translation [GO:0006417]; response to iron(II) ion [GO:0010040]; tricarboxylic acid cycle [GO:0006099]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; mitochondrion [GO:0005739]	"3 iron, 4 sulfur cluster binding [GO:0051538]; 4 iron, 4 sulfur cluster binding [GO:0051539]; aconitate hydratase activity [GO:0003994]; citrate dehydratase activity [GO:0047780]; iron-responsive element binding [GO:0030350]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]"	LFFWNSKSTYIK	0.85974	0	0	0	0	0	0	0	9.99322	0	0	0	0
Q6DKJ4	NXN_HUMAN	Nucleoredoxin (EC 1.8.1.8)	NXN NRX	Homo sapiens (Human)	cell differentiation [GO:0030154]; circulatory system development [GO:0072359]; in utero embryonic development [GO:0001701]; negative regulation of protein ubiquitination [GO:0031397]; negative regulation of Wnt signaling pathway [GO:0030178]; Wnt signaling pathway [GO:0016055]	cytosol [GO:0005829]; nucleus [GO:0005634]	thioredoxin-disulfide reductase activity [GO:0004791]	RLEIVFVSSDQDQR	0.99952	0	0	0	0	0	0	0	9.98428	0	0	0	0
Q5TCS8	KAD9_HUMAN	Adenylate kinase 9 (AK 9) (EC 2.7.4.4) (EC 2.7.4.6) (Adenylate kinase domain-containing protein 1) (Adenylate kinase domain-containing protein 2)	AK9 AKD1 AKD2 C6orf199 C6orf224	Homo sapiens (Human)	AMP phosphorylation [GO:0006756]; ATP generation from ADP [GO:0006757]; CDP phosphorylation [GO:0061508]; CMP phosphorylation [GO:0061566]; dADP phosphorylation [GO:0006174]; dAMP phosphorylation [GO:0061565]; dCDP phosphorylation [GO:0061570]; dCMP phosphorylation [GO:0061567]; dGDP phosphorylation [GO:0006186]; GDP phosphorylation [GO:0061568]; TDP phosphorylation [GO:0061571]; UDP phosphorylation [GO:0061569]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; mitochondrion [GO:0005739]; nuclear membrane [GO:0031965]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	adenylate kinase activity [GO:0004017]; ATP binding [GO:0005524]; nucleoside diphosphate kinase activity [GO:0004550]; nucleoside monophosphate kinase activity [GO:0050145]	FMKNPIK	0.97454	0	0	0	9.98342	0	0	0	0	0	0	0	0
O75489	NDUS3_HUMAN	"NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial (EC 7.1.1.2) (Complex I-30kD) (CI-30kD) (NADH-ubiquinone oxidoreductase 30 kDa subunit)"	NDUFS3	Homo sapiens (Human)	"aerobic respiration [GO:0009060]; mitochondrial electron transport, NADH to ubiquinone [GO:0006120]; mitochondrial respiratory chain complex I assembly [GO:0032981]; negative regulation of cell growth [GO:0030308]; negative regulation of intrinsic apoptotic signaling pathway [GO:2001243]; proton motive force-driven mitochondrial ATP synthesis [GO:0042776]; reactive oxygen species metabolic process [GO:0072593]; substantia nigra development [GO:0021762]"	mitochondrial inner membrane [GO:0005743]; mitochondrial matrix [GO:0005759]; mitochondrial membrane [GO:0031966]; mitochondrial respiratory chain complex I [GO:0005747]; mitochondrion [GO:0005739]; nuclear body [GO:0016604]	electron transfer activity [GO:0009055]; NADH dehydrogenase (ubiquinone) activity [GO:0008137]; NADH dehydrogenase activity [GO:0003954]	KDFPLSGYVELRYDDEVK	0.93744	0	9.98042	0	0	0	0	0	0	0	0	0	0
O14772	FPGT_HUMAN	Fucose-1-phosphate guanylyltransferase (EC 2.7.7.30) (GDP-L-fucose diphosphorylase) (GDP-L-fucose pyrophosphorylase)	FPGT GFPP	Homo sapiens (Human)	fucose metabolic process [GO:0006004]	cytoplasm [GO:0005737]; cytosol [GO:0005829]	catalytic activity [GO:0003824]; fucose-1-phosphate guanylyltransferase activity [GO:0047341]; GTP binding [GO:0005525]	CLKYATMAFGVQDNLKK	0.80488	9.97154	0	0	0	0	0	0	0	0	0	0	0
Q5W0Q7	USPL1_HUMAN	SUMO-specific isopeptidase USPL1 (EC 3.4.22.-) (Ubiquitin-specific peptidase-like protein 1) (USP-like 1)	USPL1 C13orf22 D13S106	Homo sapiens (Human)	Cajal body organization [GO:0030576]; cell population proliferation [GO:0008283]; protein desumoylation [GO:0016926]; snRNA transcription [GO:0009301]	Cajal body [GO:0015030]; extracellular space [GO:0005615]	deSUMOylase activity [GO:0016929]; SUMO binding [GO:0032183]	VPSDEYCPACR	0.93897	0	0	0	0	0	9.96737	0	0	0	0	0	0
Q6KF10	GDF6_HUMAN	Growth/differentiation factor 6 (GDF-6) (Bone morphogenetic protein 13) (BMP-13) (Growth/differentiation factor 16)	GDF6 BMP13 GDF16	Homo sapiens (Human)	activin receptor signaling pathway [GO:0032924]; apoptotic process [GO:0006915]; BMP signaling pathway [GO:0030509]; cell migration involved in metanephros development [GO:0035788]; fat cell differentiation [GO:0045444]; metanephros development [GO:0001656]; pathway-restricted SMAD protein phosphorylation [GO:0060389]; positive regulation of chondrocyte differentiation [GO:0032332]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of p38MAPK cascade [GO:1900745]; positive regulation of pathway-restricted SMAD protein phosphorylation [GO:0010862]; retinal cell apoptotic process [GO:1990009]; SMAD protein signal transduction [GO:0060395]	extracellular space [GO:0005615]	cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; identical protein binding [GO:0042802]	KPLHVNFK	0.9374	0	0	0	0	0	9.96694	0	0	0	0	0	0
Q96NN9	AIFM3_HUMAN	Apoptosis-inducing factor 3 (EC 1.-.-.-) (Apoptosis-inducing factor-like protein)	AIFM3 AIFL	Homo sapiens (Human)	execution phase of apoptosis [GO:0097194]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]	"2 iron, 2 sulfur cluster binding [GO:0051537]; flavin adenine dinucleotide binding [GO:0050660]; metal ion binding [GO:0046872]; oxidoreductase activity, acting on NAD(P)H [GO:0016651]"	LLLAPGSSPK	0.86692	0	0	0	0	0	9.96694	0	0	0	0	0	0
Q86UQ4	ABCAD_HUMAN	ATP-binding cassette sub-family A member 13 (EC 7.6.2.-)	ABCA13	Homo sapiens (Human)	ceramide transport [GO:0035627]; lipid transport [GO:0006869]; positive regulation of cholesterol transport [GO:0032376]; positive regulation of synaptic vesicle endocytosis [GO:1900244]	azurophil granule membrane [GO:0035577]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; intracellular vesicle [GO:0097708]; plasma membrane [GO:0005886]; secretory granule membrane [GO:0030667]	ABC-type transporter activity [GO:0140359]; ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626]; lipid transporter activity [GO:0005319]	LLGSVEDADR	0.94603	0	9.96181	0	0	0	0	0	0	0	0	0	0
Q96RW7	HMCN1_HUMAN	Hemicentin-1 (Fibulin-6) (FIBL-6)	HMCN1 FIBL6	Homo sapiens (Human)	actin filament reorganization [GO:0090527]; basement membrane organization [GO:0071711]; cell cycle [GO:0007049]; cell division [GO:0051301]; heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules [GO:0007157]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; response to bacterium [GO:0009617]; visual perception [GO:0007601]	adherens junction [GO:0005912]; basement membrane [GO:0005604]; cell cortex [GO:0005938]; cleavage furrow [GO:0032154]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; extracellular exosome [GO:0070062]; muscle tendon junction [GO:0005927]	calcium ion binding [GO:0005509]; extracellular matrix structural constituent [GO:0005201]	FSPVRNNYQPQQHYR	0.92167	0	0	9.96029	0	0	0	0	0	0	0	0	0
C9J069	AJM1_HUMAN	Apical junction component 1 homolog	AJM1 C9orf172	Homo sapiens (Human)	cell-cell junction organization [GO:0045216]	adherens junction [GO:0005912]; apical junction complex [GO:0043296]; apical plasma membrane [GO:0016324]; cilium [GO:0005929]; plasma membrane [GO:0005886]		RYAALSLSETSLTEKGR	0.92051	0	9.95082	0	0	0	0	0	0	0	0	0	0
Q5TC12	ATPF1_HUMAN	ATP synthase mitochondrial F1 complex assembly factor 1 (ATP11 homolog)	ATPAF1 ATP11	Homo sapiens (Human)	mitochondrial proton-transporting ATP synthase complex assembly [GO:0033615]	mitochondrion [GO:0005739]		DKTLSSIFNIEMVKEK	0.95777	0	9.95082	0	0	0	0	0	0	0	0	0	0
Q86Y26	NUTM1_HUMAN	NUT family member 1 (Nuclear protein in testis)	NUTM1 C15orf55 NUT	Homo sapiens (Human)		cytoplasm [GO:0005737]; nucleus [GO:0005634]		ATSSHQGLGSTLPRRGTR	0.93656	0	9.95082	0	0	0	0	0	0	0	0	0	0
Q9Y620	RA54B_HUMAN	DNA repair and recombination protein RAD54B (EC 3.6.4.-) (RAD54 homolog B)	RAD54B	Homo sapiens (Human)	determination of adult lifespan [GO:0008340]; double-strand break repair via homologous recombination [GO:0000724]; mitotic recombination [GO:0006312]; reciprocal meiotic recombination [GO:0007131]; response to ionizing radiation [GO:0010212]; response to xenobiotic stimulus [GO:0009410]	nucleus [GO:0005634]	ATP binding [GO:0005524]; ATP-dependent chromatin remodeler activity [GO:0140658]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; DNA translocase activity [GO:0015616]; hydrolase activity [GO:0016787]; RNA helicase activity [GO:0003724]	SNPGLNEEITKLNPDIK	0.87681	0	9.95082	0	0	0	0	0	0	0	0	0	0
O15085	ARHGB_HUMAN	Rho guanine nucleotide exchange factor 11 (PDZ-RhoGEF)	ARHGEF11 KIAA0380	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; establishment of cell polarity [GO:0030010]; G protein-coupled receptor signaling pathway [GO:0007186]; positive regulation of DNA-templated transcription [GO:0045893]; regulation of cell growth [GO:0001558]; regulation of small GTPase mediated signal transduction [GO:0051056]; Rho protein signal transduction [GO:0007266]; striated muscle contraction [GO:0006941]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]	G protein-coupled receptor binding [GO:0001664]; GTPase activator activity [GO:0005096]; guanyl-nucleotide exchange factor activity [GO:0005085]	SESLKGREEMK	0.9389	9.9468	0	0	0	0	0	0	0	0	0	0	0
Q702N8	XIRP1_HUMAN	Xin actin-binding repeat-containing protein 1 (Cardiomyopathy-associated protein 1)	XIRP1 CMYA1 XIN	Homo sapiens (Human)	actin filament organization [GO:0007015]; negative regulation of protein binding [GO:0032091]	anchoring junction [GO:0070161]	actin filament binding [GO:0051015]; RNA binding [GO:0003723]	ESFSKFHQQR	1	9.9468	0	0	0	0	0	0	0	0	0	0	0
Q7Z3V5	ZN571_HUMAN	Zinc finger protein 571	ZNF571 HSPC059	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	AFILGSQLTYHQR	0.51724	0	0	0	0	9.94648	0	0	0	0	0	0	0
Q8N142	PURA1_HUMAN	"Adenylosuccinate synthetase isozyme 1 (AMPSase 1) (AdSS 1) (EC 6.3.4.4) (Adenylosuccinate synthetase, basic isozyme) (Adenylosuccinate synthetase, muscle isozyme) (M-type adenylosuccinate synthetase) (Adenylosuccinate synthetase-like 1) (AdSSL1) (IMP--aspartate ligase 1)"	ADSS1 ADSSL1	Homo sapiens (Human)	'de novo' AMP biosynthetic process [GO:0044208]; AMP biosynthetic process [GO:0006167]; immune system process [GO:0002376]; IMP metabolic process [GO:0046040]	cytoplasm [GO:0005737]; cytosol [GO:0005829]	adenylosuccinate synthase activity [GO:0004019]; GTP binding [GO:0005525]; magnesium ion binding [GO:0000287]; phosphate ion binding [GO:0042301]	GLKDWEKR	0.94312	0	9.94351	0	0	0	0	0	0	0	0	0	0
Q9NPC6	MYOZ2_HUMAN	Myozenin-2 (Calsarcin-1) (FATZ-related protein 2)	MYOZ2 C4orf5	Homo sapiens (Human)	negative regulation of calcineurin-NFAT signaling cascade [GO:0070885]; negative regulation of transcription by RNA polymerase II [GO:0000122]; sarcomere organization [GO:0045214]; skeletal muscle fiber adaptation [GO:0043503]; skeletal muscle tissue development [GO:0007519]	actin cytoskeleton [GO:0015629]; sarcomere [GO:0030017]; Z disc [GO:0030018]	actin binding [GO:0003779]; FATZ binding [GO:0051373]; protein phosphatase 2B binding [GO:0030346]; telethonin binding [GO:0031433]	LSHNTMMK	0.92181	0	0	0	0	9.94228	0	0	0	0	0	0	0
P61009	SPCS3_HUMAN	Signal peptidase complex subunit 3 (Microsomal signal peptidase 22/23 kDa subunit) (SPC22/23) (SPase 22/23 kDa subunit)	SPCS3 SPC22 UNQ1841/PRO3567	Homo sapiens (Human)	protein targeting to ER [GO:0045047]; proteolysis [GO:0006508]; signal peptide processing [GO:0006465]; viral protein processing [GO:0019082]	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; signal peptidase complex [GO:0005787]		SVPVRLHVSR	0.99889	9.93681	0	0	0	0	0	0	0	0	0	0	0
P10721	KIT_HUMAN	Mast/stem cell growth factor receptor Kit (SCFR) (EC 2.7.10.1) (Piebald trait protein) (PBT) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (p145 c-kit) (v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog) (CD antigen CD117)	KIT SCFR	Homo sapiens (Human)	actin cytoskeleton reorganization [GO:0031532]; B cell differentiation [GO:0030183]; cell chemotaxis [GO:0060326]; cellular response to thyroid hormone stimulus [GO:0097067]; cytokine-mediated signaling pathway [GO:0019221]; detection of mechanical stimulus involved in sensory perception of sound [GO:0050910]; digestive tract development [GO:0048565]; ectopic germ cell programmed cell death [GO:0035234]; embryonic hemopoiesis [GO:0035162]; epithelial cell proliferation [GO:0050673]; erythrocyte differentiation [GO:0030218]; erythropoietin-mediated signaling pathway [GO:0038162]; Fc receptor signaling pathway [GO:0038093]; germ cell migration [GO:0008354]; glycosphingolipid metabolic process [GO:0006687]; hematopoietic progenitor cell differentiation [GO:0002244]; hematopoietic stem cell migration [GO:0035701]; hemopoiesis [GO:0030097]; immature B cell differentiation [GO:0002327]; inflammatory response [GO:0006954]; intracellular signal transduction [GO:0035556]; Kit signaling pathway [GO:0038109]; lamellipodium assembly [GO:0030032]; lymphoid progenitor cell differentiation [GO:0002320]; male gonad development [GO:0008584]; mast cell chemotaxis [GO:0002551]; mast cell degranulation [GO:0043303]; mast cell differentiation [GO:0060374]; mast cell proliferation [GO:0070662]; megakaryocyte development [GO:0035855]; melanocyte adhesion [GO:0097326]; melanocyte differentiation [GO:0030318]; melanocyte migration [GO:0097324]; myeloid progenitor cell differentiation [GO:0002318]; negative regulation of developmental process [GO:0051093]; negative regulation of programmed cell death [GO:0043069]; negative regulation of reproductive process [GO:2000242]; ovarian follicle development [GO:0001541]; pigmentation [GO:0043473]; positive regulation of cell migration [GO:0030335]; positive regulation of colon smooth muscle contraction [GO:1904343]; positive regulation of dendritic cell cytokine production [GO:0002732]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of kinase activity [GO:0033674]; positive regulation of long-term neuronal synaptic plasticity [GO:0048170]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of mast cell cytokine production [GO:0032765]; positive regulation of mast cell proliferation [GO:0070668]; positive regulation of Notch signaling pathway [GO:0045747]; positive regulation of phosphatidylinositol 3-kinase activity [GO:0043552]; positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; positive regulation of phospholipase C activity [GO:0010863]; positive regulation of pseudopodium assembly [GO:0031274]; positive regulation of pyloric antrum smooth muscle contraction [GO:0120072]; positive regulation of receptor signaling pathway via JAK-STAT [GO:0046427]; positive regulation of small intestine smooth muscle contraction [GO:1904349]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]; positive regulation of vascular associated smooth muscle cell differentiation [GO:1905065]; protein autophosphorylation [GO:0046777]; regulation of bile acid metabolic process [GO:1904251]; regulation of cell population proliferation [GO:0042127]; regulation of cell shape [GO:0008360]; response to cadmium ion [GO:0046686]; signal transduction [GO:0007165]; somatic stem cell division [GO:0048103]; somatic stem cell population maintenance [GO:0035019]; spermatid development [GO:0007286]; spermatogenesis [GO:0007283]; stem cell differentiation [GO:0048863]; stem cell population maintenance [GO:0019827]; T cell differentiation [GO:0030217]; tongue development [GO:0043586]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]; visual learning [GO:0008542]	acrosomal vesicle [GO:0001669]; cell-cell junction [GO:0005911]; cytoplasmic side of plasma membrane [GO:0009898]; external side of plasma membrane [GO:0009897]; extracellular space [GO:0005615]; fibrillar center [GO:0001650]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]	ATP binding [GO:0005524]; cytokine binding [GO:0019955]; metal ion binding [GO:0046872]; protease binding [GO:0002020]; protein homodimerization activity [GO:0042803]; protein tyrosine kinase activity [GO:0004713]; SH2 domain binding [GO:0042169]; stem cell factor receptor activity [GO:0005020]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]	EDNDTLVR	0.9311	0	0	0	0	0	9.93322	0	0	0	0	0	0
Q86UP0	CAD24_HUMAN	Cadherin-24	CDH24 CDH11L UNQ2834/PRO34009	Homo sapiens (Human)	adherens junction organization [GO:0034332]; calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules [GO:0016339]; cell morphogenesis [GO:0000902]; cell-cell adhesion [GO:0098609]; cell-cell adhesion via plasma-membrane adhesion molecules [GO:0098742]; cell-cell junction assembly [GO:0007043]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]	adherens junction [GO:0005912]; catenin complex [GO:0016342]; cell-cell junction [GO:0005911]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	alpha-catenin binding [GO:0045294]; beta-catenin binding [GO:0008013]; cadherin binding [GO:0045296]; calcium ion binding [GO:0005509]; delta-catenin binding [GO:0070097]	RDVLPRAR	0.94277	0	0	0	0	0	0	0	9.91243	0	0	0	0
Q9UJM8	HAOX1_HUMAN	2-Hydroxyacid oxidase 1 (HAOX1) (EC 1.1.3.15) (Glycolate oxidase) (GO) (GOX) (Glyoxylate oxidase) (EC 1.2.3.5)	HAO1 GOX1	Homo sapiens (Human)	fatty acid alpha-oxidation [GO:0001561]; glycine biosynthetic process [GO:0006545]; glycolate catabolic process [GO:0046296]; response to oxidative stress [GO:0006979]	cytosol [GO:0005829]; peroxisomal matrix [GO:0005782]; peroxisome [GO:0005777]	(S)-2-hydroxy-acid oxidase activity [GO:0003973]; FMN binding [GO:0010181]; glyoxylate oxidase activity [GO:0047969]	GVQDVLEILK	0.99978	0	0	0	0	0	0	0	9.91243	0	0	0	0
Q9UQ35	SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 (300 kDa nuclear matrix antigen) (Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa) (SR-related nuclear matrix protein of 300 kDa) (Ser/Arg-related nuclear matrix protein of 300 kDa) (Splicing coactivator subunit SRm300) (Tax-responsive enhancer element-binding protein 803) (TaxREB803)	SRRM2 KIAA0324 SRL300 SRM300 HSPC075	Homo sapiens (Human)	"mRNA splicing, via spliceosome [GO:0000398]"	Cajal body [GO:0015030]; catalytic step 2 spliceosome [GO:0071013]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; U2-type catalytic step 2 spliceosome [GO:0071007]; U2-type precatalytic spliceosome [GO:0071005]	C2H2 zinc finger domain binding [GO:0070742]; mRNA binding [GO:0003729]; protein N-terminus binding [GO:0047485]; RNA binding [GO:0003723]	TPARRSGR	0.94055	0	0	0	0	0	0	0	9.91243	0	0	0	0
O75691	UTP20_HUMAN	Small subunit processome component 20 homolog (Down-regulated in metastasis protein) (Novel nucleolar protein 73) (NNP73) (Protein Key-1A6)	UTP20 DRIM	Homo sapiens (Human)	"endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000480]; endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000447]; endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000472]; negative regulation of cell population proliferation [GO:0008285]; rRNA processing [GO:0006364]"	"90S preribosome [GO:0030686]; cytoplasm [GO:0005737]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; preribosome, small subunit precursor [GO:0030688]; small-subunit processome [GO:0032040]"	RNA binding [GO:0003723]	EEIVHFSISEDNAVVK	0.99717	0	9.91234	0	0	0	0	0	0	0	0	0	0
P78524	DEN2B_HUMAN	DENN domain-containing protein 2B (HeLa tumor suppression 1) (Suppression of tumorigenicity 5 protein)	DENND2B HTS1 ST5	Homo sapiens (Human)	positive regulation of ERK1 and ERK2 cascade [GO:0070374]	cell cortex [GO:0005938]; plasma membrane [GO:0005886]; recycling endosome [GO:0055037]	guanyl-nucleotide exchange factor activity [GO:0005085]	EQPGRGLPQLPSSCYSVDR	0.86667	0	0	0	9.91046	0	0	0	0	0	0	0	0
Q93063	EXT2_HUMAN	Exostosin-2 (EC 2.4.1.224) (EC 2.4.1.225) (Glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase) (Multiple exostoses protein 2) (Putative tumor suppressor protein EXT2)	EXT2	Homo sapiens (Human)	"cellular polysaccharide biosynthetic process [GO:0033692]; cellular response to fibroblast growth factor stimulus [GO:0044344]; chondrocyte differentiation [GO:0002062]; endochondral bone morphogenesis [GO:0060350]; fluid transport [GO:0042044]; gene expression [GO:0010467]; glycosaminoglycan biosynthetic process [GO:0006024]; heart contraction [GO:0060047]; heparan sulfate proteoglycan biosynthetic process [GO:0015012]; heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process [GO:0015014]; heparin biosynthetic process [GO:0030210]; mesoderm formation [GO:0001707]; multicellular organismal water homeostasis [GO:0050891]; ossification [GO:0001503]; protein N-linked glycosylation [GO:0006487]; regulation of blood pressure [GO:0008217]; signal transduction [GO:0007165]; sodium ion homeostasis [GO:0055078]; sulfation [GO:0051923]; vasodilation [GO:0042311]"	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; UDP-N-acetylglucosamine transferase complex [GO:0043541]	glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase activity [GO:0050508]; glucuronosyltransferase activity [GO:0015020]; glycosyltransferase activity [GO:0016757]; heparan sulfate N-acetylglucosaminyltransferase activity [GO:0042328]; metal ion binding [GO:0046872]; N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase activity [GO:0050509]; protein heterodimerization activity [GO:0046982]	GPALIPRMK	0.99956	0	0	0	9.90988	0	0	0	0	0	0	0	0
P49792	RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 (EC 2.3.2.-) (358 kDa nucleoporin) (Nuclear pore complex protein Nup358) (Nucleoporin Nup358) (Ran-binding protein 2) (RanBP2) (p270)	RANBP2 NUP358	Homo sapiens (Human)	centrosome localization [GO:0051642]; mRNA transport [GO:0051028]; NLS-bearing protein import into nucleus [GO:0006607]; nuclear export [GO:0051168]; nucleocytoplasmic transport [GO:0006913]; positive regulation of glucokinase activity [GO:0033133]; protein folding [GO:0006457]; protein peptidyl-prolyl isomerization [GO:0000413]; protein sumoylation [GO:0016925]; regulation of gluconeogenesis [GO:0006111]	annulate lamellae [GO:0005642]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; nuclear envelope [GO:0005635]; nuclear inclusion body [GO:0042405]; nuclear membrane [GO:0031965]; nuclear pore [GO:0005643]; nuclear pore cytoplasmic filaments [GO:0044614]; nuclear pore nuclear basket [GO:0044615]; nucleoplasm [GO:0005654]; SUMO ligase complex [GO:0106068]	metal ion binding [GO:0046872]; RNA binding [GO:0003723]; small GTPase binding [GO:0031267]; SUMO ligase activity [GO:0061665]; SUMO transferase activity [GO:0019789]	ITITECGQI	0.99574	0	0	0	0	0	0	0	0	9.89561	0	0	0
Q9HC29	NOD2_HUMAN	Nucleotide-binding oligomerization domain-containing protein 2 (Caspase recruitment domain-containing protein 15) (Inflammatory bowel disease protein 1)	NOD2 CARD15 IBD1	Homo sapiens (Human)	activation of immune response [GO:0002253]; biosynthetic process of antibacterial peptides active against Gram-positive bacteria [GO:0002815]; cellular response to lipopolysaccharide [GO:0071222]; cellular response to muramyl dipeptide [GO:0071225]; cellular response to organic cyclic compound [GO:0071407]; cellular response to peptidoglycan [GO:0071224]; defense response [GO:0006952]; defense response to bacterium [GO:0042742]; detection of bacterium [GO:0016045]; detection of biotic stimulus [GO:0009595]; detection of muramyl dipeptide [GO:0032498]; ERK1 and ERK2 cascade [GO:0070371]; establishment of localization in cell [GO:0051649]; I-kappaB kinase/NF-kappaB signaling [GO:0007249]; innate immune response [GO:0045087]; innate immune response in mucosa [GO:0002227]; intracellular signal transduction [GO:0035556]; JNK cascade [GO:0007254]; maintenance of gastrointestinal epithelium [GO:0030277]; negative regulation of inflammatory response to antigenic stimulus [GO:0002862]; negative regulation of interferon-gamma production [GO:0032689]; negative regulation of interleukin-12 production [GO:0032695]; negative regulation of interleukin-18 production [GO:0032701]; negative regulation of interleukin-2 production [GO:0032703]; negative regulation of macrophage apoptotic process [GO:2000110]; negative regulation of macrophage cytokine production [GO:0010936]; negative regulation of NF-kappaB transcription factor activity [GO:0032088]; negative regulation of T cell mediated immunity [GO:0002710]; negative regulation of toll-like receptor 2 signaling pathway [GO:0034136]; negative regulation of tumor necrosis factor production [GO:0032720]; NIK/NF-kappaB signaling [GO:0038061]; nucleotide-binding oligomerization domain containing 2 signaling pathway [GO:0070431]; pattern recognition receptor signaling pathway [GO:0002221]; peptidyl-tyrosine phosphorylation [GO:0018108]; phagocytosis [GO:0006909]; positive regulation of B cell activation [GO:0050871]; positive regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteria [GO:0006965]; positive regulation of cytokine production involved in immune response [GO:0002720]; positive regulation of cytokine production involved in inflammatory response [GO:1900017]; positive regulation of dendritic cell antigen processing and presentation [GO:0002606]; positive regulation of dendritic cell cytokine production [GO:0002732]; positive regulation of epithelial cell proliferation [GO:0050679]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of gamma-delta T cell activation [GO:0046645]; positive regulation of humoral immune response mediated by circulating immunoglobulin [GO:0002925]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of innate immune response [GO:0045089]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-10 production [GO:0032733]; positive regulation of interleukin-12 production [GO:0032735]; positive regulation of interleukin-17 production [GO:0032740]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of JNK cascade [GO:0046330]; positive regulation of macrophage cytokine production [GO:0060907]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of monocyte chemotactic protein-1 production [GO:0071639]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of nitric-oxide synthase biosynthetic process [GO:0051770]; positive regulation of Notch signaling pathway [GO:0045747]; positive regulation of oxidoreductase activity [GO:0051353]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of phagocytosis [GO:0050766]; positive regulation of phosphatidylinositol 3-kinase activity [GO:0043552]; positive regulation of prostaglandin-E synthase activity [GO:2000363]; positive regulation of prostaglandin-endoperoxide synthase activity [GO:0060585]; positive regulation of protein K63-linked ubiquitination [GO:1902523]; positive regulation of stress-activated MAPK cascade [GO:0032874]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of type 2 immune response [GO:0002830]; positive regulation of xenophagy [GO:1904417]; regulation of inflammatory response [GO:0050727]; regulation of neutrophil chemotaxis [GO:0090022]; response to exogenous dsRNA [GO:0043330]; response to muramyl dipeptide [GO:0032495]; response to nutrient [GO:0007584]; toll-like receptor 2 signaling pathway [GO:0034134]; xenophagy [GO:0098792]	anchored component of plasma membrane [GO:0046658]; basolateral plasma membrane [GO:0016323]; cell surface [GO:0009986]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; mitochondrion [GO:0005739]; phagocytic vesicle [GO:0045335]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; vesicle [GO:0031982]	actin binding [GO:0003779]; ATP binding [GO:0005524]; CARD domain binding [GO:0050700]; enzyme binding [GO:0019899]; Hsp70 protein binding [GO:0030544]; Hsp90 protein binding [GO:0051879]; muramyl dipeptide binding [GO:0032500]; pattern recognition receptor activity [GO:0038187]; peptidoglycan binding [GO:0042834]; protein kinase binding [GO:0019901]; protein-containing complex binding [GO:0044877]	KRHHEPGVADR	0.95238	0	0	0	0	0	0	0	0	0	0	0	9.89421
Q5TZA2	CROCC_HUMAN	Rootletin (Ciliary rootlet coiled-coil protein)	CROCC KIAA0445	Homo sapiens (Human)	cellular homeostasis [GO:0019725]; centriole-centriole cohesion [GO:0010457]; centrosome cycle [GO:0007098]; ciliary basal body organization [GO:0032053]; epithelial structure maintenance [GO:0010669]; establishment of localization in cell [GO:0051649]; establishment of organelle localization [GO:0051656]; photoreceptor cell maintenance [GO:0045494]; positive regulation of cilium assembly [GO:0045724]; positive regulation of protein localization to cilium [GO:1903566]; protein localization [GO:0008104]; protein localization to organelle [GO:0033365]	9+2 motile cilium [GO:0097729]; actin cytoskeleton [GO:0015629]; centriole [GO:0005814]; centrosome [GO:0005813]; ciliary rootlet [GO:0035253]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; photoreceptor inner segment [GO:0001917]; plasma membrane [GO:0005886]; subapical part of cell [GO:0120219]	actin binding [GO:0003779]; kinesin binding [GO:0019894]; structural constituent of cytoskeleton [GO:0005200]; structural molecule activity [GO:0005198]	LANEDKEQK	0.87188	0	9.88923	0	0	0	0	0	0	0	0	0	0
Q8NB25	F184A_HUMAN	Protein FAM184A	FAM184A C6orf60	Homo sapiens (Human)		extracellular space [GO:0005615]		EVESELAAAR	0.77836	0	9.88923	0	0	0	0	0	0	0	0	0	0
Q01546	K22O_HUMAN	"Keratin, type II cytoskeletal 2 oral (Cytokeratin-2P) (CK-2P) (K2P) (Keratin-76) (K76) (Type-II keratin Kb9)"	KRT76 KRT2B KRT2P	Homo sapiens (Human)	cytoskeleton organization [GO:0007010]; intermediate filament organization [GO:0045109]; keratinization [GO:0031424]; pigmentation [GO:0043473]; sebaceous gland development [GO:0048733]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; intermediate filament [GO:0005882]; keratin filament [GO:0045095]; nucleus [GO:0005634]	structural constituent of skin epidermis [GO:0030280]	AQYEEIAQR	1.0005	0	0	0	0	0	0	0	0	0	9.88177	0	0
Q8N1T3	MYO1H_HUMAN	Unconventional myosin-Ih (Myosin-1H)	MYO1H	Homo sapiens (Human)	actin filament organization [GO:0007015]; vesicle transport along actin filament [GO:0030050]	actin cytoskeleton [GO:0015629]; microvillus [GO:0005902]; myosin complex [GO:0016459]; plasma membrane [GO:0005886]	actin filament binding [GO:0051015]; ATP binding [GO:0005524]; microfilament motor activity [GO:0000146]	IGWMEFR	0.92209	9.87286	0	0	0	0	0	0	0	0	0	0	0
Q15345	LRC41_HUMAN	Leucine-rich repeat-containing protein 41 (Protein Muf1)	LRRC41 MUF1 PP7759	Homo sapiens (Human)	protein ubiquitination [GO:0016567]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleus [GO:0005634]	identical protein binding [GO:0042802]	GLSTQAIWR	0.94232	0	0	0	0	0	0	0	9.86955	0	0	0	0
Q8N715	CC185_HUMAN	Coiled-coil domain-containing protein 185	CCDC185 C1orf65	Homo sapiens (Human)				LVEACRKR	0.93659	0	0	0	0	0	0	0	9.86955	0	0	0	0
Q8NA82	MARHA_HUMAN	Probable E3 ubiquitin-protein ligase MARCHF10 (EC 2.3.2.27) (Membrane-associated RING finger protein 10) (Membrane-associated RING-CH protein X) (MARCH-X) (RING finger protein 190) (RING-type E3 ubiquitin transferase MARCHF10)	MARCHF10 MARCH10 RNF190	Homo sapiens (Human)	protein ubiquitination [GO:0016567]		transferase activity [GO:0016740]; zinc ion binding [GO:0008270]	ITSGADLGAVK	0.9165	0	0	0	0	0	0	0	9.86955	0	0	0	0
P0C7U3	ZH11B_HUMAN	Probable palmitoyltransferase ZDHHC11B (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 11B) (DHHC-11B)	ZDHHC11B	Homo sapiens (Human)	peptidyl-L-cysteine S-palmitoylation [GO:0018230]; protein targeting to membrane [GO:0006612]	endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]	protein-cysteine S-palmitoyltransferase activity [GO:0019706]	HCISCNK	0.75298	0	0	0	0	0	0	0	0	0	0	0	9.86324
P15538	C11B1_HUMAN	"Cytochrome P450 11B1, mitochondrial (CYPXIB1) (Cytochrome P-450c11) (Cytochrome P450C11) (Steroid 11-beta-hydroxylase, CYP11B1) (EC 1.14.15.4)"	CYP11B1 S11BH	Homo sapiens (Human)	aldosterone biosynthetic process [GO:0032342]; C21-steroid hormone biosynthetic process [GO:0006700]; cellular response to hormone stimulus [GO:0032870]; cellular response to peptide hormone stimulus [GO:0071375]; cellular response to potassium ion [GO:0035865]; cholesterol metabolic process [GO:0008203]; cortisol biosynthetic process [GO:0034651]; cortisol metabolic process [GO:0034650]; glucocorticoid biosynthetic process [GO:0006704]; glucose homeostasis [GO:0042593]; immune response [GO:0006955]; regulation of blood pressure [GO:0008217]; sterol metabolic process [GO:0016125]	mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]	corticosterone 18-monooxygenase activity [GO:0047783]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; steroid 11-beta-monooxygenase activity [GO:0004507]	MSLEPWVAYR	0.94562	0	9.84378	0	0	0	0	0	0	0	0	0	0
Q9P0I2	EMC3_HUMAN	ER membrane protein complex subunit 3 (Transmembrane protein 111)	EMC3 TMEM111	Homo sapiens (Human)	protein insertion into ER membrane by stop-transfer membrane-anchor sequence [GO:0045050]; tail-anchored membrane protein insertion into ER membrane [GO:0071816]	EMC complex [GO:0072546]; endoplasmic reticulum membrane [GO:0005789]; integral component of endoplasmic reticulum membrane [GO:0030176]; integral component of membrane [GO:0016021]		DLHFEGMFKK	0.99788	0	9.84378	0	0	0	0	0	0	0	0	0	0
P49321	NASP_HUMAN	Nuclear autoantigenic sperm protein (NASP)	NASP	Homo sapiens (Human)	blastocyst development [GO:0001824]; CENP-A containing chromatin assembly [GO:0034080]; DNA replication [GO:0006260]; DNA replication-dependent chromatin assembly [GO:0006335]; DNA replication-independent chromatin assembly [GO:0006336]; G1/S transition of mitotic cell cycle [GO:0000082]; histone exchange [GO:0043486]; male gonad development [GO:0008584]; nucleosome assembly [GO:0006334]; protein transport [GO:0015031]; response to testosterone [GO:0033574]	chromatin [GO:0000785]; cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]	histone binding [GO:0042393]; protein-containing complex binding [GO:0044877]	IEDAKESQR	0.85991	0	9.83739	0	0	0	0	0	0	0	0	0	0
Q8TC56	GAR3_HUMAN	Golgi-associated RAB2 interactor protein 3	GARIN3 FAM71B HSD-51 HSD51	Homo sapiens (Human)		Cajal body [GO:0015030]; Golgi apparatus [GO:0005794]; nucleus [GO:0005634]		VSQPSAEVWNENKERR	0.87559	9.83382	0	0	0	0	0	0	0	0	0	0	0
Q9HBY8	SGK2_HUMAN	Serine/threonine-protein kinase Sgk2 (EC 2.7.11.1) (Serum/glucocorticoid-regulated kinase 2)	SGK2	Homo sapiens (Human)	intracellular signal transduction [GO:0035556]; peptidyl-serine phosphorylation [GO:0018105]; positive regulation of transporter activity [GO:0032411]; protein phosphorylation [GO:0006468]; regulation of cell growth [GO:0001558]; regulation of cell population proliferation [GO:0042127]; response to oxidative stress [GO:0006979]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]	ATP binding [GO:0005524]; potassium channel regulator activity [GO:0015459]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; sodium channel regulator activity [GO:0017080]	TVAACDLLQSLLHKDQR	0.76149	0	0	0	0	0	0	0	0	0	0	9.8305	0
Q16670	ZSC26_HUMAN	Zinc finger and SCAN domain-containing protein 26 (Protein SRE-ZBP) (Zinc finger protein 187)	ZSCAN26 ZNF187	Homo sapiens (Human)	regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase II [GO:0006357]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	HQAKPKEK	0.99954	0	0	0	0	0	0	9.82486	0	0	0	0	0
P04259	K2C6B_HUMAN	"Keratin, type II cytoskeletal 6B (Cytokeratin-6B) (CK-6B) (Keratin-6B) (K6B) (Type-II keratin Kb10)"	KRT6B K6B KRTL1	Homo sapiens (Human)	ectoderm development [GO:0007398]; intermediate filament organization [GO:0045109]; keratinization [GO:0031424]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; keratin filament [GO:0045095]	structural constituent of cytoskeleton [GO:0005200]; structural constituent of skin epidermis [GO:0030280]	AQYEEIAQR	0.93007	0	9.82008	0	0	0	0	0	0	0	0	0	0
Q86YR5	GPSM1_HUMAN	G-protein-signaling modulator 1 (Activator of G-protein signaling 3)	GPSM1 AGS3	Homo sapiens (Human)	cell differentiation [GO:0030154]; establishment of mitotic spindle orientation [GO:0000132]; negative regulation of GTPase activity [GO:0034260]; negative regulation of guanyl-nucleotide exchange factor activity [GO:1905098]; nervous system development [GO:0007399]; positive regulation of macroautophagy [GO:0016239]	cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; Golgi membrane [GO:0000139]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]	G-protein alpha-subunit binding [GO:0001965]; GDP-dissociation inhibitor activity [GO:0005092]	AGPAPPVADELPGPAAR	0.58431	0	9.82008	0	0	0	0	0	0	0	0	0	0
Q9BPX3	CND3_HUMAN	Condensin complex subunit 3 (Chromosome-associated protein G) (Condensin subunit CAP-G) (hCAP-G) (Melanoma antigen NY-MEL-3) (Non-SMC condensin I complex subunit G) (XCAP-G homolog)	NCAPG CAPG NYMEL3	Homo sapiens (Human)	cell division [GO:0051301]; mitotic chromosome condensation [GO:0007076]; positive regulation of chromosome condensation [GO:1905821]; positive regulation of chromosome segregation [GO:0051984]; positive regulation of chromosome separation [GO:1905820]	"condensed chromosome [GO:0000793]; condensed chromosome, centromeric region [GO:0000779]; condensed nuclear chromosome [GO:0000794]; condensin complex [GO:0000796]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleus [GO:0005634]"		SHEANSNAVR	0.93744	0	9.81742	0	0	0	0	0	0	0	0	0	0
Q5T6C5	AT7L2_HUMAN	Ataxin-7-like protein 2	ATXN7L2	Homo sapiens (Human)				CHVVNGQGPACRAPGSTK	0.86086	0	0	0	9.81724	0	0	0	0	0	0	0	0
Q8TEQ8	PIGO_HUMAN	GPI ethanolamine phosphate transferase 3 (EC 2.-.-.-) (Phosphatidylinositol-glycan biosynthesis class O protein) (PIG-O)	PIGO UNQ632/PRO1249	Homo sapiens (Human)	GPI anchor biosynthetic process [GO:0006506]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; membrane [GO:0016020]	mannose-ethanolamine phosphotransferase activity [GO:0051377]	FLHTYSAATQDLQAK	0.95911	0	9.81508	0	0	0	0	0	0	0	0	0	0
Q8IWF9	CCD83_HUMAN	Coiled-coil domain-containing protein 83	CCDC83 HSD9	Homo sapiens (Human)				YHERNSR	0.99859	0	0	0	0	0	0	0	0	0	9.79372	0	0
Q9UL01	DSE_HUMAN	Dermatan-sulfate epimerase (DS epimerase) (EC 5.1.3.19) (Chondroitin-glucuronate 5-epimerase) (Squamous cell carcinoma antigen recognized by T-cells 2) (SART-2)	DSE SART2	Homo sapiens (Human)	chondroitin sulfate biosynthetic process [GO:0030206]; chondroitin sulfate metabolic process [GO:0030204]; dermatan sulfate biosynthetic process [GO:0030208]; dermatan sulfate metabolic process [GO:0030205]; heparan sulfate proteoglycan biosynthetic process [GO:0015012]	cytoplasmic vesicle membrane [GO:0030659]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	chondroitin-glucuronate 5-epimerase activity [GO:0047757]; metal ion binding [GO:0046872]	QTEEAIDR	0.93689	0	0	0	0	0	0	0	0	0	9.79372	0	0
Q92913	FGF13_HUMAN	Fibroblast growth factor 13 (FGF-13) (Fibroblast growth factor homologous factor 2) (FHF-2)	FGF13 FHF2	Homo sapiens (Human)	branching morphogenesis of a nerve [GO:0048755]; cell-cell signaling [GO:0007267]; cerebral cortex cell migration [GO:0021795]; establishment of neuroblast polarity [GO:0045200]; hippocampus development [GO:0021766]; inhibitory synapse assembly [GO:1904862]; learning [GO:0007612]; MAPK cascade [GO:0000165]; memory [GO:0007613]; microtubule polymerization [GO:0046785]; negative regulation of collateral sprouting [GO:0048671]; negative regulation of microtubule depolymerization [GO:0007026]; nervous system development [GO:0007399]; neuron migration [GO:0001764]; protein localization to plasma membrane [GO:0072659]; regulation of cardiac muscle cell action potential involved in regulation of contraction [GO:0098909]; regulation of voltage-gated sodium channel activity [GO:1905150]; signal transduction [GO:0007165]; sodium ion transport [GO:0006814]	axon [GO:0030424]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; extracellular region [GO:0005576]; filopodium [GO:0030175]; growth cone [GO:0030426]; intercalated disc [GO:0014704]; lateral plasma membrane [GO:0016328]; microtubule [GO:0005874]; neuron projection [GO:0043005]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; sarcolemma [GO:0042383]	beta-tubulin binding [GO:0048487]; growth factor activity [GO:0008083]; microtubule binding [GO:0008017]; protein kinase activator activity [GO:0030295]; sodium channel regulator activity [GO:0017080]; transmembrane transporter binding [GO:0044325]	EPSLHDLTEFSRSGSGTPTK	0.86369	0	0	0	9.79178	0	0	0	0	0	0	0	0
Q96EY1	DNJA3_HUMAN	"DnaJ homolog subfamily A member 3, mitochondrial (DnaJ protein Tid-1) (hTid-1) (Hepatocellular carcinoma-associated antigen 57) (Tumorous imaginal discs protein Tid56 homolog)"	DNAJA3 HCA57 TID1	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; activation-induced cell death of T cells [GO:0006924]; cellular senescence [GO:0090398]; mitochondrial DNA replication [GO:0006264]; mitochondrion organization [GO:0007005]; negative regulation of apoptotic process [GO:0043066]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043124]; negative regulation of interferon-gamma-mediated signaling pathway [GO:0060336]; negative regulation of NF-kappaB transcription factor activity [GO:0032088]; negative regulation of protein kinase activity [GO:0006469]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neuromuscular junction development [GO:0007528]; positive regulation of apoptotic process [GO:0043065]; positive regulation of protein ubiquitination [GO:0031398]; positive regulation of T cell proliferation [GO:0042102]; protein folding [GO:0006457]; protein stabilization [GO:0050821]; response to heat [GO:0009408]; response to interferon-gamma [GO:0034341]; skeletal muscle acetylcholine-gated channel clustering [GO:0071340]; small GTPase mediated signal transduction [GO:0007264]; T cell differentiation in thymus [GO:0033077]	anchoring junction [GO:0070161]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extrinsic component of plasma membrane [GO:0019897]; intracellular membrane-bounded organelle [GO:0043231]; mitochondrial matrix [GO:0005759]; mitochondrial nucleoid [GO:0042645]; mitochondrion [GO:0005739]; neuromuscular junction [GO:0031594]; nucleus [GO:0005634]; postsynaptic membrane [GO:0045211]	ATP binding [GO:0005524]; DNA-binding transcription factor binding [GO:0140297]; GTPase regulator activity [GO:0030695]; Hsp70 protein binding [GO:0030544]; IkappaB kinase complex binding [GO:0106137]; interferon-gamma receptor binding [GO:0005133]; metal ion binding [GO:0046872]; NF-kappaB binding [GO:0051059]; protein kinase binding [GO:0019901]; protein-containing complex binding [GO:0044877]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; unfolded protein binding [GO:0051082]	EFTVNIMDTCER	0.94258	0	0	9.77548	0	0	0	0	0	0	0	0	0
A6PVS8	LRIQ3_HUMAN	Leucine-rich repeat and IQ domain-containing protein 3 (Leucine-rich repeat-containing protein 44)	LRRIQ3 LRRC44	Homo sapiens (Human)				WIYITKGYEDK	0.9973	0	9.77248	0	0	0	0	0	0	0	0	0	0
Q8WWB3	DYDC1_HUMAN	DPY30 domain-containing protein 1	DYDC1 DPY30D1 RSD-9 RSD9	Homo sapiens (Human)	histone H3-K4 methylation [GO:0051568]	MLL3/4 complex [GO:0044666]; Set1C/COMPASS complex [GO:0048188]		ERELALMEQEMMER	0.87421	0	0	9.75549	0	0	0	0	0	0	0	0	0
Q8WVM0	TFB1M_HUMAN	"Dimethyladenosine transferase 1, mitochondrial (EC 2.1.1.-) (Mitochondrial 12S rRNA dimethylase 1) (Mitochondrial transcription factor B1) (h-mtTFB) (h-mtTFB1) (hTFB1M) (mtTFB1) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 1)"	TFB1M CGI-75	Homo sapiens (Human)	rRNA methylation [GO:0031167]; rRNA modification [GO:0000154]; transcription initiation at mitochondrial promoter [GO:0006391]	mitochondrial matrix [GO:0005759]; mitochondrial nucleoid [GO:0042645]	"DNA binding [GO:0003677]; mitochondrial transcription factor activity [GO:0034246]; RNA binding [GO:0003723]; rRNA (adenine-N6,N6-)-dimethyltransferase activity [GO:0000179]"	LLELADIDPTLRPR	0.38571	0	0	0	0	0	0	9.74715	0	0	0	0	0
Q5HYC2	K2026_HUMAN	Uncharacterized protein KIAA2026	KIAA2026	Homo sapiens (Human)				EGKAVAKEVPPLQQK	0.99733	0	9.73796	0	0	0	0	0	0	0	0	0	0
O75369	FLNB_HUMAN	Filamin-B (FLN-B) (ABP-278) (ABP-280 homolog) (Actin-binding-like protein) (Beta-filamin) (Filamin homolog 1) (Fh1) (Filamin-3) (Thyroid autoantigen) (Truncated actin-binding protein) (Truncated ABP)	FLNB FLN1L FLN3 TABP TAP	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; cellular response to interferon-gamma [GO:0071346]; epithelial cell morphogenesis [GO:0003382]; keratinocyte development [GO:0003334]; signal transduction [GO:0007165]; skeletal muscle tissue development [GO:0007519]	actin cytoskeleton [GO:0015629]; brush border [GO:0005903]; cell cortex [GO:0005938]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; integral component of membrane [GO:0016021]; phagocytic vesicle [GO:0045335]; plasma membrane [GO:0005886]; stress fiber [GO:0001725]; Z disc [GO:0030018]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; identical protein binding [GO:0042802]; RNA binding [GO:0003723]	TGEEVGFVVDAK	0.9323	0	0	9.73601	0	0	0	0	0	0	0	0	0
O43820	HYAL3_HUMAN	Hyaluronidase-3 (Hyal-3) (EC 3.2.1.35) (Hyaluronoglucosaminidase-3) (Lung carcinoma protein 3) (LuCa-3)	HYAL3 LUCA3	Homo sapiens (Human)	carbohydrate metabolic process [GO:0005975]; cartilage development [GO:0051216]; cellular response to interleukin-1 [GO:0071347]; cellular response to tumor necrosis factor [GO:0071356]; cellular response to UV-B [GO:0071493]; hyaluronan catabolic process [GO:0030214]; inflammatory response [GO:0006954]; negative regulation of ovarian follicle development [GO:2000355]; ovarian follicle atresia [GO:0001552]; penetration of zona pellucida [GO:0007341]; positive regulation of acrosomal vesicle exocytosis [GO:2000368]; response to antibiotic [GO:0046677]; response to virus [GO:0009615]	acrosomal membrane [GO:0002080]; acrosomal vesicle [GO:0001669]; cytoplasmic vesicle [GO:0031410]; early endosome [GO:0005769]; endoplasmic reticulum [GO:0005783]; extracellular region [GO:0005576]; lysosome [GO:0005764]; plasma membrane [GO:0005886]; sperm midpiece [GO:0097225]	hyaluronoglucuronidase activity [GO:0033906]; hyalurononglucosaminidase activity [GO:0004415]	HRLEEAFR	1.0002	0	9.72784	0	0	0	0	0	0	0	0	0	0
Q8IZD4	DCP1B_HUMAN	mRNA-decapping enzyme 1B (EC 3.6.1.62)	DCP1B	Homo sapiens (Human)	"deadenylation-dependent decapping of nuclear-transcribed mRNA [GO:0000290]; deadenylation-independent decapping of nuclear-transcribed mRNA [GO:0031087]; nuclear-transcribed mRNA catabolic process, nonsense-mediated decay [GO:0000184]; positive regulation of catalytic activity [GO:0043085]"	cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; nucleus [GO:0005634]; P-body [GO:0000932]	enzyme activator activity [GO:0008047]; hydrolase activity [GO:0016787]; mRNA binding [GO:0003729]	DISLAALQRHDPYINR	0.86003	0	0	0	0	9.72615	0	0	0	0	0	0	0
Q8N165	PDK1L_HUMAN	Serine/threonine-protein kinase PDIK1L (EC 2.7.11.1) (PDLIM1-interacting kinase 1-like)	PDIK1L CLIK1L	Homo sapiens (Human)	meiotic cell cycle [GO:0051321]; protein phosphorylation [GO:0006468]	nucleoplasm [GO:0005654]; nucleus [GO:0005634]	ATP binding [GO:0005524]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	EVGRGSYGVVYEAVIRK	0.9385	0	0	0	0	9.72615	0	0	0	0	0	0	0
P13497	BMP1_HUMAN	Bone morphogenetic protein 1 (BMP-1) (EC 3.4.24.19) (Mammalian tolloid protein) (mTld) (Procollagen C-proteinase) (PCP)	BMP1 PCOLC	Homo sapiens (Human)	cartilage condensation [GO:0001502]; cell differentiation [GO:0030154]; collagen fibril organization [GO:0030199]; dorsal/ventral pattern formation [GO:0009953]; ossification [GO:0001503]; positive regulation of cartilage development [GO:0061036]; protein processing [GO:0016485]; proteolysis [GO:0006508]; skeletal system development [GO:0001501]	extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; vesicle [GO:0031982]	calcium ion binding [GO:0005509]; cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; identical protein binding [GO:0042802]; metalloendopeptidase activity [GO:0004222]; metallopeptidase activity [GO:0008237]; peptidase activity [GO:0008233]; serine-type endopeptidase activity [GO:0004252]; zinc ion binding [GO:0008270]	KGFQASHATECGGQVRADVK	0.92237	0	0	0	0	9.71887	0	0	0	0	0	0	0
Q5T9S5	CCD18_HUMAN	Coiled-coil domain-containing protein 18 (Sarcoma antigen NY-SAR-24)	CCDC18	Homo sapiens (Human)				LEQELQKQR	0.96885	0	0	0	0	9.71887	0	0	0	0	0	0	0
P18505	GBRB1_HUMAN	Gamma-aminobutyric acid receptor subunit beta-1 (GABA(A) receptor subunit beta-1)	GABRB1	Homo sapiens (Human)	cellular response to histamine [GO:0071420]; central nervous system neuron development [GO:0021954]; chemical synaptic transmission [GO:0007268]; chloride transmembrane transport [GO:1902476]; gamma-aminobutyric acid signaling pathway [GO:0007214]; ion transmembrane transport [GO:0034220]; ion transport [GO:0006811]; nervous system process [GO:0050877]; ovulation cycle [GO:0042698]; regulation of membrane potential [GO:0042391]; response to progesterone [GO:0032570]; response to toxic substance [GO:0009636]; signal transduction [GO:0007165]	anchoring junction [GO:0070161]; chloride channel complex [GO:0034707]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; GABA-A receptor complex [GO:1902711]; GABA-ergic synapse [GO:0098982]; integral component of plasma membrane [GO:0005887]; neuron projection [GO:0043005]; nuclear envelope [GO:0005635]; plasma membrane [GO:0005886]; postsynaptic membrane [GO:0045211]; synapse [GO:0045202]	excitatory extracellular ligand-gated ion channel activity [GO:0005231]; GABA receptor binding [GO:0050811]; GABA-A receptor activity [GO:0004890]; GABA-gated chloride ion channel activity [GO:0022851]; ligand-gated ion channel activity [GO:0015276]; neurotransmitter receptor activity [GO:0030594]; transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential [GO:1904315]	IELPQFSIVDYKMVSK	0.87088	0	0	0	0	0	0	0	9.71395	0	0	0	0
Q9UBJ2	ABCD2_HUMAN	ATP-binding cassette sub-family D member 2 (EC 3.1.2.-) (EC 7.6.2.-) (Adrenoleukodystrophy-like 1) (Adrenoleukodystrophy-related protein) (hALDR)	ABCD2 ALD1 ALDL1 ALDR ALDRP	Homo sapiens (Human)	fatty acid beta-oxidation [GO:0006635]; long-chain fatty acid import into peroxisome [GO:0015910]; myelin maintenance [GO:0043217]; negative regulation of cytokine production involved in inflammatory response [GO:1900016]; negative regulation of reactive oxygen species biosynthetic process [GO:1903427]; neuron projection maintenance [GO:1990535]; peroxisome organization [GO:0007031]; positive regulation of fatty acid beta-oxidation [GO:0032000]; positive regulation of unsaturated fatty acid biosynthetic process [GO:2001280]; response to bacterium [GO:0009617]; very long-chain fatty acid catabolic process [GO:0042760]; very long-chain fatty acid metabolic process [GO:0000038]	cytosol [GO:0005829]; integral component of membrane [GO:0016021]; peroxisomal membrane [GO:0005778]; peroxisome [GO:0005777]	ABC-type transporter activity [GO:0140359]; acyl-CoA hydrolase activity [GO:0047617]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATPase-coupled transmembrane transporter activity [GO:0042626]; long-chain fatty acid transporter activity [GO:0005324]; protein heterodimerization activity [GO:0046982]; protein homodimerization activity [GO:0042803]	LKQSGHGKK	0.99953	9.70242	0	0	0	0	0	0	0	0	0	0	0
P43378	PTN9_HUMAN	Tyrosine-protein phosphatase non-receptor type 9 (EC 3.1.3.48) (Protein-tyrosine phosphatase MEG2) (PTPase MEG2)	PTPN9	Homo sapiens (Human)	negative regulation of neuron projection development [GO:0010977]; peptidyl-tyrosine dephosphorylation [GO:0035335]; positive regulation of protein localization to plasma membrane [GO:1903078]; protein dephosphorylation [GO:0006470]	cytoplasm [GO:0005737]; neuron projection terminus [GO:0044306]; nucleoplasm [GO:0005654]	non-membrane spanning protein tyrosine phosphatase activity [GO:0004726]; protein tyrosine phosphatase activity [GO:0004725]	IQILKTSEVTQHLPR	0.86842	0	0	0	0	9.69745	0	0	0	0	0	0	0
Q5H9U9	DDX6L_HUMAN	Probable ATP-dependent RNA helicase DDX60-like (EC 3.6.4.13) (DEAD box protein 60-like)	DDX60L	Homo sapiens (Human)	defense response to virus [GO:0051607]	cytoplasm [GO:0005737]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; double-stranded RNA binding [GO:0003725]; RNA helicase activity [GO:0003724]; single-stranded RNA binding [GO:0003727]	DYEDLWNVVSHLVK	0.38462	0	0	0	0	9.68898	0	0	0	0	0	0	0
Q8NHX9	TPC2_HUMAN	Two pore channel protein 2 (Two pore calcium channel protein 2)	TPCN2 TPC2	Homo sapiens (Human)	calcium-mediated signaling [GO:0019722]; cellular calcium ion homeostasis [GO:0006874]; endocytosis involved in viral entry into host cell [GO:0075509]; endosome to lysosome transport of low-density lipoprotein particle [GO:0090117]; ion transmembrane transport [GO:0034220]; lysosome organization [GO:0007040]; receptor-mediated endocytosis of virus by host cell [GO:0019065]; regulation of autophagy [GO:0010506]; regulation of exocytosis [GO:0017157]; regulation of ion transmembrane transport [GO:0034765]; response to vitamin D [GO:0033280]; smooth muscle contraction [GO:0006939]; sodium ion transmembrane transport [GO:0035725]	cytosol [GO:0005829]; endolysosome membrane [GO:0036020]; endosome membrane [GO:0010008]; integral component of membrane [GO:0016021]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]	"identical protein binding [GO:0042802]; intracellular phosphatidylinositol-3,5-bisphosphate-sensitive cation channel activity [GO:0097682]; ligand-gated sodium channel activity [GO:0015280]; NAADP-sensitive calcium-release channel activity [GO:0072345]; phosphatidylinositol-3,5-bisphosphate binding [GO:0080025]; protein kinase binding [GO:0019901]; voltage-gated calcium channel activity [GO:0005245]"	RYSGPWSK	0.99928	0	9.68168	0	0	0	0	0	0	0	0	0	0
O94916	NFAT5_HUMAN	Nuclear factor of activated T-cells 5 (NF-AT5) (T-cell transcription factor NFAT5) (Tonicity-responsive enhancer-binding protein) (TonE-binding protein) (TonEBP)	NFAT5 KIAA0827 TONEBP	Homo sapiens (Human)	calcineurin-NFAT signaling cascade [GO:0033173]; cellular hyperosmotic response [GO:0071474]; cellular response to cytokine stimulus [GO:0071345]; cellular response to DNA damage stimulus [GO:0006974]; positive regulation of gene expression [GO:0010628]; positive regulation of leukocyte adhesion to vascular endothelial cell [GO:1904996]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of transcription by RNA polymerase II [GO:0045944]; R-loop disassembly [GO:0062176]; regulation of calcineurin-NFAT signaling cascade [GO:0070884]; regulation of transcription by RNA polymerase II [GO:0006357]; signal transduction [GO:0007165]; transcription by RNA polymerase II [GO:0006366]	chromatin [GO:0000785]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	"chromatin binding [GO:0003682]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific double-stranded DNA binding [GO:1990837]"	STRARLVFR	0.95703	0	0	0	0	0	0	0	0	0	9.68073	0	0
Q9Y3A4	RRP7A_HUMAN	Ribosomal RNA-processing protein 7 homolog A (Gastric cancer antigen Zg14)	RRP7A CGI-96	Homo sapiens (Human)	blastocyst formation [GO:0001825]; cilium disassembly [GO:0061523]; protein localization to nucleolus [GO:1902570]; ribosomal small subunit assembly [GO:0000028]; ribosome biogenesis [GO:0042254]; rRNA processing [GO:0006364]	centrosome [GO:0005813]; cilium [GO:0005929]; CURI complex [GO:0032545]; cytoplasm [GO:0005737]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; UTP-C complex [GO:0034456]	RNA binding [GO:0003723]	QQASHYLYVR	0.93741	0	0	0	9.67624	0	0	0	0	0	0	0	0
Q96KN7	RPGR1_HUMAN	X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 (RPGR-interacting protein 1)	RPGRIP1	Homo sapiens (Human)	neural precursor cell proliferation [GO:0061351]; non-motile cilium assembly [GO:1905515]; response to stimulus [GO:0050896]; retinal rod cell development [GO:0046548]; visual perception [GO:0007601]	axoneme [GO:0005930]; ciliary transition zone [GO:0035869]; photoreceptor connecting cilium [GO:0032391]; photoreceptor distal connecting cilium [GO:0120206]		EKAQNEDLK	0.94975	0	0	0	0	0	0	0	9.66763	0	0	0	0
P48547	KCNC1_HUMAN	Potassium voltage-gated channel subfamily C member 1 (NGK2) (Voltage-gated potassium channel subunit Kv3.1) (Voltage-gated potassium channel subunit Kv4)	KCNC1	Homo sapiens (Human)	cellular response to xenobiotic stimulus [GO:0071466]; cerebellum development [GO:0021549]; globus pallidus development [GO:0021759]; positive regulation of voltage-gated potassium channel activity [GO:1903818]; potassium ion transmembrane transport [GO:0071805]; potassium ion transport [GO:0006813]; protein homooligomerization [GO:0051260]; protein tetramerization [GO:0051262]; response to amine [GO:0014075]; response to auditory stimulus [GO:0010996]; response to fibroblast growth factor [GO:0071774]; response to light intensity [GO:0009642]; response to nerve growth factor [GO:1990089]; response to potassium ion [GO:0035864]; response to toxic substance [GO:0009636]	anchoring junction [GO:0070161]; axolemma [GO:0030673]; axon [GO:0030424]; calyx of Held [GO:0044305]; cell surface [GO:0009986]; dendrite membrane [GO:0032590]; integral component of membrane [GO:0016021]; integral component of postsynaptic membrane [GO:0099055]; integral component of presynaptic membrane [GO:0099056]; neuronal cell body membrane [GO:0032809]; plasma membrane [GO:0005886]; voltage-gated potassium channel complex [GO:0008076]	delayed rectifier potassium channel activity [GO:0005251]; kinesin binding [GO:0019894]; transmembrane transporter binding [GO:0044325]; voltage-gated ion channel activity involved in regulation of presynaptic membrane potential [GO:0099508]; voltage-gated potassium channel activity [GO:0005249]	VIFCPNKVEFIK	0.88257	0	0	0	0	0	0	9.66253	0	0	0	0	0
Q96T51	RUFY1_HUMAN	RUN and FYVE domain-containing protein 1 (FYVE-finger protein EIP1) (La-binding protein 1) (Rab4-interacting protein) (Zinc finger FYVE domain-containing protein 12)	RUFY1 RABIP4 ZFYVE12	Homo sapiens (Human)	endocytosis [GO:0006897]; protein transport [GO:0015031]; regulation of endocytosis [GO:0030100]; small GTPase mediated signal transduction [GO:0007264]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; early endosome membrane [GO:0031901]; endosome [GO:0005768]; intracellular membrane-bounded organelle [GO:0043231]; nuclear speck [GO:0016607]	identical protein binding [GO:0042802]; lipid binding [GO:0008289]; metal ion binding [GO:0046872]; SH2 domain binding [GO:0042169]; SH3 domain binding [GO:0017124]	EVNQALKGHAWLK	0.86727	0	0	0	0	0	0	9.66253	0	0	0	0	0
Q6ZS30	NBEL1_HUMAN	Neurobeachin-like protein 1 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 16 protein) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 17 protein)	NBEAL1 ALS2CR16 ALS2CR17	Homo sapiens (Human)	protein localization [GO:0008104]	cytosol [GO:0005829]; membrane [GO:0016020]	protein kinase binding [GO:0019901]	EIHLRRYNLR	0.99735	0	0	0	0	0	0	0	0	0	0	9.65907	0
Q16270	IBP7_HUMAN	Insulin-like growth factor-binding protein 7 (IBP-7) (IGF-binding protein 7) (IGFBP-7) (IGFBP-rP1) (MAC25 protein) (PGI2-stimulating factor) (Prostacyclin-stimulating factor) (Tumor-derived adhesion factor) (TAF)	IGFBP7 MAC25 PSF	Homo sapiens (Human)	cell adhesion [GO:0007155]; cellular response to hormone stimulus [GO:0032870]; embryo implantation [GO:0007566]; negative regulation of cell population proliferation [GO:0008285]; regulation of cell growth [GO:0001558]; regulation of signal transduction [GO:0009966]; regulation of steroid biosynthetic process [GO:0050810]; response to cortisol [GO:0051414]; response to heat [GO:0009408]; response to retinoic acid [GO:0032526]	collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]	insulin-like growth factor binding [GO:0005520]	GYCAPGMECVKSR	1	0	9.64596	0	0	0	0	0	0	0	0	0	0
Q68CP4	HGNAT_HUMAN	Heparan-alpha-glucosaminide N-acetyltransferase (EC 2.3.1.78) (Transmembrane protein 76)	HGSNAT TMEM76	Homo sapiens (Human)	heparan sulfate proteoglycan catabolic process [GO:0030200]; lysosomal transport [GO:0007041]; protein complex oligomerization [GO:0051259]	integral component of membrane [GO:0016021]; lysosomal lumen [GO:0043202]; lysosomal membrane [GO:0005765]; plasma membrane [GO:0005886]; specific granule membrane [GO:0035579]; tertiary granule membrane [GO:0070821]	acyltransferase activity [GO:0016746]; heparan-alpha-glucosaminide N-acetyltransferase activity [GO:0015019]	LLLSLDDFNNWISK	0.9046	0	9.64596	0	0	0	0	0	0	0	0	0	0
P51811	XK_HUMAN	Endoplasmic reticulum membrane adapter protein XK (Kell complex 37 kDa component) (Kx antigen) (Membrane transport protein XK) (XK-related protein 1)	XK XKR1 XRG1	Homo sapiens (Human)	amino acid transport [GO:0006865]; cellular calcium ion homeostasis [GO:0006874]; cellular magnesium ion homeostasis [GO:0010961]; myelination [GO:0042552]; regulation of axon diameter [GO:0031133]; regulation of cell size [GO:0008361]; skeletal muscle fiber development [GO:0048741]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	protein-macromolecule adaptor activity [GO:0030674]	WLRCFCWACR	0.99824	0	0	0	0	0	0	9.63956	0	0	0	0	0
Q13247	SRSF6_HUMAN	"Serine/arginine-rich splicing factor 6 (Pre-mRNA-splicing factor SRP55) (Splicing factor, arginine/serine-rich 6)"	SRSF6 SFRS6 SRP55	Homo sapiens (Human)	"alternative mRNA splicing, via spliceosome [GO:0000380]; mRNA splice site selection [GO:0006376]; mRNA splicing, via spliceosome [GO:0000398]; negative regulation of cell death [GO:0060548]; negative regulation of keratinocyte differentiation [GO:0045617]; negative regulation of mRNA splicing, via spliceosome [GO:0048025]; negative regulation of type B pancreatic cell apoptotic process [GO:2000675]; positive regulation of epithelial cell proliferation involved in lung morphogenesis [GO:0060501]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]; regulation of keratinocyte proliferation [GO:0010837]; regulation of wound healing [GO:0061041]; response to insulin [GO:0032868]"	nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]	mRNA binding [GO:0003729]; pre-mRNA binding [GO:0036002]; RNA binding [GO:0003723]	ARSVSPPPK	0.99956	0	0	9.63283	0	0	0	0	0	0	0	0	0
Q6ZV89	SH2D5_HUMAN	SH2 domain-containing protein 5	SH2D5	Homo sapiens (Human)		anchoring junction [GO:0070161]; postsynaptic density [GO:0014069]		MQKAGAGGRR	0.95791	0	0	0	0	0	0	0	0	0	9.62828	0	0
P52824	DGKQ_HUMAN	Diacylglycerol kinase theta (DAG kinase theta) (DGKtheta) (EC 2.7.1.107) (Diglyceride kinase theta) (DGK-theta)	DGKQ DAGK4	Homo sapiens (Human)	cAMP-mediated signaling [GO:0019933]; diacylglycerol metabolic process [GO:0046339]; G protein-coupled receptor signaling pathway [GO:0007186]; glycerolipid metabolic process [GO:0046486]; intracellular signal transduction [GO:0035556]; lipid phosphorylation [GO:0046834]; negative regulation of gene expression [GO:0010629]; negative regulation of peptidyl-threonine phosphorylation [GO:0010801]; peptidyl-serine phosphorylation [GO:0018105]; phosphatidic acid biosynthetic process [GO:0006654]; platelet activation [GO:0030168]; positive regulation of gene expression [GO:0010628]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; protein kinase C signaling [GO:0070528]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]; regulation of cholesterol metabolic process [GO:0090181]; regulation of cortisol biosynthetic process [GO:2000064]; regulation of G protein-coupled receptor signaling pathway [GO:0008277]; regulation of gluconeogenesis [GO:0006111]; regulation of progesterone biosynthetic process [GO:2000182]; regulation of synaptic vesicle endocytosis [GO:1900242]; regulation of TORC1 signaling [GO:1903432]; regulation of transcription by RNA polymerase II [GO:0006357]; response to ATP [GO:0033198]; response to cAMP [GO:0051591]; thrombin-activated receptor signaling pathway [GO:0070493]	anchoring junction [GO:0070161]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; endosome [GO:0005768]; glutamatergic synapse [GO:0098978]; nuclear matrix [GO:0016363]; nuclear speck [GO:0016607]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]; presynapse [GO:0098793]; vesicle membrane [GO:0012506]	ATP binding [GO:0005524]; diacylglycerol kinase activity [GO:0004143]; DNA-binding transcription factor binding [GO:0140297]; kinase binding [GO:0019900]; metal ion binding [GO:0046872]; phospholipase binding [GO:0043274]; transmembrane receptor protein tyrosine kinase activator activity [GO:0030297]	VHMLRKAK	0.94286	0	0	9.60951	0	0	0	0	0	0	0	0	0
P52757	CHIO_HUMAN	Beta-chimaerin (Beta-chimerin) (Rho GTPase-activating protein 3)	CHN2 ARHGAP3 BCH	Homo sapiens (Human)	positive regulation of GTPase activity [GO:0043547]; regulation of GTPase activity [GO:0043087]; regulation of small GTPase mediated signal transduction [GO:0051056]; signal transduction [GO:0007165]	cytosol [GO:0005829]; membrane [GO:0016020]; synapse [GO:0045202]	GTPase activator activity [GO:0005096]; metal ion binding [GO:0046872]	THNFKVHTFR	0.99846	0	9.60492	0	0	0	0	0	0	0	0	0	0
Q9H0I9	TKTL2_HUMAN	Transketolase-like protein 2 (EC 2.2.1.1)	TKTL2	Homo sapiens (Human)		cytoplasm [GO:0005737]	metal ion binding [GO:0046872]; thiamine pyrophosphate binding [GO:0030976]; transketolase activity [GO:0004802]	MTSPPAYKVGDK	0.99815	0	0	9.60142	0	0	0	0	0	0	0	0	0
Q96NA8	TSNA1_HUMAN	t-SNARE domain-containing protein 1	TSNARE1	Homo sapiens (Human)	intracellular protein transport [GO:0006886]; vesicle docking [GO:0048278]; vesicle fusion [GO:0006906]	endomembrane system [GO:0012505]; integral component of membrane [GO:0016021]; SNARE complex [GO:0031201]	SNAP receptor activity [GO:0005484]; SNARE binding [GO:0000149]	ILQAVNALGYCRR	0.85632	0	0	0	9.58257	0	0	0	0	0	0	0	0
Q9BTD3	TM121_HUMAN	Transmembrane protein 121	TMEM121 HHOLE	Homo sapiens (Human)		integral component of membrane [GO:0016021]		LYFIFQNYKAAR	0.80882	0	0	0	9.58257	0	0	0	0	0	0	0	0
Q9Y5W8	SNX13_HUMAN	Sorting nexin-13 (RGS domain- and PHOX domain-containing protein) (RGS-PX1)	SNX13 KIAA0713	Homo sapiens (Human)	intracellular protein transport [GO:0006886]; negative regulation of signal transduction [GO:0009968]; positive regulation of GTPase activity [GO:0043547]	early endosome [GO:0005769]; early endosome membrane [GO:0031901]; intracellular membrane-bounded organelle [GO:0043231]	phosphatidylinositol binding [GO:0035091]; phosphatidylinositol-3-phosphate binding [GO:0032266]	ASPRVTVDDYLVAK	0.99618	0	0	0	9.58257	0	0	0	0	0	0	0	0
O75817	POP7_HUMAN	Ribonuclease P protein subunit p20 (RNaseP protein p20) (Ribonucleases P/MRP protein subunit POP7 homolog) (hPOP7)	POP7 RPP20	Homo sapiens (Human)	"RNA phosphodiester bond hydrolysis, endonucleolytic [GO:0090502]; rRNA processing [GO:0006364]; tRNA 5'-leader removal [GO:0001682]; tRNA processing [GO:0008033]"	cytoplasm [GO:0005737]; intracellular membrane-bounded organelle [GO:0043231]; multimeric ribonuclease P complex [GO:0030681]; nucleolar ribonuclease P complex [GO:0005655]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; ribonuclease MRP complex [GO:0000172]	ribonuclease P activity [GO:0004526]; ribonuclease P RNA binding [GO:0033204]; RNA binding [GO:0003723]	LLDGGAR	0.76816	0	0	9.5756	0	0	0	0	0	0	0	0	0
Q9NZM1	MYOF_HUMAN	Myoferlin (Fer-1-like protein 3)	MYOF FER1L3 KIAA1207	Homo sapiens (Human)	blood circulation [GO:0008015]; membrane fusion [GO:0061025]; muscle contraction [GO:0006936]; myoblast fusion [GO:0007520]; plasma membrane organization [GO:0007009]; plasma membrane repair [GO:0001778]; T-tubule organization [GO:0033292]	caveola [GO:0005901]; cytoplasmic vesicle [GO:0031410]; cytoplasmic vesicle membrane [GO:0030659]; extracellular exosome [GO:0070062]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]; nuclear envelope [GO:0005635]; nuclear membrane [GO:0031965]; plasma membrane [GO:0005886]	metal ion binding [GO:0046872]; phospholipid binding [GO:0005543]	AEDIPQMDDAFSQTVK	0.4125	0	0	0	0	9.57295	0	0	0	0	0	0	0
Q9HCH3	CPNE5_HUMAN	Copine-5 (Copine V)	CPNE5 KIAA1599	Homo sapiens (Human)	cell differentiation [GO:0030154]; cellular response to calcium ion [GO:0071277]; positive regulation of dendrite extension [GO:1903861]	extracellular exosome [GO:0070062]; neuron projection [GO:0043005]; perikaryon [GO:0043204]; plasma membrane [GO:0005886]	calcium-dependent phospholipid binding [GO:0005544]; metal ion binding [GO:0046872]	HDFLGQAFCTLGEIVGSPGSR	0.93711	0	0	0	0	0	0	0	0	9.56423	0	0	0
Q8NCI6	GLBL3_HUMAN	Beta-galactosidase-1-like protein 3 (EC 3.2.1.-)	GLB1L3	Homo sapiens (Human)	carbohydrate metabolic process [GO:0005975]	vacuole [GO:0005773]	beta-galactosidase activity [GO:0004565]	DLHIPELRDCR	0.68027	9.55928	0	0	0	0	0	0	0	0	0	0	0
A2RTY3	HEAT9_HUMAN	Protein HEATR9 (HEAT repeat-containing protein 9)	HEATR9 C17orf66	Homo sapiens (Human)	hematopoietic progenitor cell differentiation [GO:0002244]			KMRDDCR	0.9169	0	9.55662	0	0	0	0	0	0	0	0	0	0
Q96M69	LRGUK_HUMAN	Leucine-rich repeat and guanylate kinase domain-containing protein	LRGUK	Homo sapiens (Human)	axoneme assembly [GO:0035082]; cell differentiation [GO:0030154]; phosphorylation [GO:0016310]; spermatogenesis [GO:0007283]	acrosomal vesicle [GO:0001669]; cell projection [GO:0042995]; cytosol [GO:0005829]; manchette [GO:0002177]	ATP binding [GO:0005524]; guanylate kinase activity [GO:0004385]	DSLVSMKCSLFRFCPWSK	0.94915	0	0	0	9.54913	0	0	0	0	0	0	0	0
Q6ZR52	ZN493_HUMAN	Zinc finger protein 493	ZNF493	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	AFRRSSHLSR	0.67568	9.54622	0	0	0	0	0	0	0	0	0	0	0
O95376	ARI2_HUMAN	E3 ubiquitin-protein ligase ARIH2 (ARI-2) (Protein ariadne-2 homolog) (EC 2.3.2.31) (RING-type E3 ubiquitin transferase ARIH2) (Triad1 protein)	ARIH2 ARI2 TRIAD1 HT005	Homo sapiens (Human)	developmental cell growth [GO:0048588]; hematopoietic stem cell proliferation [GO:0071425]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein targeting to mitochondrion [GO:1903955]; protein K48-linked ubiquitination [GO:0070936]; protein K63-linked ubiquitination [GO:0070534]; protein polyubiquitination [GO:0000209]; protein ubiquitination [GO:0016567]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; ubiquitin ligase complex [GO:0000151]	ubiquitin conjugating enzyme binding [GO:0031624]; ubiquitin protein ligase activity [GO:0061630]; ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]	CNEVFCFK	0.94001	9.53621	0	0	0	0	0	0	0	0	0	0	0
Q8IY92	SLX4_HUMAN	Structure-specific endonuclease subunit SLX4 (BTB/POZ domain-containing protein 12)	SLX4 BTBD12 KIAA1784 KIAA1987	Homo sapiens (Human)	DNA double-strand break processing involved in repair via single-strand annealing [GO:0010792]; DNA repair [GO:0006281]; DNA replication [GO:0006260]; double-strand break repair via homologous recombination [GO:0000724]; interstrand cross-link repair [GO:0036297]; meiotic DNA double-strand break processing [GO:0000706]; negative regulation of telomere maintenance via telomere lengthening [GO:1904357]; nucleotide-excision repair [GO:0006289]; positive regulation of t-circle formation [GO:1904431]; positive regulation of telomere maintenance [GO:0032206]; resolution of meiotic recombination intermediates [GO:0000712]; response to intra-S DNA damage checkpoint signaling [GO:0072429]; t-circle formation [GO:0090656]; telomeric D-loop disassembly [GO:0061820]	"cell junction [GO:0030054]; chromosome, telomeric region [GO:0000781]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; Slx1-Slx4 complex [GO:0033557]"	DNA binding [GO:0003677]; enzyme activator activity [GO:0008047]; enzyme binding [GO:0019899]; metal ion binding [GO:0046872]	LESAFSER	0.9375	0	0	9.53039	0	0	0	0	0	0	0	0	0
Q96C92	ENTR1_HUMAN	Endosome-associated-trafficking regulator 1 (Antigen NY-CO-3) (Serologically defined colon cancer antigen 3)	ENTR1 SDCCAG3	Homo sapiens (Human)	cell cycle [GO:0007049]; cell division [GO:0051301]; cell projection organization [GO:0030030]; endocytic recycling [GO:0032456]; positive regulation of cilium assembly [GO:0045724]; positive regulation of protein localization to cilium [GO:1903566]; protein transport [GO:0015031]; regulation of cytokinesis [GO:0032465]	centrosome [GO:0005813]; ciliary basal body [GO:0036064]; early endosome [GO:0005769]; endosome [GO:0005768]; midbody [GO:0030496]; recycling endosome [GO:0055037]		KLEAKMIK	0.94259	9.53002	0	0	0	0	0	0	0	0	0	0	0
P09848	LPH_HUMAN	Lactase/phlorizin hydrolase (Lactase/glycosylceramidase) [Includes: Lactase (EC 3.2.1.108); Glycosylceramidase (EC 3.2.1.62) (Phlorizin hydrolase)]	LCT LPH	Homo sapiens (Human)	cellobiose catabolic process [GO:2000892]; glycosylceramide catabolic process [GO:0046477]; lactose catabolic process [GO:0005990]; quercetin catabolic process [GO:1901733]	external side of apical plasma membrane [GO:0098591]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]	beta-glucosidase activity [GO:0008422]; cellobiose glucosidase activity [GO:0080079]; galactosylceramidase activity [GO:0004336]; glucosylceramidase activity [GO:0004348]; glycosylceramidase activity [GO:0017042]; lactase activity [GO:0000016]; phlorizin hydrolase activity [GO:0140749]; protein homodimerization activity [GO:0042803]	VVPWGIRR	0.99904	0	0	0	0	0	0	0	0	0	0	9.51761	0
Q4ZHG4	FNDC1_HUMAN	Fibronectin type III domain-containing protein 1 (Activation-associated cDNA protein) (Expressed in synovial lining protein)	FNDC1 FNDC2 KIAA1866 MEL4B3	Homo sapiens (Human)		extracellular region [GO:0005576]; nuclear speck [GO:0016607]		RTLRPPSR	0.9966	0	0	0	0	0	0	0	0	0	0	9.51761	0
Q14980	NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 (Nuclear matrix protein-22) (NMP-22) (Nuclear mitotic apparatus protein) (NuMA protein) (SP-H antigen)	NUMA1 NMP22 NUMA	Homo sapiens (Human)	anastral spindle assembly [GO:0055048]; astral microtubule organization [GO:0030953]; cell division [GO:0051301]; chromosome segregation [GO:0007059]; establishment of mitotic spindle orientation [GO:0000132]; meiotic cell cycle [GO:0051321]; microtubule bundle formation [GO:0001578]; nucleus organization [GO:0006997]; positive regulation of BMP signaling pathway [GO:0030513]; positive regulation of chromosome segregation [GO:0051984]; positive regulation of chromosome separation [GO:1905820]; positive regulation of hair follicle development [GO:0051798]; positive regulation of intracellular transport [GO:0032388]; positive regulation of keratinocyte differentiation [GO:0045618]; positive regulation of microtubule polymerization [GO:0031116]; positive regulation of mitotic spindle elongation [GO:1902846]; positive regulation of protein localization to cell cortex [GO:1904778]; positive regulation of protein localization to spindle pole body [GO:1902365]; positive regulation of spindle assembly [GO:1905832]; regulation of metaphase plate congression [GO:0090235]; regulation of mitotic spindle organization [GO:0060236]	cell cortex [GO:0005938]; cell cortex region [GO:0099738]; centrosome [GO:0005813]; chromosome [GO:0005694]; cortical microtubule [GO:0055028]; cytoplasmic microtubule bundle [GO:1905720]; cytosol [GO:0005829]; dendrite [GO:0030425]; extracellular exosome [GO:0070062]; extrinsic component of plasma membrane [GO:0019897]; Golgi membrane [GO:0000139]; lateral cell cortex [GO:0097575]; lateral plasma membrane [GO:0016328]; microtubule bundle [GO:0097427]; microtubule minus-end [GO:0036449]; microtubule plus-end [GO:0035371]; mitotic spindle [GO:0072686]; mitotic spindle astral microtubule [GO:0061673]; mitotic spindle midzone [GO:1990023]; mitotic spindle pole [GO:0097431]; neuronal cell body [GO:0043025]; nuclear matrix [GO:0016363]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]; spindle [GO:0005819]; spindle microtubule [GO:0005876]; spindle pole [GO:0000922]; spindle pole centrosome [GO:0031616]	disordered domain specific binding [GO:0097718]; dynein complex binding [GO:0070840]; microtubule binding [GO:0008017]; microtubule minus-end binding [GO:0051011]; microtubule plus-end binding [GO:0051010]; phosphatidylinositol binding [GO:0035091]; protein C-terminus binding [GO:0008022]; protein domain specific binding [GO:0019904]; protein-containing complex binding [GO:0044877]; structural molecule activity [GO:0005198]; tubulin binding [GO:0015631]	ELEEERAGR	0.54419	9.5158	0	0	0	0	0	0	0	0	0	0	0
Q9NR48	ASH1L_HUMAN	Histone-lysine N-methyltransferase ASH1L (EC 2.1.1.359) (EC 2.1.1.367) (ASH1-like protein) (huASH1) (Absent small and homeotic disks protein 1 homolog) (Lysine N-methyltransferase 2H)	ASH1L KIAA1420 KMT2H	Homo sapiens (Human)	chromatin organization [GO:0006325]; decidualization [GO:0046697]; flagellated sperm motility [GO:0030317]; histone H3-K36 dimethylation [GO:0097676]; histone H3-K4 methylation [GO:0051568]; I-kappaB kinase/NF-kappaB signaling [GO:0007249]; inflammatory response [GO:0006954]; MAPK cascade [GO:0000165]; negative regulation of acute inflammatory response [GO:0002674]; negative regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043124]; negative regulation of MAPK cascade [GO:0043409]; positive regulation of transcription by RNA polymerase II [GO:0045944]; post-embryonic development [GO:0009791]; regulation of DNA-templated transcription [GO:0006355]; single fertilization [GO:0007338]; skeletal system development [GO:0001501]; tarsal gland development [GO:1903699]; transcription by RNA polymerase II [GO:0006366]; uterine gland development [GO:1903709]; uterus morphogenesis [GO:0061038]	bicellular tight junction [GO:0005923]; chromosome [GO:0005694]; Golgi apparatus [GO:0005794]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	chromatin binding [GO:0003682]; DNA binding [GO:0003677]; histone methyltransferase activity (H3-K36 specific) [GO:0046975]; histone methyltransferase activity (H3-K4 specific) [GO:0042800]; histone methyltransferase activity (H3-K9 specific) [GO:0046974]; histone-lysine N-methyltransferase activity [GO:0018024]; metal ion binding [GO:0046872]	RGRPKSK	0.93775	0	0	0	0	0	0	0	0	0	0	9.51499	0
Q9C0D3	ZY11B_HUMAN	Protein zyg-11 homolog B	ZYG11B KIAA1730	Homo sapiens (Human)	positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; protein quality control for misfolded or incompletely synthesized proteins [GO:0006515]	Cul2-RING ubiquitin ligase complex [GO:0031462]		TKPEILK	0.93754	0	0	0	0	0	0	0	0	0	9.51252	0	0
Q7Z4S6	KI21A_HUMAN	Kinesin-like protein KIF21A (Kinesin-like protein KIF2) (Renal carcinoma antigen NY-REN-62)	KIF21A KIAA1708 KIF2	Homo sapiens (Human)	microtubule-based movement [GO:0007018]	axon [GO:0030424]; cytosol [GO:0005829]; dendrite [GO:0030425]; kinesin complex [GO:0005871]; microtubule [GO:0005874]; plasma membrane [GO:0005886]	ankyrin repeat binding [GO:0071532]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777]	EIEDLRAK	0.93826	0	0	0	0	0	0	0	0	0	0	9.51098	0
O75781	PALM_HUMAN	Paralemmin-1 (Paralemmin)	PALM KIAA0270	Homo sapiens (Human)	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway [GO:0007193]; cellular response to electrical stimulus [GO:0071257]; cytoskeleton organization [GO:0007010]; negative regulation of adenylate cyclase activity [GO:0007194]; negative regulation of dopamine receptor signaling pathway [GO:0060160]; positive regulation of filopodium assembly [GO:0051491]; protein localization to plasma membrane [GO:0072659]; regulation of cell shape [GO:0008360]; synapse maturation [GO:0060074]	anchoring junction [GO:0070161]; apicolateral plasma membrane [GO:0016327]; axon [GO:0030424]; basolateral plasma membrane [GO:0016323]; cytoplasmic vesicle [GO:0031410]; dendritic spine [GO:0043197]; filopodium membrane [GO:0031527]; intrinsic component of the cytoplasmic side of the plasma membrane [GO:0031235]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]	D3 dopamine receptor binding [GO:0031750]	QAEIENKR	0.99806	0	0	0	9.50577	0	0	0	0	0	0	0	0
Q15629	TRAM1_HUMAN	Translocating chain-associated membrane protein 1 (Protein TRAM1)	TRAM1 TRAM	Homo sapiens (Human)	"cotranslational protein targeting to membrane [GO:0006613]; protein insertion into ER membrane [GO:0045048]; response to unfolded protein [GO:0006986]; SRP-dependent cotranslational protein targeting to membrane, translocation [GO:0006616]"	endoplasmic reticulum [GO:0005783]; integral component of endoplasmic reticulum membrane [GO:0030176]; integral component of membrane [GO:0016021]	signaling receptor activity [GO:0038023]	LFYFSNEK	0.94075	0	9.5018	0	0	0	0	0	0	0	0	0	0
Q96JX3	SRAC1_HUMAN	Protein SERAC1 (Serine active site-containing protein 1)	SERAC1	Homo sapiens (Human)	extracellular matrix organization [GO:0030198]; intracellular cholesterol transport [GO:0032367]; phosphatidylglycerol acyl-chain remodeling [GO:0036148]; phospholipid biosynthetic process [GO:0008654]	endoplasmic reticulum [GO:0005783]; extracellular matrix [GO:0031012]; integral component of membrane [GO:0016021]; mitochondria-associated endoplasmic reticulum membrane [GO:0044233]; mitochondrion [GO:0005739]		ARCPMERK	0.94282	0	9.5018	0	0	0	0	0	0	0	0	0	0
Q7Z4F1	LRP10_HUMAN	Low-density lipoprotein receptor-related protein 10 (LRP-10)	LRP10 MSTP087 SP220 UNQ389/PRO724	Homo sapiens (Human)	inner ear development [GO:0048839]; lipid metabolic process [GO:0006629]; lipid transport [GO:0006869]	clathrin-coated pit [GO:0005905]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; plasma membrane [GO:0005886]	low-density lipoprotein particle receptor activity [GO:0005041]	SLTHFSNGK	0.94412	0	9.49899	0	0	0	0	0	0	0	0	0	0
Q92618	ZN516_HUMAN	Zinc finger protein 516	ZNF516 KIAA0222	Homo sapiens (Human)	adipose tissue development [GO:0060612]; brown fat cell differentiation [GO:0050873]; positive regulation of cold-induced thermogenesis [GO:0120162]; positive regulation of DNA-templated transcription [GO:0045893]; regulation of DNA-templated transcription [GO:0006355]; response to cold [GO:0009409]	nucleus [GO:0005634]	"cis-regulatory region sequence-specific DNA binding [GO:0000987]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription factor binding [GO:0140297]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	NREAEMELRR	0.9415	0	9.47194	0	0	0	0	0	0	0	0	0	0
Q8IWU2	LMTK2_HUMAN	Serine/threonine-protein kinase LMTK2 (EC 2.7.11.1) (Apoptosis-associated tyrosine kinase 2) (Brain-enriched kinase) (hBREK) (CDK5/p35-regulated kinase) (CPRK) (Kinase/phosphatase/inhibitor 2) (Lemur tyrosine kinase 2) (Serine/threonine-protein kinase KPI-2)	LMTK2 AATYK2 BREK KIAA1079 KPI2 LMR2	Homo sapiens (Human)	axonogenesis [GO:0007409]; early endosome to late endosome transport [GO:0045022]; endocytic recycling [GO:0032456]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of kinase activity [GO:0033674]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; receptor recycling [GO:0001881]; transferrin transport [GO:0033572]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	cytosol [GO:0005829]; early endosome [GO:0005769]; Golgi apparatus [GO:0005794]; growth cone [GO:0030426]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; neuronal cell body [GO:0043025]; perinuclear region of cytoplasm [GO:0048471]; receptor complex [GO:0043235]; recycling endosome [GO:0055037]	ATP binding [GO:0005524]; myosin VI binding [GO:0070853]; protein phosphatase inhibitor activity [GO:0004864]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	VFPLRWTAPELVTSFQDR	0.87717	0	9.46771	0	0	0	0	0	0	0	0	0	0
H3BQL2	GOG8T_HUMAN	Golgin subfamily A member 8T	GOLGA8T	Homo sapiens (Human)	Golgi organization [GO:0007030]	cis-Golgi network [GO:0005801]; Golgi cis cisterna [GO:0000137]; Golgi cisterna membrane [GO:0032580]		SLRYFEEKSK	0.95711	0	0	0	0	0	0	0	0	0	0	0	9.46583
P20594	ANPRB_HUMAN	Atrial natriuretic peptide receptor 2 (EC 4.6.1.2) (Atrial natriuretic peptide receptor type B) (ANP-B) (ANPR-B) (NPR-B) (Guanylate cyclase B) (GC-B)	NPR2 ANPRB	Homo sapiens (Human)	bone development [GO:0060348]; cellular response to granulocyte macrophage colony-stimulating factor stimulus [GO:0097011]; cGMP biosynthetic process [GO:0006182]; cGMP-mediated signaling [GO:0019934]; meiotic cell cycle [GO:0051321]; negative regulation of meiotic cell cycle [GO:0051447]; negative regulation of oocyte maturation [GO:1900194]; ossification [GO:0001503]; positive regulation of cGMP-mediated signaling [GO:0010753]; protein phosphorylation [GO:0006468]; receptor guanylyl cyclase signaling pathway [GO:0007168]; regulation of blood pressure [GO:0008217]; signal transduction [GO:0007165]	integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]	ATP binding [GO:0005524]; GTP binding [GO:0005525]; guanylate cyclase activity [GO:0004383]; hormone binding [GO:0042562]; identical protein binding [GO:0042802]; natriuretic peptide receptor activity [GO:0016941]; peptide hormone binding [GO:0017046]; peptide receptor activity [GO:0001653]; protein kinase activity [GO:0004672]	TGPSAPK	0.83264	0	0	0	0	0	0	0	0	9.46377	0	0	0
O00541	PESC_HUMAN	Pescadillo homolog	PES1	Homo sapiens (Human)	"cell population proliferation [GO:0008283]; maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000466]; maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463]; regulation of cell cycle [GO:0051726]; ribosomal large subunit biogenesis [GO:0042273]; rRNA processing [GO:0006364]"	"chromosome [GO:0005694]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; PeBoW complex [GO:0070545]; preribosome, large subunit precursor [GO:0030687]"	ribonucleoprotein complex binding [GO:0043021]; RNA binding [GO:0003723]	DNKPNYKLDHIIKER	0.94444	0	0	0	0	0	9.45992	0	0	0	0	0	0
O75683	SURF6_HUMAN	Surfeit locus protein 6	SURF6 SURF-6	Homo sapiens (Human)	ribosomal large subunit biogenesis [GO:0042273]; ribosomal small subunit biogenesis [GO:0042274]	chromosome [GO:0005694]; granular component [GO:0001652]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	DNA binding [GO:0003677]; RNA binding [GO:0003723]	MQQRQDR	0.99812	0	0	0	0	0	9.45992	0	0	0	0	0	0
C9J442	CV046_HUMAN	Uncharacterized protein C22orf46	C22orf46	Homo sapiens (Human)		extracellular region [GO:0005576]		HCWHQVTR	0.94185	0	0	9.45802	0	0	0	0	0	0	0	0	0
Q68D20	PMS2L_HUMAN	Protein PMS2CL (PMS2-C terminal-like protein)	PMS2CL PMS2P13	Homo sapiens (Human)				GSQEHVDSQEKAPETDDSFSDVDCHSNQEDTGCK	0.90524	9.45475	0	0	0	0	0	0	0	0	0	0	0
Q8IVM0	CCD50_HUMAN	Coiled-coil domain-containing protein 50 (Protein Ymer)	CCDC50 C3orf6	Homo sapiens (Human)	sensory perception of sound [GO:0007605]	cytoplasm [GO:0005737]; cytosol [GO:0005829]	ubiquitin protein ligase binding [GO:0031625]	TAKAANSKSK	0.93591	0	0	0	0	0	9.45092	0	0	0	0	0	0
Q01101	INSM1_HUMAN	Insulinoma-associated protein 1 (Zinc finger protein IA-1)	INSM1 IA1	Homo sapiens (Human)	adrenal chromaffin cell differentiation [GO:0061104]; cell cycle [GO:0007049]; cell migration [GO:0016477]; cell population proliferation [GO:0008283]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of protein phosphorylation [GO:0001933]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neuron differentiation [GO:0030182]; noradrenergic neuron development [GO:0003358]; norepinephrine biosynthetic process [GO:0042421]; pancreatic A cell differentiation [GO:0003310]; positive regulation of cell differentiation [GO:0045597]; positive regulation of cell migration [GO:0030335]; positive regulation of neural precursor cell proliferation [GO:2000179]; regulation of cell cycle [GO:0051726]; regulation of cell cycle process [GO:0010564]; regulation of gene expression [GO:0010468]; regulation of protein-containing complex assembly [GO:0043254]; sympathetic ganglion development [GO:0061549]; transdifferentiation [GO:0060290]; type B pancreatic cell development [GO:0003323]; type B pancreatic cell differentiation [GO:0003309]	nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription repressor complex [GO:0017053]	"chromatin DNA binding [GO:0031490]; cyclin binding [GO:0030332]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; histone deacetylase binding [GO:0042826]; metal ion binding [GO:0046872]; molecular adaptor activity [GO:0060090]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	MPRGFLVK	0.19167	0	0	0	0	0	0	0	9.44882	0	0	0	0
Q9NYW7	TA2R1_HUMAN	Taste receptor type 2 member 1 (T2R1) (Taste receptor family B member 7) (TRB7)	TAS2R1	Homo sapiens (Human)	detection of chemical stimulus involved in sensory perception of bitter taste [GO:0001580]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	bitter taste receptor activity [GO:0033038]; G protein-coupled receptor activity [GO:0004930]; taste receptor activity [GO:0008527]	KFLLHSK	0.99803	0	0	9.44808	0	0	0	0	0	0	0	0	0
Q96BP3	PPWD1_HUMAN	Peptidylprolyl isomerase domain and WD repeat-containing protein 1 (EC 5.2.1.8) (Spliceosome-associated cyclophilin)	PPWD1 KIAA0073	Homo sapiens (Human)	"mRNA splicing, via spliceosome [GO:0000398]; protein peptidyl-prolyl isomerization [GO:0000413]"	catalytic step 2 spliceosome [GO:0071013]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]	cyclosporin A binding [GO:0016018]; peptidyl-prolyl cis-trans isomerase activity [GO:0003755]	SGMIEYWTGPPHEYK	0.88129	0	0	0	0	0	0	0	9.44145	0	0	0	0
Q8IYN0	ZN100_HUMAN	Zinc finger protein 100	ZNF100	Homo sapiens (Human)	regulation of DNA-templated transcription [GO:0006355]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	KYGKYGHDNLQLQK	0.86659	0	0	0	0	0	0	0	0	9.43634	0	0	0
Q15542	TAF5_HUMAN	Transcription initiation factor TFIID subunit 5 (Transcription initiation factor TFIID 100 kDa subunit) (TAF(II)100) (TAFII-100) (TAFII100)	TAF5 TAF2D	Homo sapiens (Human)	DNA-templated transcription initiation [GO:0006352]; histone H3 acetylation [GO:0043966]; monoubiquitinated histone deubiquitination [GO:0035521]; monoubiquitinated histone H2A deubiquitination [GO:0035522]; mRNA transcription by RNA polymerase II [GO:0042789]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of transcription initiation by RNA polymerase II [GO:0060261]; protein phosphorylation [GO:0006468]; regulation of DNA repair [GO:0006282]; regulation of transcription by RNA polymerase II [GO:0006357]; RNA polymerase II preinitiation complex assembly [GO:0051123]; transcription initiation at RNA polymerase II promoter [GO:0006367]	actin cytoskeleton [GO:0015629]; chromatin [GO:0000785]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription factor TFIID complex [GO:0005669]; transcription factor TFTC complex [GO:0033276]	identical protein binding [GO:0042802]; RNA polymerase II general transcription initiation factor activity [GO:0016251]	IMDEKTASELK	0.99807	0	0	0	0	0	9.43296	0	0	0	0	0	0
O75908	SOAT2_HUMAN	Sterol O-acyltransferase 2 (EC 2.3.1.26) (Acyl-coenzyme A:cholesterol acyltransferase 2) (ACAT-2) (Cholesterol acyltransferase 2)	SOAT2 ACACT2 ACAT2	Homo sapiens (Human)	cholesterol efflux [GO:0033344]; cholesterol esterification [GO:0034435]; cholesterol homeostasis [GO:0042632]; cholesterol metabolic process [GO:0008203]; intestinal cholesterol absorption [GO:0030299]; low-density lipoprotein particle clearance [GO:0034383]; macrophage derived foam cell differentiation [GO:0010742]; very-low-density lipoprotein particle assembly [GO:0034379]	brush border [GO:0005903]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	acyltransferase activity [GO:0016746]; cholesterol binding [GO:0015485]; cholesterol O-acyltransferase activity [GO:0034736]; fatty-acyl-CoA binding [GO:0000062]; O-acyltransferase activity [GO:0008374]; sterol O-acyltransferase activity [GO:0004772]	CVLVFEQVR	0.94378	0	9.42677	0	0	0	0	0	0	0	0	0	0
Q86WI3	NLRC5_HUMAN	Protein NLRC5 (Caterpiller protein 16.1) (CLR16.1) (Nucleotide-binding oligomerization domain protein 27) (Nucleotide-binding oligomerization domain protein 4)	NLRC5 NOD27 NOD4	Homo sapiens (Human)	defense response to virus [GO:0051607]; innate immune response [GO:0045087]; intracellular signal transduction [GO:0035556]; negative regulation of NF-kappaB transcription factor activity [GO:0032088]; negative regulation of type I interferon-mediated signaling pathway [GO:0060339]; positive regulation of interferon-gamma-mediated signaling pathway [GO:0060335]; positive regulation of MHC class I biosynthetic process [GO:0045345]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of type I interferon-mediated signaling pathway [GO:0060340]; regulation of kinase activity [GO:0043549]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleus [GO:0005634]	ATP binding [GO:0005524]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]	LNRNSIGDVGCCHLSEALR	0.83436	0	9.42639	0	0	0	0	0	0	0	0	0	0
Q9BWH6	RPAP1_HUMAN	RNA polymerase II-associated protein 1	RPAP1 KIAA1403	Homo sapiens (Human)	transcription by RNA polymerase II [GO:0006366]	DNA-directed RNA polymerase complex [GO:0000428]; nucleus [GO:0005634]	DNA binding [GO:0003677]; nucleotidyltransferase activity [GO:0016779]	EDEDEDEECPAGK	0.82618	9.42423	0	0	0	0	0	0	0	0	0	0	0
A0A1W2PPF3	DUXB_HUMAN	Double homeobox protein B	DUXB	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	IQMWFQKQR	0.99887	0	9.41926	0	0	0	0	0	0	0	0	0	0
P08048	ZFY_HUMAN	Zinc finger Y-chromosomal protein	ZFY	Homo sapiens (Human)	fertilization [GO:0009566]; homeostasis of number of cells [GO:0048872]; multicellular organism growth [GO:0035264]; oocyte development [GO:0048599]; ovarian follicle development [GO:0001541]; parental behavior [GO:0060746]; positive regulation of transcription by RNA polymerase II [GO:0045944]; post-embryonic development [GO:0009791]; regulation of transcription by RNA polymerase II [GO:0006357]; spermatogenesis [GO:0007283]	chromatin [GO:0000785]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]"	FKSRGFLK	0.87207	0	0	0	0	0	0	0	0	0	0	0	9.41901
P30086	PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 (PEBP-1) (HCNPpp) (Neuropolypeptide h3) (Prostatic-binding protein) (Raf kinase inhibitor protein) (RKIP) [Cleaved into: Hippocampal cholinergic neurostimulating peptide (HCNP)]	PEBP1 PBP PEBP	Homo sapiens (Human)	negative regulation of MAPK cascade [GO:0043409]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; nucleus [GO:0005634]	ATP binding [GO:0005524]; enzyme binding [GO:0019899]; phosphatidylethanolamine binding [GO:0008429]; protein kinase binding [GO:0019901]; RNA binding [GO:0003723]; serine-type endopeptidase inhibitor activity [GO:0004867]	FKVASFRK	0.45402	0	0	0	0	0	0	0	0	0	0	0	9.41901
Q01082	SPTB2_HUMAN	"Spectrin beta chain, non-erythrocytic 1 (Beta-II spectrin) (Fodrin beta chain) (Spectrin, non-erythroid beta chain 1)"	SPTBN1 SPTB2	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; actin filament capping [GO:0051693]; central nervous system development [GO:0007417]; central nervous system formation [GO:0021556]; common-partner SMAD protein phosphorylation [GO:0007182]; Golgi to plasma membrane protein transport [GO:0043001]; membrane assembly [GO:0071709]; mitotic cytokinesis [GO:0000281]; plasma membrane organization [GO:0007009]; positive regulation of interleukin-2 production [GO:0032743]; positive regulation of protein localization to plasma membrane [GO:1903078]; protein localization to plasma membrane [GO:0072659]; regulation of protein localization to plasma membrane [GO:1903076]; regulation of SMAD protein signal transduction [GO:0060390]	axolemma [GO:0030673]; cell junction [GO:0030054]; cell projection [GO:0042995]; cortical actin cytoskeleton [GO:0030864]; cuticular plate [GO:0032437]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; glutamatergic synapse [GO:0098978]; M band [GO:0031430]; nucleolus [GO:0005730]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; spectrin [GO:0008091]; spectrin-associated cytoskeleton [GO:0014731]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; ankyrin binding [GO:0030506]; cadherin binding [GO:0045296]; calmodulin binding [GO:0005516]; GTPase binding [GO:0051020]; phospholipid binding [GO:0005543]; RNA binding [GO:0003723]; structural constituent of cytoskeleton [GO:0005200]	RENEVLEAWK	0.82185	0	0	0	0	0	0	0	0	0	0	0	9.41901
Q8IZ13	ZBED8_HUMAN	Protein ZBED8 (Transposon-derived Buster3 transposase-like protein) (Zinc finger BED domain-containing protein 8)	ZBED8 Buster3 C5orf54	Homo sapiens (Human)		nucleoplasm [GO:0005654]		SCFNLSDDIR	0.93664	0	9.41792	0	0	0	0	0	0	0	0	0	0
Q5XG99	LYSM4_HUMAN	LysM and putative peptidoglycan-binding domain-containing protein 4	LYSMD4	Homo sapiens (Human)		integral component of membrane [GO:0016021]		EQDLYALK	0.92244	9.41652	0	0	0	0	0	0	0	0	0	0	0
Q9BZR9	TRIM8_HUMAN	E3 ubiquitin-protein ligase TRIM8 (EC 2.3.2.27) (Glioblastoma-expressed RING finger protein) (RING finger protein 27) (RING-type E3 ubiquitin transferase TRIM8) (Tripartite motif-containing protein 8)	TRIM8 GERP RNF27	Homo sapiens (Human)	innate immune response [GO:0045087]; negative regulation of viral entry into host cell [GO:0046597]; negative regulation of viral transcription [GO:0032897]; positive regulation of autophagy [GO:0010508]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of protein localization to nucleus [GO:1900182]; protein ubiquitination [GO:0016567]; stem cell population maintenance [GO:0019827]; suppression of viral release by host [GO:0044790]	cytosol [GO:0005829]; nucleus [GO:0005634]; PML body [GO:0016605]	identical protein binding [GO:0042802]; protein homodimerization activity [GO:0042803]; transcription coactivator activity [GO:0003713]; transferase activity [GO:0016740]; zinc ion binding [GO:0008270]	QQDRLEER	0.99977	0	0	9.41614	0	0	0	0	0	0	0	0	0
Q96HJ9	FMC1_HUMAN	"Protein FMC1 homolog (ATP synthase assembly factor FMC1, mitochondrial) (Formation of mitochondrial complex V assembly factor 1 homolog)"	FMC1 C7orf55 HSPC268	Homo sapiens (Human)	mitochondrial proton-transporting ATP synthase complex assembly [GO:0033615]; negative regulation of lipid catabolic process [GO:0050995]; regulation of type B pancreatic cell proliferation [GO:0061469]	mitochondrion [GO:0005739]		HVALHQEFHGK	0.91862	0	0	0	9.41595	0	0	0	0	0	0	0	0
P04114	APOB_HUMAN	Apolipoprotein B-100 (Apo B-100) [Cleaved into: Apolipoprotein B-48 (Apo B-48)]	APOB	Homo sapiens (Human)	artery morphogenesis [GO:0048844]; cellular response to prostaglandin stimulus [GO:0071379]; cellular response to tumor necrosis factor [GO:0071356]; cholesterol efflux [GO:0033344]; cholesterol homeostasis [GO:0042632]; cholesterol metabolic process [GO:0008203]; cholesterol transport [GO:0030301]; establishment of localization in cell [GO:0051649]; fertilization [GO:0009566]; flagellated sperm motility [GO:0030317]; in utero embryonic development [GO:0001701]; lipoprotein biosynthetic process [GO:0042158]; lipoprotein catabolic process [GO:0042159]; lipoprotein transport [GO:0042953]; low-density lipoprotein particle clearance [GO:0034383]; low-density lipoprotein particle remodeling [GO:0034374]; nervous system development [GO:0007399]; positive regulation of cholesterol storage [GO:0010886]; positive regulation of gene expression [GO:0010628]; positive regulation of lipid storage [GO:0010884]; positive regulation of macrophage derived foam cell differentiation [GO:0010744]; post-embryonic development [GO:0009791]; regulation of cholesterol biosynthetic process [GO:0045540]; response to carbohydrate [GO:0009743]; response to estradiol [GO:0032355]; response to lipopolysaccharide [GO:0032496]; response to selenium ion [GO:0010269]; response to virus [GO:0009615]; spermatogenesis [GO:0007283]; triglyceride catabolic process [GO:0019433]; triglyceride mobilization [GO:0006642]; very-low-density lipoprotein particle assembly [GO:0034379]	chylomicron [GO:0042627]; chylomicron remnant [GO:0034360]; clathrin-coated endocytic vesicle membrane [GO:0030669]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; early endosome [GO:0005769]; endocytic vesicle lumen [GO:0071682]; endoplasmic reticulum exit site [GO:0070971]; endoplasmic reticulum lumen [GO:0005788]; endoplasmic reticulum membrane [GO:0005789]; endosome lumen [GO:0031904]; endosome membrane [GO:0010008]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; high-density lipoprotein particle [GO:0034364]; intermediate-density lipoprotein particle [GO:0034363]; intracellular membrane-bounded organelle [GO:0043231]; lipid droplet [GO:0005811]; low-density lipoprotein particle [GO:0034362]; lysosomal lumen [GO:0043202]; mature chylomicron [GO:0034359]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886]; smooth endoplasmic reticulum [GO:0005790]; very-low-density lipoprotein particle [GO:0034361]; vesicle lumen [GO:0031983]	cholesterol transfer activity [GO:0120020]; heparin binding [GO:0008201]; lipase binding [GO:0035473]; low-density lipoprotein particle receptor binding [GO:0050750]; phospholipid binding [GO:0005543]	EFQVPTFTIPK	0	9.41128	0	0	0	0	0	0	0	0	0	0	0
P59103	DAOA_HUMAN	D-amino acid oxidase activator (Protein G72)	DAOA G72	Homo sapiens (Human)	negative regulation of D-amino-acid oxidase activity [GO:1900758]; positive regulation of catalytic activity [GO:0043085]	Golgi apparatus [GO:0005794]; mitochondrion [GO:0005739]; perinuclear region of cytoplasm [GO:0048471]	enzyme activator activity [GO:0008047]; enzyme binding [GO:0019899]	QPLERMWTCNYNQQK	0.87266	9.40493	0	0	0	0	0	0	0	0	0	0	0
P80098	CCL7_HUMAN	C-C motif chemokine 7 (Monocyte chemoattractant protein 3) (Monocyte chemotactic protein 3) (MCP-3) (NC28) (Small-inducible cytokine A7)	CCL7 MCP3 SCYA6 SCYA7	Homo sapiens (Human)	cell-cell signaling [GO:0007267]; cellular calcium ion homeostasis [GO:0006874]; cellular response to ethanol [GO:0071361]; cellular response to interferon-gamma [GO:0071346]; cellular response to interleukin-1 [GO:0071347]; cellular response to tumor necrosis factor [GO:0071356]; chemokine-mediated signaling pathway [GO:0070098]; chemotaxis [GO:0006935]; cytoskeleton organization [GO:0007010]; eosinophil chemotaxis [GO:0048245]; G protein-coupled receptor signaling pathway [GO:0007186]; inflammatory response [GO:0006954]; lymphocyte chemotaxis [GO:0048247]; monocyte chemotaxis [GO:0002548]; neutrophil chemotaxis [GO:0030593]; positive regulation of cell migration [GO:0030335]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of GTPase activity [GO:0043547]; positive regulation of natural killer cell chemotaxis [GO:2000503]; regulation of cell shape [GO:0008360]; response to gamma radiation [GO:0010332]; signal transduction [GO:0007165]	extracellular region [GO:0005576]; extracellular space [GO:0005615]	CCR chemokine receptor binding [GO:0048020]; CCR1 chemokine receptor binding [GO:0031726]; CCR2 chemokine receptor binding [GO:0031727]; chemokine activity [GO:0008009]; heparin binding [GO:0008201]	EICADPTQKWVQDFMK	0.87313	9.40493	0	0	0	0	0	0	0	0	0	0	0
Q66K14	TBC9B_HUMAN	TBC1 domain family member 9B	TBC1D9B KIAA0676	Homo sapiens (Human)	activation of GTPase activity [GO:0090630]	integral component of membrane [GO:0016021]	calcium ion binding [GO:0005509]; GTPase activator activity [GO:0005096]	MKEESWHIHFFEYGR	0.87088	9.40493	0	0	0	0	0	0	0	0	0	0	0
P25325	THTM_HUMAN	3-mercaptopyruvate sulfurtransferase (MST) (EC 2.8.1.2)	MPST TST2	Homo sapiens (Human)	cyanate catabolic process [GO:0009440]; hydrogen sulfide biosynthetic process [GO:0070814]; kidney development [GO:0001822]; liver development [GO:0001889]; response to toxic substance [GO:0009636]; spinal cord development [GO:0021510]; sulfur amino acid catabolic process [GO:0000098]; transsulfuration [GO:0019346]	anchoring junction [GO:0070161]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]; neuron projection [GO:0043005]; synapse [GO:0045202]	3-mercaptopyruvate sulfurtransferase activity [GO:0016784]; identical protein binding [GO:0042802]; thiosulfate sulfurtransferase activity [GO:0004792]	DARREFEER	0.86344	0	0	0	0	9.38899	0	0	0	0	0	0	0
O43918	AIRE_HUMAN	Autoimmune regulator (Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein) (APECED protein)	AIRE APECED	Homo sapiens (Human)	central tolerance induction to self antigen [GO:0002509]; humoral immune response [GO:0006959]; immune response [GO:0006955]; negative thymic T cell selection [GO:0045060]; peripheral T cell tolerance induction [GO:0002458]; positive regulation of chemokine production [GO:0032722]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of DNA-templated transcription [GO:0006355]; regulation of thymocyte migration [GO:2000410]; thymus epithelium morphogenesis [GO:0097536]; transcription by RNA polymerase II [GO:0006366]	cytoplasm [GO:0005737]; female germ cell nucleus [GO:0001674]; male germ cell nucleus [GO:0001673]; nuclear body [GO:0016604]; nucleus [GO:0005634]	chromatin binding [GO:0003682]; histone binding [GO:0042393]; identical protein binding [GO:0042802]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; translation regulator activity [GO:0045182]; zinc ion binding [GO:0008270]	VLFKDYNLER	0.99884	0	0	0	0	0	0	9.38679	0	0	0	0	0
P62917	RL8_HUMAN	60S ribosomal protein L8 (Large ribosomal subunit protein uL2)	RPL8	Homo sapiens (Human)	cytoplasmic translation [GO:0002181]; translation [GO:0006412]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; cytosolic large ribosomal subunit [GO:0022625]; cytosolic ribosome [GO:0022626]; focal adhesion [GO:0005925]; membrane [GO:0016020]; polysomal ribosome [GO:0042788]; postsynapse [GO:0098794]; postsynaptic density [GO:0014069]	RNA binding [GO:0003723]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]	AKRNCWPR	0.94244	0	0	9.38427	0	0	0	0	0	0	0	0	0
Q8IYS1	P20D2_HUMAN	Xaa-Arg dipeptidase (EC 3.4.13.4) (Beta-Ala-Lys dipeptidase)	PM20D2 ACY1L2	Homo sapiens (Human)	proteolysis [GO:0006508]; regulation of cellular protein metabolic process [GO:0032268]	nucleoplasm [GO:0005654]	carboxypeptidase activity [GO:0004180]; dipeptidase activity [GO:0016805]; identical protein binding [GO:0042802]	AEWEPPEAR	0.93819	0	0	0	0	0	0	0	0	0	0	9.3805	0
Q9H1P3	OSBL2_HUMAN	Oxysterol-binding protein-related protein 2 (ORP-2) (OSBP-related protein 2)	OSBPL2 KIAA0772 ORP2	Homo sapiens (Human)	bile acid biosynthetic process [GO:0006699]; cholesterol transport [GO:0030301]; intracellular cholesterol transport [GO:0032367]; phospholipid transport [GO:0015914]; plasma membrane organization [GO:0007009]; protein homotetramerization [GO:0051289]	cytosol [GO:0005829]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]; intracellular membrane-bounded organelle [GO:0043231]; lipid droplet [GO:0005811]; membrane [GO:0016020]	"cholesterol binding [GO:0015485]; cholesterol transfer activity [GO:0120020]; phosphatidylinositol transfer activity [GO:0008526]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]; sterol binding [GO:0032934]; sterol transporter activity [GO:0015248]"	LKFWGKSVEAEPR	0.87372	0	9.37979	0	0	0	0	0	0	0	0	0	0
P51690	ARSL_HUMAN	Arylsulfatase L (EC 3.1.6.1) (Arylsulfatase E) (ASE)	ARSL ARSE	Homo sapiens (Human)	skeletal system development [GO:0001501]	endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; Golgi stack [GO:0005795]	arylsulfatase activity [GO:0004065]; metal ion binding [GO:0046872]	VPGIFRWPGVLPAGR	0.99808	0	0	0	0	0	0	0	9.37606	0	0	0	0
P43897	EFTS_HUMAN	"Elongation factor Ts, mitochondrial (EF-Ts) (EF-TsMt)"	TSFM	Homo sapiens (Human)	mitochondrial translational elongation [GO:0070125]; regulation of DNA-templated transcription elongation [GO:0032784]; regulation of mitochondrial translation [GO:0070129]; translational elongation [GO:0006414]	mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]	RNA binding [GO:0003723]; translation elongation factor activity [GO:0003746]	TGYSFVNCKKALETCGGDLK	0.9376	0	0	0	0	9.37284	0	0	0	0	0	0	0
A2NJV5	KV229_HUMAN	Immunoglobulin kappa variable 2-29	IGKV2-29	Homo sapiens (Human)	adaptive immune response [GO:0002250]; immune response [GO:0006955]	extracellular region [GO:0005576]; extracellular space [GO:0005615]; immunoglobulin complex [GO:0019814]; plasma membrane [GO:0005886]		FSGSGSGTDFTLK	0	9.37175	0	0	0	0	0	0	0	0	0	0	0
C9JN71	ZN878_HUMAN	Zinc finger protein 878	ZNF878	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	AFFSPSSLKRHEK	0.93998	0	0	0	0	0	0	0	0	0	9.36131	0	0
Q92831	KAT2B_HUMAN	Histone acetyltransferase KAT2B (EC 2.3.1.48) (Histone acetyltransferase PCAF) (Histone acetylase PCAF) (Lysine acetyltransferase 2B) (P300/CBP-associated factor) (P/CAF) (Spermidine acetyltransferase KAT2B) (EC 2.3.1.57)	KAT2B PCAF	Homo sapiens (Human)	cell cycle [GO:0007049]; cellular response to insulin stimulus [GO:0032869]; chromatin remodeling [GO:0006338]; epigenetic maintenance of chromatin in transcription-competent conformation [GO:0045815]; gluconeogenesis [GO:0006094]; heart development [GO:0007507]; histone acetylation [GO:0016573]; histone H3 acetylation [GO:0043966]; histone H3-K9 acetylation [GO:0043970]; internal peptidyl-lysine acetylation [GO:0018393]; limb development [GO:0060173]; N-terminal peptidyl-lysine acetylation [GO:0018076]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of centriole replication [GO:0046600]; negative regulation of rRNA processing [GO:2000233]; peptidyl-lysine acetylation [GO:0018394]; positive regulation of attachment of mitotic spindle microtubules to kinetochore [GO:1902425]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of gluconeogenesis [GO:0045722]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein acetylation [GO:0006473]; regulation of cell cycle [GO:0051726]; regulation of DNA repair [GO:0006282]; regulation of DNA-templated transcription [GO:0006355]; regulation of embryonic development [GO:0045995]; regulation of protein ADP-ribosylation [GO:0010835]; regulation of RNA splicing [GO:0043484]; rhythmic process [GO:0048511]	A band [GO:0031672]; actomyosin [GO:0042641]; ATAC complex [GO:0140672]; centrosome [GO:0005813]; cytosol [GO:0005829]; histone acetyltransferase complex [GO:0000123]; I band [GO:0031674]; kinetochore [GO:0000776]; mitotic spindle [GO:0072686]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]; SAGA complex [GO:0000124]	"acetyltransferase activity [GO:0016407]; chromatin binding [GO:0003682]; cyclin-dependent protein serine/threonine kinase inhibitor activity [GO:0004861]; diamine N-acetyltransferase activity [GO:0004145]; DNA-binding transcription factor binding [GO:0140297]; H3 histone acetyltransferase activity [GO:0010484]; histone acetyltransferase activity [GO:0004402]; histone deacetylase binding [GO:0042826]; lysine N-acetyltransferase activity, acting on acetyl phosphate as donor [GO:0004468]; peptide-lysine-N-acetyltransferase activity [GO:0061733]; protein kinase binding [GO:0019901]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; transcription coactivator activity [GO:0003713]; transcription coregulator activity [GO:0003712]"	EEDADTKQVYFYLFK	0.87224	0	0	0	0	0	9.35942	0	0	0	0	0	0
Q9NRY4	RHG35_HUMAN	Rho GTPase-activating protein 35 (Glucocorticoid receptor DNA-binding factor 1) (Glucocorticoid receptor repression factor 1) (GRF-1) (Rho GAP p190A) (p190-A)	ARHGAP35 GRF1 GRLF1 KIAA1722 P190A p190ARHOGAP	Homo sapiens (Human)	"axon guidance [GO:0007411]; axonal fasciculation [GO:0007413]; camera-type eye development [GO:0043010]; cell migration [GO:0016477]; cellular response to extracellular stimulus [GO:0031668]; central nervous system neuron axonogenesis [GO:0021955]; establishment or maintenance of actin cytoskeleton polarity [GO:0030950]; forebrain development [GO:0030900]; mammary gland development [GO:0030879]; negative regulation of Rho protein signal transduction [GO:0035024]; negative regulation of vascular permeability [GO:0043116]; neural tube closure [GO:0001843]; neuron projection guidance [GO:0097485]; positive regulation of cilium assembly [GO:0045724]; positive regulation of GTPase activity [GO:0043547]; positive regulation of neuron projection development [GO:0010976]; regulation of actin cytoskeleton organization [GO:0032956]; regulation of actin polymerization or depolymerization [GO:0008064]; regulation of axonogenesis [GO:0050770]; regulation of cell shape [GO:0008360]; regulation of cell size [GO:0008361]; regulation of small GTPase mediated signal transduction [GO:0051056]; Rho protein signal transduction [GO:0007266]; wound healing, spreading of cells [GO:0044319]"	actin cytoskeleton [GO:0015629]; ciliary basal body [GO:0036064]; cytosol [GO:0005829]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	DNA binding [GO:0003677]; GTP binding [GO:0005525]; GTPase activating protein binding [GO:0032794]; GTPase activator activity [GO:0005096]; GTPase activity [GO:0003924]; phospholipid binding [GO:0005543]; protein-containing complex binding [GO:0044877]	HQKQIIDK	0.99803	0	0	0	0	0	0	9.34385	0	0	0	0	0
Q9Y242	TCF19_HUMAN	Transcription factor 19 (TCF-19) (Transcription factor SC1)	TCF19 SC1	Homo sapiens (Human)	regulation of gene expression [GO:0010468]	nucleus [GO:0005634]	metal ion binding [GO:0046872]	MLPCFQLLR	0.94136	0	0	0	0	0	0	9.34385	0	0	0	0	0
Q9UPN4	CP131_HUMAN	Centrosomal protein of 131 kDa (5-azacytidine-induced protein 1) (Pre-acrosome localization protein 1)	CEP131 AZI1 KIAA1118	Homo sapiens (Human)	cell cycle [GO:0007049]; cilium assembly [GO:0060271]; intraciliary transport involved in cilium assembly [GO:0035735]; intramanchette transport [GO:1990953]; manchette assembly [GO:1905198]; non-motile cilium assembly [GO:1905515]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of intracellular protein transport [GO:0090316]; protein localization to centrosome [GO:0071539]; regulation of centrosome duplication [GO:0010824]; sperm axoneme assembly [GO:0007288]	acrosomal vesicle [GO:0001669]; centriolar satellite [GO:0034451]; centriole [GO:0005814]; centrosome [GO:0005813]; ciliary basal body [GO:0036064]; ciliary transition zone [GO:0035869]; cytosol [GO:0005829]; intercellular bridge [GO:0045171]; intracellular membrane-bounded organelle [GO:0043231]; manchette [GO:0002177]; microtubule cytoskeleton [GO:0015630]; sperm head-tail coupling apparatus [GO:0120212]	protein homodimerization activity [GO:0042803]; protein-containing complex binding [GO:0044877]	AAESRIK	0.87163	0	0	9.34303	0	0	0	0	0	0	0	0	0
Q9BZJ0	CRNL1_HUMAN	Crooked neck-like protein 1 (Crooked neck homolog) (hCrn)	CRNKL1 CRN CGI-201 MSTP021	Homo sapiens (Human)	"mRNA splicing, via spliceosome [GO:0000398]; spliceosomal complex assembly [GO:0000245]"	catalytic step 2 spliceosome [GO:0071013]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; post-mRNA release spliceosomal complex [GO:0071014]; Prp19 complex [GO:0000974]; spliceosomal complex [GO:0005681]; U2-type catalytic step 2 spliceosome [GO:0071007]	RNA binding [GO:0003723]	QDAQELFK	0.91672	0	0	0	0	0	0	0	9.34094	0	0	0	0
P62280	RS11_HUMAN	40S ribosomal protein S11 (Small ribosomal subunit protein uS17)	RPS11	Homo sapiens (Human)	cytoplasmic translation [GO:0002181]; translation [GO:0006412]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; cytosolic ribosome [GO:0022626]; cytosolic small ribosomal subunit [GO:0022627]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; membrane [GO:0016020]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; ribosome [GO:0005840]	RNA binding [GO:0003723]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]	ILSGVVTKMK	1	0	0	0	0	0	0	9.33561	0	0	0	0	0
Q86T75	NBPFB_HUMAN	Neuroblastoma breakpoint family member 11 (Neuroblastoma breakpoint family member 24)	NBPF11 NBPF24	Homo sapiens (Human)		cytoplasm [GO:0005737]		KNMLAFLLTWEK	0.42771	0	0	9.33376	0	0	0	0	0	0	0	0	0
Q96TA0	PCDBI_HUMAN	Putative protocadherin beta-18 (PCDH-beta-18) (PCDH-psi2)	PCDHB18P PCDHB18	Homo sapiens (Human)	cell adhesion [GO:0007155]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; nervous system development [GO:0007399]	integral component of plasma membrane [GO:0005887]	calcium ion binding [GO:0005509]	DSEMEKAPPF	0.99956	0	9.32542	0	0	0	0	0	0	0	0	0	0
Q9P209	CEP72_HUMAN	Centrosomal protein of 72 kDa (Cep72)	CEP72 KIAA1519	Homo sapiens (Human)	centriole replication [GO:0007099]; gamma-tubulin complex localization [GO:0033566]; regulation of protein localization to centrosome [GO:1904779]; spindle organization [GO:0007051]	centriolar satellite [GO:0034451]; centrosome [GO:0005813]; cytosol [GO:0005829]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]		LDLSGEMVPGPLPAPGK	0.58893	0	0	0	0	0	0	0	0	9.3161	0	0	0
Q96H35	RBM18_HUMAN	Probable RNA-binding protein 18 (RNA-binding motif protein 18)	RBM18	Homo sapiens (Human)		cytosol [GO:0005829]; intercellular bridge [GO:0045171]; nucleoplasm [GO:0005654]	RNA binding [GO:0003723]	RTTPYSRTAWK	0.99717	0	0	0	9.3152	0	0	0	0	0	0	0	0
P54577	SYYC_HUMAN	"Tyrosine--tRNA ligase, cytoplasmic (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) (TyrRS) [Cleaved into: Tyrosine--tRNA ligase, cytoplasmic, N-terminally processed]"	YARS1 YARS	Homo sapiens (Human)	apoptotic process [GO:0006915]; tyrosyl-tRNA aminoacylation [GO:0006437]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular space [GO:0005615]; nuclear body [GO:0016604]; nucleus [GO:0005634]	ATP binding [GO:0005524]; interleukin-8 receptor binding [GO:0005153]; RNA binding [GO:0003723]; small molecule binding [GO:0036094]; tRNA binding [GO:0000049]; tyrosine-tRNA ligase activity [GO:0004831]	ISEECIAQWK	0.99777	0	0	0	0	9.30879	0	0	0	0	0	0	0
Q8WV24	PHLA1_HUMAN	Pleckstrin homology-like domain family A member 1 (Apoptosis-associated nuclear protein) (Proline- and glutamine-rich protein) (PQ-rich protein) (PQR protein) (Proline- and histidine-rich protein) (T-cell death-associated gene 51 protein)	PHLDA1 PHRIP TDAG51	Homo sapiens (Human)	apoptotic process [GO:0006915]; FasL biosynthetic process [GO:0045210]; positive regulation of apoptotic process [GO:0043065]	cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	phosphatidylinositol phosphate binding [GO:1901981]	WPIQKRR	0.94271	0	0	0	0	9.30879	0	0	0	0	0	0	0
O60231	DHX16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 (EC 3.6.4.13) (ATP-dependent RNA helicase #3) (DEAH-box protein 16)	DHX16 DBP2 DDX16 KIAA0577 PRP2	Homo sapiens (Human)	"mRNA splicing, via spliceosome [GO:0000398]; RNA splicing [GO:0008380]"	nucleoplasm [GO:0005654]; nucleus [GO:0005634]; spliceosomal complex [GO:0005681]; U2-type precatalytic spliceosome [GO:0071005]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724]	ELEDPHAK	0.94248	0	9.30118	0	0	0	0	0	0	0	0	0	0
O60229	KALRN_HUMAN	Kalirin (EC 2.7.11.1) (Huntingtin-associated protein-interacting protein) (Protein Duo) (Serine/threonine-protein kinase with Dbl- and pleckstrin homology domain)	KALRN DUET DUO HAPIP TRAD	Homo sapiens (Human)	axon guidance [GO:0007411]; central nervous system development [GO:0007417]; ephrin receptor signaling pathway [GO:0048013]; intracellular signal transduction [GO:0035556]; nervous system development [GO:0007399]; protein phosphorylation [GO:0006468]; regulation of small GTPase mediated signal transduction [GO:0051056]; signal transduction [GO:0007165]; vesicle-mediated transport [GO:0016192]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extrinsic component of membrane [GO:0019898]; nucleoplasm [GO:0005654]; postsynaptic density [GO:0014069]	ATP binding [GO:0005524]; guanyl-nucleotide exchange factor activity [GO:0005085]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	KEFIMAELLQTEK	0.675	0	0	9.29262	0	0	0	0	0	0	0	0	0
Q8NDA2	HMCN2_HUMAN	Hemicentin-2	HMCN2	Homo sapiens (Human)	response to stimulus [GO:0050896]	cleavage furrow [GO:0032154]; collagen-containing extracellular matrix [GO:0062023]; extracellular matrix [GO:0031012]; extracellular space [GO:0005615]	calcium ion binding [GO:0005509]	AAVSREDSGTYVCWAENR	0.86906	0	0	0	0	9.28912	0	0	0	0	0	0	0
Q6JQN1	ACD10_HUMAN	Acyl-CoA dehydrogenase family member 10 (ACAD-10) (EC 1.3.99.-)	ACAD10	Homo sapiens (Human)	fatty acid beta-oxidation [GO:0006635]; fatty acid beta-oxidation using acyl-CoA dehydrogenase [GO:0033539]	cytoplasm [GO:0005737]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]	acyl-CoA dehydrogenase activity [GO:0003995]; flavin adenine dinucleotide binding [GO:0050660]	VNDPETAVK	0.94115	0	9.28817	0	0	0	0	0	0	0	0	0	0
Q9NVN8	GNL3L_HUMAN	Guanine nucleotide-binding protein-like 3-like protein	GNL3L	Homo sapiens (Human)	"negative regulation of protein binding [GO:0032091]; negative regulation of protein sumoylation [GO:0033234]; negative regulation of protein ubiquitination [GO:0031397]; negative regulation of telomere maintenance via telomerase [GO:0032211]; positive regulation of protein localization to chromosome, telomeric region [GO:1904816]; positive regulation of protein-containing complex assembly [GO:0031334]; regulation of protein stability [GO:0031647]; ribosome biogenesis [GO:0042254]"	cytosol [GO:0005829]; membrane [GO:0016020]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; telomerase holoenzyme complex [GO:0005697]	GTP binding [GO:0005525]; RNA binding [GO:0003723]	SSLINSLKR	0.99861	0	0	0	0	0	0	0	0	0	0	0	9.27207
Q96T76	MMS19_HUMAN	MMS19 nucleotide excision repair protein homolog (hMMS19) (MET18 homolog) (MMS19-like protein)	MMS19 MMS19L	Homo sapiens (Human)	cellular response to DNA damage stimulus [GO:0006974]; chromosome segregation [GO:0007059]; DNA metabolic process [GO:0006259]; DNA repair [GO:0006281]; DNA-templated transcription [GO:0006351]; iron-sulfur cluster assembly [GO:0016226]; nucleotide-excision repair [GO:0006289]; phosphorelay signal transduction system [GO:0000160]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of double-strand break repair via homologous recombination [GO:1905168]; protein maturation by iron-sulfur cluster transfer [GO:0097428]; response to hormone [GO:0009725]	CIA complex [GO:0097361]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; microtubule organizing center [GO:0005815]; MMXD complex [GO:0071817]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; spindle [GO:0005819]; transcription factor TFIIH holo complex [GO:0005675]	enzyme binding [GO:0019899]; nuclear estrogen receptor binding [GO:0030331]; protein-macromolecule adaptor activity [GO:0030674]; signaling receptor complex adaptor activity [GO:0030159]; transcription coactivator activity [GO:0003713]	AGHAEVRIMFR	0.99977	0	0	9.26627	0	0	0	0	0	0	0	0	0
O94892	ZN432_HUMAN	Zinc finger protein 432	ZNF432 KIAA0798	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	SYLCSECGK	0.94325	0	0	0	0	0	0	0	0	0	0	0	9.26508
Q14699	RFTN1_HUMAN	Raftlin (Cell migration-inducing gene 2 protein) (Raft-linking protein)	RFTN1 KIAA0084 MIG2	Homo sapiens (Human)	B cell receptor signaling pathway [GO:0050853]; dsRNA transport [GO:0033227]; membrane raft assembly [GO:0001765]; positive regulation of growth rate [GO:0040010]; positive regulation of interleukin-17 production [GO:0032740]; protein localization to membrane raft [GO:1903044]; protein transport into membrane raft [GO:0032596]; response to exogenous dsRNA [GO:0043330]; T cell antigen processing and presentation [GO:0002457]; T cell receptor signaling pathway [GO:0050852]; toll-like receptor 3 signaling pathway [GO:0034138]	cytoplasm [GO:0005737]; early endosome [GO:0005769]; endosome [GO:0005768]; extracellular exosome [GO:0070062]; membrane raft [GO:0045121]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]	double-stranded RNA binding [GO:0003725]	TPLEHIFR	0.93261	0	0	0	0	0	0	0	9.26386	0	0	0	0
Q16625	OCLN_HUMAN	Occludin	OCLN	Homo sapiens (Human)	bicellular tight junction assembly [GO:0070830]; cell-cell junction organization [GO:0045216]; maintenance of blood-brain barrier [GO:0035633]; negative regulation of gene expression [GO:0010629]; negative regulation of protein phosphorylation [GO:0001933]; positive regulation of blood-brain barrier permeability [GO:1905605]; positive regulation of gene expression [GO:0010628]; positive regulation of glucose import [GO:0046326]; positive regulation of lamellipodium assembly [GO:0010592]; positive regulation of microtubule polymerization [GO:0031116]; positive regulation of wound healing [GO:0090303]; protein localization to cell leading edge [GO:1902463]; protein-containing complex assembly [GO:0065003]; regulation of glucose transmembrane transport [GO:0010827]	apical plasma membrane [GO:0016324]; apicolateral plasma membrane [GO:0016327]; bicellular tight junction [GO:0005923]; cell junction [GO:0030054]; cell leading edge [GO:0031252]; cell-cell junction [GO:0005911]; cytoplasmic vesicle [GO:0031410]; endocytic vesicle [GO:0030139]; integral component of membrane [GO:0016021]; lysosomal membrane [GO:0005765]; plasma membrane [GO:0005886]; protein-containing complex [GO:0032991]; tight junction [GO:0070160]	protein domain specific binding [GO:0019904]	WTSPPGVIR	0.94133	0	0	0	0	0	0	0	9.26386	0	0	0	0
Q14CM0	FRPD4_HUMAN	FERM and PDZ domain-containing protein 4 (PDZ domain-containing protein 10) (PSD-95-interacting regulator of spine morphogenesis) (Preso)	FRMPD4 KIAA0316 PDZD10 PDZK10	Homo sapiens (Human)	positive regulation of synapse structural plasticity [GO:0051835]	anchoring junction [GO:0070161]; cytoskeleton [GO:0005856]; dendritic spine [GO:0043197]; protein-containing complex [GO:0032991]	"phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]"	QSENLSR	0.90057	9.26146	0	0	0	0	0	0	0	0	0	0	0
Q2TBE0	C19L2_HUMAN	CWF19-like protein 2	CWF19L2	Homo sapiens (Human)	"mRNA splicing, via spliceosome [GO:0000398]"	post-mRNA release spliceosomal complex [GO:0071014]		SLESQGGR	0.88069	9.26146	0	0	0	0	0	0	0	0	0	0	0
Q6P6B1	ERIC5_HUMAN	Glutamate-rich protein 5	ERICH5 C8orf47	Homo sapiens (Human)				GCSSSALNK	0.93935	9.25963	0	0	0	0	0	0	0	0	0	0	0
Q7L311	ARMX2_HUMAN	Armadillo repeat-containing X-linked protein 2 (ARM protein lost in epithelial cancers on chromosome X 2) (Protein ALEX2)	ARMCX2 ALEX2 KIAA0512	Homo sapiens (Human)		integral component of membrane [GO:0016021]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]		EFNKGSLFYLCTTSGVCVK	0.87042	0	0	0	0	0	0	9.25463	0	0	0	0	0
P17948	VGFR1_HUMAN	Vascular endothelial growth factor receptor 1 (VEGFR-1) (EC 2.7.10.1) (Fms-like tyrosine kinase 1) (FLT-1) (Tyrosine-protein kinase FRT) (Tyrosine-protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor)	FLT1 FLT FRT VEGFR1	Homo sapiens (Human)	angiogenesis [GO:0001525]; blood vessel morphogenesis [GO:0048514]; cell migration [GO:0016477]; cellular response to vascular endothelial growth factor stimulus [GO:0035924]; embryonic morphogenesis [GO:0048598]; hematopoietic progenitor cell differentiation [GO:0002244]; hyaloid vascular plexus regression [GO:1990384]; monocyte chemotaxis [GO:0002548]; negative regulation of vascular endothelial cell proliferation [GO:1905563]; peptidyl-tyrosine phosphorylation [GO:0018108]; positive regulation of angiogenesis [GO:0045766]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of kinase activity [GO:0033674]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of phosphatidylinositol 3-kinase activity [GO:0043552]; positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; positive regulation of phospholipase C activity [GO:0010863]; protein autophosphorylation [GO:0046777]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]; vascular endothelial growth factor receptor signaling pathway [GO:0048010]; vascular endothelial growth factor receptor-1 signaling pathway [GO:0036323]	actin cytoskeleton [GO:0015629]; endosome [GO:0005768]; extracellular space [GO:0005615]; focal adhesion [GO:0005925]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]	ATP binding [GO:0005524]; growth factor binding [GO:0019838]; placental growth factor receptor activity [GO:0036332]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]; vascular endothelial growth factor receptor activity [GO:0005021]	GEAAHKWSLPEMVSKESER	0.93898	0	0	0	0	0	0	0	0	0	0	0	9.24757
Q6RI45	BRWD3_HUMAN	Bromodomain and WD repeat-containing protein 3	BRWD3	Homo sapiens (Human)	cytoskeleton organization [GO:0007010]; regulation of cell shape [GO:0008360]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]		GTGGRGR	0.42515	0	0	0	0	0	0	0	0	0	9.24615	0	0
O00408	PDE2A_HUMAN	"cGMP-dependent 3',5'-cyclic phosphodiesterase (EC 3.1.4.17) (Cyclic GMP-stimulated phosphodiesterase) (CGS-PDE) (cGSPDE)"	PDE2A	Homo sapiens (Human)	"adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway [GO:0007193]; aorta development [GO:0035904]; cAMP-mediated signaling [GO:0019933]; cellular response to 2,3,7,8-tetrachlorodibenzodioxine [GO:1904613]; cellular response to cAMP [GO:0071320]; cellular response to cGMP [GO:0071321]; cellular response to granulocyte macrophage colony-stimulating factor stimulus [GO:0097011]; cellular response to macrophage colony-stimulating factor stimulus [GO:0036006]; cellular response to mechanical stimulus [GO:0071260]; cellular response to transforming growth factor beta stimulus [GO:0071560]; cellular response to xenobiotic stimulus [GO:0071466]; cGMP catabolic process [GO:0046069]; cGMP-mediated signaling [GO:0019934]; establishment of endothelial barrier [GO:0061028]; heart valve development [GO:0003170]; monocyte differentiation [GO:0030224]; negative regulation of cAMP-mediated signaling [GO:0043951]; negative regulation of cGMP-mediated signaling [GO:0010754]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of vascular permeability [GO:0043116]; positive regulation of gene expression [GO:0010628]; positive regulation of inflammatory response [GO:0050729]; positive regulation of vascular permeability [GO:0043117]; regulation of cAMP-mediated signaling [GO:0043949]; regulation of cGMP-mediated signaling [GO:0010752]; regulation of mitochondrion organization [GO:0010821]; signal transduction [GO:0007165]; ventricular septum development [GO:0003281]"	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; mitochondrial inner membrane [GO:0005743]; mitochondrial matrix [GO:0005759]; mitochondrial outer membrane [GO:0005741]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; presynaptic membrane [GO:0042734]; synaptic membrane [GO:0097060]	"3',5'-cyclic-AMP phosphodiesterase activity [GO:0004115]; 3',5'-cyclic-GMP phosphodiesterase activity [GO:0047555]; 3',5'-cyclic-nucleotide phosphodiesterase activity [GO:0004114]; cAMP binding [GO:0030552]; cGMP binding [GO:0030553]; cGMP-stimulated cyclic-nucleotide phosphodiesterase activity [GO:0004118]; identical protein binding [GO:0042802]; magnesium ion binding [GO:0000287]; phosphate ion binding [GO:0042301]; protein homodimerization activity [GO:0042803]; TPR domain binding [GO:0030911]; zinc ion binding [GO:0008270]"	LKCECQALLQVAK	0.67314	0	0	0	0	9.24541	0	0	0	0	0	0	0
O75891	AL1L1_HUMAN	Cytosolic 10-formyltetrahydrofolate dehydrogenase (10-FTHFDH) (FDH) (EC 1.5.1.6) (Aldehyde dehydrogenase family 1 member L1)	ALDH1L1 FTHFD	Homo sapiens (Human)	10-formyltetrahydrofolate catabolic process [GO:0009258]; biosynthetic process [GO:0009058]; NADPH regeneration [GO:0006740]; one-carbon metabolic process [GO:0006730]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]	"aldehyde dehydrogenase (NAD+) activity [GO:0004029]; formyltetrahydrofolate dehydrogenase activity [GO:0016155]; hydroxymethyl-, formyl- and related transferase activity [GO:0016742]"	LSDHPDVR	0.94287	0	0	0	0	0	0	0	0	0	9.24129	0	0
Q9NYG2	ZDHC3_HUMAN	Palmitoyltransferase ZDHHC3 (EC 2.3.1.225) (Acyltransferase ZDHHC3) (EC 2.3.1.-) (Protein DHHC1) (Zinc finger DHHC domain-containing protein 3) (DHHC-3)	ZDHHC3 HSD49	Homo sapiens (Human)	"lipoprotein localization to membrane [GO:0044873]; peptidyl-L-cysteine S-palmitoylation [GO:0018230]; positive regulation of receptor localization to synapse [GO:1902685]; positive regulation of synaptic transmission, GABAergic [GO:0032230]; protein localization to photoreceptor outer segment [GO:1903546]; protein localization to plasma membrane [GO:0072659]; protein palmitoylation [GO:0018345]; protein targeting to membrane [GO:0006612]; regulation of G protein-coupled receptor signaling pathway [GO:0008277]; TRAIL-activated apoptotic signaling pathway [GO:0036462]"	endoplasmic reticulum [GO:0005783]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; membrane [GO:0016020]	palmitoyltransferase activity [GO:0016409]; protein homodimerization activity [GO:0042803]; protein-cysteine S-myristoyltransferase activity [GO:0019705]; protein-cysteine S-palmitoyltransferase activity [GO:0019706]; protein-cysteine S-stearoyltransferase activity [GO:0140439]	TKWMNMK	0.99717	0	0	0	0	0	0	0	0	0	9.24129	0	0
Q5SQN1	SNP47_HUMAN	Synaptosomal-associated protein 47 (SNAP-47) (Epididymis luminal protein 170) (Synaptosomal-associated 47 kDa protein)	SNAP47 C1orf142 HEL170 SVAP1	Homo sapiens (Human)	exocytosis [GO:0006887]; synaptic vesicle fusion to presynaptic active zone membrane [GO:0031629]; synaptic vesicle priming [GO:0016082]; vesicle fusion [GO:0006906]	endomembrane system [GO:0012505]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]; presynapse [GO:0098793]; SNARE complex [GO:0031201]	SNAP receptor activity [GO:0005484]; syntaxin binding [GO:0019905]	AARRGLHCAGAERPR	0.94641	0	0	0	0	0	0	0	9.23883	0	0	0	0
O94991	SLIK5_HUMAN	SLIT and NTRK-like protein 5 (Leucine-rich repeat-containing protein 11)	SLITRK5 KIAA0918 LRRC11	Homo sapiens (Human)	adult behavior [GO:0030534]; axonogenesis [GO:0007409]; chemical synaptic transmission [GO:0007268]; circulatory system development [GO:0072359]; dendrite morphogenesis [GO:0048813]; grooming behavior [GO:0007625]; positive regulation of synapse assembly [GO:0051965]; regulation of presynapse assembly [GO:1905606]; response to xenobiotic stimulus [GO:0009410]; skin development [GO:0043588]; striatum development [GO:0021756]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]; synapse [GO:0045202]		LNVEPDYLEVLEK	0.89667	0	0	0	9.23467	0	0	0	0	0	0	0	0
P20963	CD3Z_HUMAN	T-cell surface glycoprotein CD3 zeta chain (T-cell receptor T3 zeta chain) (CD antigen CD247)	CD247 CD3Z T3Z TCRZ	Homo sapiens (Human)	adaptive immune response [GO:0002250]; alpha-beta T cell activation [GO:0046631]; cell surface receptor signaling pathway [GO:0007166]; Fc-gamma receptor signaling pathway [GO:0038094]; gamma-delta T cell activation [GO:0046629]; positive regulation of protein localization to cell surface [GO:2000010]; protein-containing complex assembly [GO:0065003]; T cell receptor signaling pathway [GO:0050852]	alpha-beta T cell receptor complex [GO:0042105]; cytoplasm [GO:0005737]; Fc-gamma receptor III complex [GO:0033001]; gamma-delta T cell receptor complex [GO:0042106]; Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; T cell receptor complex [GO:0042101]	identical protein binding [GO:0042802]; protein heterodimerization activity [GO:0046982]; protein homodimerization activity [GO:0042803]; protein tyrosine kinase binding [GO:1990782]; transmembrane signaling receptor activity [GO:0004888]	KNPQEGLYNELQK	0.82889	0	0	0	9.23467	0	0	0	0	0	0	0	0
Q8N3I7	BBS5_HUMAN	Bardet-Biedl syndrome 5 protein	BBS5	Homo sapiens (Human)	cilium assembly [GO:0060271]; heart looping [GO:0001947]; intracellular transport [GO:0046907]; melanosome transport [GO:0032402]; motile cilium assembly [GO:0044458]; protein transport [GO:0015031]; response to stimulus [GO:0050896]; visual perception [GO:0007601]	axoneme [GO:0005930]; BBSome [GO:0034464]; centriolar satellite [GO:0034451]; ciliary basal body [GO:0036064]; ciliary membrane [GO:0060170]; cytosol [GO:0005829]	phosphatidylinositol-3-phosphate binding [GO:0032266]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]	EPVFSEELGLAIEK	0.49485	0	0	0	9.23467	0	0	0	0	0	0	0	0
Q92918	M4K1_HUMAN	Mitogen-activated protein kinase kinase kinase kinase 1 (EC 2.7.11.1) (Hematopoietic progenitor kinase) (MAPK/ERK kinase kinase kinase 1) (MEK kinase kinase 1) (MEKKK 1)	MAP4K1 HPK1	Homo sapiens (Human)	cell population proliferation [GO:0008283]; cellular response to phorbol 13-acetate 12-myristate [GO:1904628]; intracellular signal transduction [GO:0035556]; JNK cascade [GO:0007254]; peptidyl-serine phosphorylation [GO:0018105]; positive regulation of MAPK cascade [GO:0043410]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]	cytoplasm [GO:0005737]; membrane [GO:0016020]	ATP binding [GO:0005524]; MAP kinase kinase kinase kinase activity [GO:0008349]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	NMVSTKIQDTK	0.9979	0	0	9.23269	0	0	0	0	0	0	0	0	0
Q59H18	TNI3K_HUMAN	Serine/threonine-protein kinase TNNI3K (EC 2.7.11.1) (Cardiac ankyrin repeat kinase) (Cardiac troponin I-interacting kinase) (TNNI3-interacting kinase)	TNNI3K CARK	Homo sapiens (Human)	bundle of His cell to Purkinje myocyte communication [GO:0086069]; protein phosphorylation [GO:0006468]; regulation of cardiac conduction [GO:1903779]; regulation of cardiac muscle contraction [GO:0055117]; regulation of heart rate [GO:0002027]; regulation of postsynapse organization [GO:0099175]	cytoplasm [GO:0005737]; glutamatergic synapse [GO:0098978]; nucleus [GO:0005634]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; protein C-terminus binding [GO:0008022]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; troponin I binding [GO:0031013]	LLMEEGSK	0.87555	9.23045	0	0	0	0	0	0	0	0	0	0	0
Q86TB3	ALPK2_HUMAN	Alpha-protein kinase 2 (EC 2.7.11.1) (Heart alpha-protein kinase)	ALPK2 HAK	Homo sapiens (Human)	cardiac muscle cell development [GO:0055013]; epicardium morphogenesis [GO:1905223]; establishment of cell polarity [GO:0030010]; heart morphogenesis [GO:0003007]; negative regulation of Wnt signaling pathway involved in heart development [GO:0003308]; protein phosphorylation [GO:0006468]; regulation of apoptotic process [GO:0042981]; regulation of gene expression [GO:0010468]	basolateral plasma membrane [GO:0016323]	ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	QLTNSESK	0.89589	9.23045	0	0	0	0	0	0	0	0	0	0	0
Q9P2H5	UBP35_HUMAN	Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.4.19.12) (Deubiquitinating enzyme 35) (Ubiquitin thioesterase 35) (Ubiquitin-specific-processing protease 35)	USP35 KIAA1372 USP34	Homo sapiens (Human)	protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytosol [GO:0005829]; nucleus [GO:0005634]	cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]	DLMEAISK	0.92506	9.23045	0	0	0	0	0	0	0	0	0	0	0
Q8NCM2	KCNH5_HUMAN	Potassium voltage-gated channel subfamily H member 5 (Ether-a-go-go potassium channel 2) (hEAG2) (Voltage-gated potassium channel subunit Kv10.2)	KCNH5 EAG2	Homo sapiens (Human)	potassium ion transmembrane transport [GO:0071805]; regulation of G2/M transition of mitotic cell cycle [GO:0010389]; regulation of ion transmembrane transport [GO:0034765]; regulation of membrane potential [GO:0042391]	cell surface [GO:0009986]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]	calmodulin binding [GO:0005516]; protein-containing complex binding [GO:0044877]; transmembrane transporter binding [GO:0044325]; voltage-gated potassium channel activity [GO:0005249]	NNMGAHEEK	0.94502	0	0	0	0	0	9.23033	0	0	0	0	0	0
O75475	PSIP1_HUMAN	PC4 and SFRS1-interacting protein (CLL-associated antigen KW-7) (Dense fine speckles 70 kDa protein) (DFS 70) (Lens epithelium-derived growth factor) (Transcriptional coactivator p75/p52)	PSIP1 DFS70 LEDGF PSIP2	Homo sapiens (Human)	mRNA 5'-splice site recognition [GO:0000395]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of transcription by RNA polymerase II [GO:0006357]; response to heat [GO:0009408]; response to oxidative stress [GO:0006979]	cytosol [GO:0005829]; euchromatin [GO:0000791]; heterochromatin [GO:0000792]; nuclear periphery [GO:0034399]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	chromatin binding [GO:0003682]; DNA-binding transcription factor binding [GO:0140297]; double-stranded DNA binding [GO:0003690]; RNA binding [GO:0003723]; supercoiled DNA binding [GO:0097100]; transcription coactivator activity [GO:0003713]; transcription coregulator activity [GO:0003712]	KGQEEKQPK	0.89965	9.22843	0	0	0	0	0	0	0	0	0	0	0
Q6BEB4	SP5_HUMAN	Transcription factor Sp5	SP5	Homo sapiens (Human)	bone morphogenesis [GO:0060349]; cellular response to organic cyclic compound [GO:0071407]; post-anal tail morphogenesis [GO:0036342]; regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	FMRSDHLAK	0.99637	0	9.22518	0	0	0	0	0	0	0	0	0	0
O15020	SPTN2_HUMAN	"Spectrin beta chain, non-erythrocytic 2 (Beta-III spectrin) (Spinocerebellar ataxia 5 protein)"	SPTBN2 KIAA0302 SCA5	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; actin filament capping [GO:0051693]; adult behavior [GO:0030534]; cerebellar Purkinje cell layer morphogenesis [GO:0021692]; multicellular organism growth [GO:0035264]; postsynapse organization [GO:0099173]; synapse assembly [GO:0007416]; vesicle-mediated transport [GO:0016192]	apical plasma membrane [GO:0016324]; cell junction [GO:0030054]; cell projection [GO:0042995]; cortical actin cytoskeleton [GO:0030864]; cytosol [GO:0005829]; extracellular space [GO:0005615]; glutamatergic synapse [GO:0098978]; intracellular membrane-bounded organelle [GO:0043231]; neuronal cell body [GO:0043025]; parallel fiber to Purkinje cell synapse [GO:0098688]; paranodal junction [GO:0033010]; plasma membrane [GO:0005886]; postsynaptic spectrin-associated cytoskeleton [GO:0099189]; presynapse [GO:0098793]; spectrin [GO:0008091]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; phospholipid binding [GO:0005543]; structural constituent of cytoskeleton [GO:0005200]; structural constituent of synapse [GO:0098918]	DKFREFSR	0.4106	9.21907	0	0	0	0	0	0	0	0	0	0	0
Q96DU9	PABP5_HUMAN	Polyadenylate-binding protein 5 (PABP-5) (Poly(A)-binding protein 5)	PABPC5 PABP5	Homo sapiens (Human)		cytoplasmic stress granule [GO:0010494]; cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]	mRNA 3'-UTR binding [GO:0003730]; poly(A) binding [GO:0008143]; poly(U) RNA binding [GO:0008266]; RNA binding [GO:0003723]	LNNRQVYVGRFK	0.93306	0	0	0	0	0	0	0	0	0	0	9.21529	0
Q9H1A4	APC1_HUMAN	Anaphase-promoting complex subunit 1 (APC1) (Cyclosome subunit 1) (Mitotic checkpoint regulator) (Testis-specific gene 24 protein)	ANAPC1 TSG24	Homo sapiens (Human)	anaphase-promoting complex-dependent catabolic process [GO:0031145]; cell division [GO:0051301]; metaphase/anaphase transition of mitotic cell cycle [GO:0007091]; protein K11-linked ubiquitination [GO:0070979]; regulation of meiotic cell cycle [GO:0051445]; regulation of mitotic cell cycle [GO:0007346]	anaphase-promoting complex [GO:0005680]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]	molecular adaptor activity [GO:0060090]	LAPLLLGNPQPMVM	0.8645	0	0	0	0	0	0	0	0	0	0	9.21529	0
Q9NSB8	HOME2_HUMAN	Homer protein homolog 2 (Homer-2) (Cupidin)	HOMER2	Homo sapiens (Human)	behavioral response to cocaine [GO:0048148]; calcium-mediated signaling using intracellular calcium source [GO:0035584]; chemical homeostasis within a tissue [GO:0048875]; G protein-coupled glutamate receptor signaling pathway [GO:0007216]; negative regulation of calcineurin-NFAT signaling cascade [GO:0070885]; negative regulation of interleukin-2 production [GO:0032703]; regulation of G protein-coupled receptor signaling pathway [GO:0008277]; regulation of store-operated calcium entry [GO:2001256]; sensory perception of sound [GO:0007605]	anchoring junction [GO:0070161]; apical part of cell [GO:0045177]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; glutamatergic synapse [GO:0098978]; intracellular organelle [GO:0043229]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; stereocilium tip [GO:0032426]	actin binding [GO:0003779]; G protein-coupled glutamate receptor binding [GO:0035256]; synaptic receptor adaptor activity [GO:0030160]	TDIEESKYRQR	0.82826	0	0	0	0	0	0	0	9.21463	0	0	0	0
O95159	ZFPL1_HUMAN	Zinc finger protein-like 1 (Zinc finger protein MCG4)	ZFPL1	Homo sapiens (Human)	regulation of DNA-templated transcription [GO:0006355]; vesicle-mediated transport [GO:0016192]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; nucleus [GO:0005634]	DNA binding [GO:0003677]; zinc ion binding [GO:0008270]	LVCYDLFHWACLNER	0.89247	0	0	9.21391	0	0	0	0	0	0	0	0	0
P49902	5NTC_HUMAN	Cytosolic purine 5'-nucleotidase (EC 3.1.3.5) (EC 3.1.3.99) (Cytosolic 5'-nucleotidase II) (cN-II) (Cytosolic IMP/GMP-specific 5'-nucleotidase) (Cytosolic nucleoside phosphotransferase 5'N) (EC 2.7.1.77) (High Km 5'-nucleotidase)	NT5C2 NT5B NT5CP PNT5	Homo sapiens (Human)	adenosine metabolic process [GO:0046085]; allantoin metabolic process [GO:0000255]; dGMP metabolic process [GO:0046054]; GMP metabolic process [GO:0046037]; IMP catabolic process [GO:0006204]; IMP metabolic process [GO:0046040]; nucleotide phosphorylation [GO:0046939]	cytosol [GO:0005829]	5'-nucleotidase activity [GO:0008253]; ATP binding [GO:0005524]; GMP 5'-nucleotidase activity [GO:0050484]; identical protein binding [GO:0042802]; IMP 5'-nucleotidase activity [GO:0050483]; metal ion binding [GO:0046872]; nucleoside phosphotransferase activity [GO:0050146]; XMP 5'-nucleosidase activity [GO:0106411]	SMFQDVRDAVDWVHYK	0.87522	0	0	9.21391	0	0	0	0	0	0	0	0	0
P52888	THOP1_HUMAN	Thimet oligopeptidase (EC 3.4.24.15) (Endopeptidase 24.15) (MP78)	THOP1	Homo sapiens (Human)	peptide metabolic process [GO:0006518]; protein polyubiquitination [GO:0000209]; proteolysis [GO:0006508]	cytosol [GO:0005829]; mitochondrial intermembrane space [GO:0005758]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	NGLHLPR	0.93846	9.21364	0	0	0	0	0	0	0	0	0	0	0
Q86UV5	UBP48_HUMAN	Ubiquitin carboxyl-terminal hydrolase 48 (EC 3.4.19.12) (Deubiquitinating enzyme 48) (Ubiquitin thioesterase 48) (Ubiquitin-specific peptidase 48) (Ubiquitin-specific protease 48) (Ubiquitin-specific-processing protease 48)	USP48 USP31	Homo sapiens (Human)	protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytosol [GO:0005829]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]	APEFPSYK	0.97103	0	0	0	0	9.21279	0	0	0	0	0	0	0
Q9UKY7	CDV3_HUMAN	Protein CDV3 homolog	CDV3 H41	Homo sapiens (Human)		cytoplasm [GO:0005737]; cytosol [GO:0005829]; plasma membrane [GO:0005886]		EVDYSGLR	0.92061	0	0	0	0	9.21279	0	0	0	0	0	0	0
Q15646	OASL_HUMAN	2'-5'-oligoadenylate synthase-like protein (2'-5'-OAS-related protein) (2'-5'-OAS-RP) (59 kDa 2'-5'-oligoadenylate synthase-like protein) (Thyroid receptor-interacting protein 14) (TR-interacting protein 14) (TRIP-14) (p59 OASL) (p59OASL)	OASL TRIP14	Homo sapiens (Human)	defense response to virus [GO:0051607]; innate immune response [GO:0045087]; interleukin-27-mediated signaling pathway [GO:0070106]; negative regulation of viral genome replication [GO:0045071]; positive regulation of RIG-I signaling pathway [GO:1900246]; regulation of ribonuclease activity [GO:0060700]; response to virus [GO:0009615]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	DNA binding [GO:0003677]; double-stranded RNA binding [GO:0003725]; nuclear thyroid hormone receptor binding [GO:0046966]; nucleotidyltransferase activity [GO:0016779]; RNA binding [GO:0003723]	RARDIHLTVEQR	0.94277	0	0	0	0	0	0	0	9.21021	0	0	0	0
Q6UWM9	UD2A3_HUMAN	UDP-glucuronosyltransferase 2A3 (UDPGT 2A3) (EC 2.4.1.17)	UGT2A3 UNQ2559/PRO6239	Homo sapiens (Human)	cellular glucuronidation [GO:0052695]	integral component of membrane [GO:0016021]	glucuronosyltransferase activity [GO:0015020]	TVITDSSYKENAMRLSR	0.80905	0	0	0	0	0	0	9.20755	0	0	0	0	0
Q6ZMV5	P4R3C_HUMAN	Protein PPP4R3C (SMEK homolog 3) (Serine/threonine-protein phosphatase 4 regulatory subunit 3C)	PPP4R3C PPP4R3CP SMEK3P	Homo sapiens (Human)	cellular response to DNA damage stimulus [GO:0006974]; protein dephosphorylation [GO:0006470]	nucleoplasm [GO:0005654]; protein phosphatase 4 complex [GO:0030289]	protein phosphatase activator activity [GO:0072542]	SDSDGSVILR	0.94169	0	0	9.20621	0	0	0	0	0	0	0	0	0
O43526	KCNQ2_HUMAN	Potassium voltage-gated channel subfamily KQT member 2 (KQT-like 2) (Neuroblastoma-specific potassium channel subunit alpha KvLQT2) (Voltage-gated potassium channel subunit Kv7.2)	KCNQ2	Homo sapiens (Human)	chemical synaptic transmission [GO:0007268]; nervous system development [GO:0007399]; potassium ion transmembrane transport [GO:0071805]; regulation of ion transmembrane transport [GO:0034765]	axon initial segment [GO:0043194]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; node of Ranvier [GO:0033268]; plasma membrane [GO:0005886]; synapse [GO:0045202]; voltage-gated potassium channel complex [GO:0008076]	ankyrin binding [GO:0030506]; calmodulin binding [GO:0005516]; delayed rectifier potassium channel activity [GO:0005251]; voltage-gated potassium channel activity [GO:0005249]	EHVDRHGCIVK	1	0	9.20491	0	0	0	0	0	0	0	0	0	0
Q92570	NR4A3_HUMAN	Nuclear receptor subfamily 4 group A member 3 (Mitogen-induced nuclear orphan receptor) (Neuron-derived orphan receptor 1) (Nuclear hormone receptor NOR-1)	NR4A3 CHN CSMF MINOR NOR1 TEC	Homo sapiens (Human)	animal organ regeneration [GO:0031100]; cellular respiration [GO:0045333]; cellular response to catecholamine stimulus [GO:0071870]; cellular response to corticotropin-releasing hormone stimulus [GO:0071376]; cellular response to leptin stimulus [GO:0044320]; common myeloid progenitor cell proliferation [GO:0035726]; energy homeostasis [GO:0097009]; fat cell differentiation [GO:0045444]; gastrulation [GO:0007369]; mast cell degranulation [GO:0043303]; negative regulation of hydrogen peroxide-induced neuron death [GO:1903208]; negative regulation of transcription by RNA polymerase II [GO:0000122]; platelet-derived growth factor receptor signaling pathway [GO:0048008]; positive regulation of cardiac muscle hypertrophy [GO:0010613]; positive regulation of epithelial cell proliferation [GO:0050679]; positive regulation of fatty acid oxidation [GO:0046321]; positive regulation of feeding behavior [GO:2000253]; positive regulation of glucose transmembrane transport [GO:0010828]; positive regulation of mast cell activation by Fc-epsilon receptor signaling pathway [GO:0038097]; positive regulation of mast cell cytokine production [GO:0032765]; positive regulation of monocyte aggregation [GO:1900625]; positive regulation of smooth muscle cell proliferation [GO:0048661]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of vascular associated smooth muscle cell migration [GO:1904754]; positive regulation of vascular associated smooth muscle cell proliferation [GO:1904707]; pyruvate oxidation [GO:0009444]; regulation of smooth muscle cell proliferation [GO:0048660]; regulation of transcription by RNA polymerase II [GO:0006357]; regulation of type B pancreatic cell proliferation [GO:0061469]	chromatin [GO:0000785]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	"cAMP response element binding [GO:0035497]; DNA binding [GO:0003677]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; nuclear glucocorticoid receptor binding [GO:0035259]; nuclear receptor activity [GO:0004879]; nuclear steroid receptor activity [GO:0003707]; protein homodimerization activity [GO:0042803]; protein kinase binding [GO:0019901]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; zinc ion binding [GO:0008270]"	FQKCLSVGMVK	0.99834	0	0	0	0	0	0	0	0	0	0	0	9.20342
A0A5B6	TVB28_HUMAN	T cell receptor beta variable 28	TRBV28 TCRBV3S1	Homo sapiens (Human)	adaptive immune response [GO:0002250]; cell surface receptor signaling pathway [GO:0007166]	plasma membrane [GO:0005886]; T cell receptor complex [GO:0042101]	peptide antigen binding [GO:0042605]	EKGDIPEGYSVSREK	0.95981	0	0	0	0	0	0	0	0	0	0	9.20261	0
P10244	MYBB_HUMAN	Myb-related protein B (B-Myb) (Myb-like protein 2)	MYBL2 BMYB	Homo sapiens (Human)	cellular response to leukemia inhibitory factor [GO:1990830]; mitotic cell cycle [GO:0000278]; mitotic spindle assembly [GO:0090307]; positive regulation of neuron apoptotic process [GO:0043525]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of DNA-templated transcription [GO:0006355]	Myb complex [GO:0031523]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific double-stranded DNA binding [GO:1990837]"	QWTLIAKHLK	0.99621	0	0	0	0	0	0	0	0	9.20107	0	0	0
Q99436	PSB7_HUMAN	Proteasome subunit beta type-7 (EC 3.4.25.1) (Macropain chain Z) (Multicatalytic endopeptidase complex chain Z) (Proteasome subunit Z)	PSMB7 Z	Homo sapiens (Human)	proteasomal protein catabolic process [GO:0010498]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]	"cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular region [GO:0005576]; ficolin-1-rich granule lumen [GO:1904813]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; proteasome complex [GO:0000502]; proteasome core complex [GO:0005839]; proteasome core complex, beta-subunit complex [GO:0019774]; secretory granule lumen [GO:0034774]"	endopeptidase activity [GO:0004175]; threonine-type endopeptidase activity [GO:0004298]	GYKLPKVR	0.94323	0	9.19982	0	0	0	0	0	0	0	0	0	0
O15050	TRNK1_HUMAN	TPR and ankyrin repeat-containing protein 1 (Lupus brain antigen 1 homolog)	TRANK1 KIAA0342 LBA1	Homo sapiens (Human)				CPNFKEDRSEIYSLFSLYQQIR	0.86704	0	9.19837	0	0	0	0	0	0	0	0	0	0
Q96PH6	DB118_HUMAN	Defensin beta 118 (Beta-defensin 18) (DEFB-18) (Epididymal secretory protein 13.6) (ESP13.6)	DEFB118 C20orf63 DEFB18 ESC42	Homo sapiens (Human)	antimicrobial humoral immune response mediated by antimicrobial peptide [GO:0061844]; cell-matrix adhesion [GO:0007160]; defense response to bacterium [GO:0042742]; defense response to Gram-negative bacterium [GO:0050829]; defense response to Gram-positive bacterium [GO:0050830]; innate immune response [GO:0045087]; killing of cells of another organism [GO:0031640]; membrane disruption in another organism [GO:0051673]; negative regulation of cell adhesion [GO:0007162]; negative regulation of lipopolysaccharide-mediated signaling pathway [GO:0031665]; spermatogenesis [GO:0007283]	extracellular region [GO:0005576]	lipopolysaccharide binding [GO:0001530]	ACCIPSNEDHRR	0.99834	0	0	0	0	0	0	0	9.19552	0	0	0	0
Q68DN1	CB016_HUMAN	Uncharacterized protein C2orf16	C2orf16	Homo sapiens (Human)		extracellular exosome [GO:0070062]; nucleus [GO:0005634]		RQPKKPSQPK	0.95692	0	0	0	0	0	0	0	9.19466	0	0	0	0
P42575	CASP2_HUMAN	Caspase-2 (CASP-2) (EC 3.4.22.55) (Neural precursor cell expressed developmentally down-regulated protein 2) (NEDD-2) (Protease ICH-1) [Cleaved into: Caspase-2 subunit p18; Caspase-2 subunit p13; Caspase-2 subunit p12]	CASP2 ICH1 NEDD2	Homo sapiens (Human)	"activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; aging [GO:0007568]; apoptotic process [GO:0006915]; apoptotic signaling pathway [GO:0097190]; brain development [GO:0007420]; cellular response to DNA damage stimulus [GO:0006974]; cellular response to mechanical stimulus [GO:0071260]; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest [GO:0006977]; ectopic germ cell programmed cell death [GO:0035234]; execution phase of apoptosis [GO:0097194]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; luteolysis [GO:0001554]; negative regulation of apoptotic process [GO:0043066]; negative regulation of necroptotic process [GO:0060546]; neural retina development [GO:0003407]; positive regulation of apoptotic process [GO:0043065]; positive regulation of apoptotic signaling pathway [GO:2001235]; positive regulation of neuron apoptotic process [GO:0043525]; protein processing [GO:0016485]; release of cytochrome c from mitochondria [GO:0001836]"	caspase complex [GO:0008303]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endopeptidase complex [GO:1905369]; membrane [GO:0016020]; mitochondrion [GO:0005739]; nucleolus [GO:0005730]; nucleus [GO:0005634]	cysteine-type endopeptidase activity [GO:0004197]; cysteine-type endopeptidase activity involved in apoptotic process [GO:0097153]; cysteine-type endopeptidase activity involved in apoptotic signaling pathway [GO:0097199]; cysteine-type endopeptidase activity involved in execution phase of apoptosis [GO:0097200]; enzyme binding [GO:0019899]; identical protein binding [GO:0042802]; protein domain specific binding [GO:0019904]	GVDQQDGKNHAGSPGCEESDAGKEK	0.86895	0	0	0	9.1933	0	0	0	0	0	0	0	0
Q9H7B2	RPF2_HUMAN	Ribosome production factor 2 homolog (Brix domain-containing protein 1) (Ribosome biogenesis protein RPF2 homolog)	RPF2 BXDC1	Homo sapiens (Human)	"maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000463]; protein localization to nucleolus [GO:1902570]; regulation of signal transduction by p53 class mediator [GO:1901796]; ribosomal large subunit assembly [GO:0000027]; ribosomal large subunit biogenesis [GO:0042273]"	chromosome [GO:0005694]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]	5S rRNA binding [GO:0008097]; RNA binding [GO:0003723]; rRNA binding [GO:0019843]	NSKCPEGTKPMLIFAGDDFDVTEDYR	0.87413	0	9.19271	0	0	0	0	0	0	0	0	0	0
Q9H9B1	EHMT1_HUMAN	Histone-lysine N-methyltransferase EHMT1 (EC 2.1.1.-) (EC 2.1.1.367) (Euchromatic histone-lysine N-methyltransferase 1) (Eu-HMTase1) (G9a-like protein 1) (GLP) (GLP1) (Histone H3-K9 methyltransferase 5) (H3-K9-HMTase 5) (Lysine N-methyltransferase 1D)	EHMT1 EUHMTASE1 GLP KIAA1876 KMT1D	Homo sapiens (Human)	chromatin organization [GO:0006325]; DNA methylation [GO:0006306]; histone H3-K9 methylation [GO:0051567]; histone methylation [GO:0016571]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]; peptidyl-lysine dimethylation [GO:0018027]; peptidyl-lysine monomethylation [GO:0018026]; positive regulation of cold-induced thermogenesis [GO:0120162]; regulation of embryonic development [GO:0045995]; regulation of histone H3-K9 methylation [GO:0051570]	chromatin [GO:0000785]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	C2H2 zinc finger domain binding [GO:0070742]; histone methyltransferase activity (H3-K27 specific) [GO:0046976]; histone methyltransferase activity (H3-K9 specific) [GO:0046974]; histone-lysine N-methyltransferase activity [GO:0018024]; methyltransferase activity [GO:0008168]; p53 binding [GO:0002039]; protein-lysine N-methyltransferase activity [GO:0016279]; transcription corepressor binding [GO:0001222]; zinc ion binding [GO:0008270]	KLPAPGADVK	0.99807	0	0	0	0	0	0	0	9.19261	0	0	0	0
Q96DT5	DYH11_HUMAN	Dynein axonemal heavy chain 11 (Axonemal beta dynein heavy chain 11) (Ciliary dynein heavy chain 11)	DNAH11	Homo sapiens (Human)	cardiac septum morphogenesis [GO:0060411]; cilium movement [GO:0003341]; determination of left/right asymmetry in nervous system [GO:0035545]; determination of left/right symmetry [GO:0007368]; epithelial cilium movement involved in determination of left/right asymmetry [GO:0060287]; flagellated sperm motility [GO:0030317]; learning or memory [GO:0007611]; microtubule-based movement [GO:0007018]; protein localization to motile cilium [GO:0120229]; regulation of cilium beat frequency [GO:0003356]	9+0 motile cilium [GO:0097728]; 9+2 motile cilium [GO:0097729]; axoneme [GO:0005930]; dynein complex [GO:0030286]; extracellular region [GO:0005576]; microtubule [GO:0005874]; motile cilium [GO:0031514]; proximal portion of axoneme [GO:0120134]	ATP binding [GO:0005524]; dynein intermediate chain binding [GO:0045505]; dynein light intermediate chain binding [GO:0051959]; minus-end-directed microtubule motor activity [GO:0008569]	AGHNYGPGGNKK	0.99851	0	0	0	9.1848	0	0	0	0	0	0	0	0
P25103	NK1R_HUMAN	Substance-P receptor (SPR) (NK-1 receptor) (NK-1R) (Tachykinin receptor 1)	TACR1 NK1R TAC1R	Homo sapiens (Human)	"acute inflammatory response [GO:0002526]; aggressive behavior [GO:0002118]; angiotensin-mediated drinking behavior [GO:0003051]; associative learning [GO:0008306]; behavioral response to pain [GO:0048266]; detection of abiotic stimulus [GO:0009582]; eating behavior [GO:0042755]; inflammatory response [GO:0006954]; long-term memory [GO:0007616]; operant conditioning [GO:0035106]; phospholipase C-activating G protein-coupled receptor signaling pathway [GO:0007200]; positive regulation of action potential [GO:0045760]; positive regulation of blood pressure [GO:0045777]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of epithelial cell migration [GO:0010634]; positive regulation of epithelial cell proliferation [GO:0050679]; positive regulation of flagellated sperm motility [GO:1902093]; positive regulation of hormone secretion [GO:0046887]; positive regulation of leukocyte migration [GO:0002687]; positive regulation of lymphocyte proliferation [GO:0050671]; positive regulation of ossification [GO:0045778]; positive regulation of renal sodium excretion [GO:0035815]; positive regulation of saliva secretion [GO:0046878]; positive regulation of stress fiber assembly [GO:0051496]; positive regulation of synaptic transmission, cholinergic [GO:0032224]; positive regulation of synaptic transmission, GABAergic [GO:0032230]; positive regulation of uterine smooth muscle contraction [GO:0070474]; positive regulation of vascular permeability [GO:0043117]; positive regulation of vasoconstriction [GO:0045907]; regulation of smooth muscle cell migration [GO:0014910]; regulation of smooth muscle cell proliferation [GO:0048660]; response to auditory stimulus [GO:0010996]; response to electrical stimulus [GO:0051602]; response to estradiol [GO:0032355]; response to ethanol [GO:0045471]; response to heat [GO:0009408]; response to morphine [GO:0043278]; response to nicotine [GO:0035094]; response to ozone [GO:0010193]; response to progesterone [GO:0032570]; sensory perception of pain [GO:0019233]; smooth muscle contraction involved in micturition [GO:0060083]; sperm ejaculation [GO:0042713]; tachykinin receptor signaling pathway [GO:0007217]"	cell body [GO:0044297]; cell surface [GO:0009986]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; sperm flagellum [GO:0036126]; sperm head [GO:0061827]; sperm midpiece [GO:0097225]	substance P receptor activity [GO:0016496]; tachykinin receptor activity [GO:0004995]	TMTESFSFSSNVLS	0.95756	0	0	9.18066	0	0	0	0	0	0	0	0	0
Q8N2E2	VWDE_HUMAN	von Willebrand factor D and EGF domain-containing protein	VWDE	Homo sapiens (Human)	anatomical structure development [GO:0048856]	cell surface [GO:0009986]; extracellular region [GO:0005576]	signaling receptor binding [GO:0005102]	YTQGRGSHSQEMR	0.99978	0	0	9.18066	0	0	0	0	0	0	0	0	0
O14639	ABLM1_HUMAN	Actin-binding LIM protein 1 (abLIM-1) (Actin-binding LIM protein family member 1) (Actin-binding double zinc finger protein) (LIMAB1) (Limatin)	ABLIM1 ABLIM KIAA0059 LIMAB1	Homo sapiens (Human)	animal organ morphogenesis [GO:0009887]; cilium assembly [GO:0060271]; cytoskeleton organization [GO:0007010]; lamellipodium assembly [GO:0030032]; visual perception [GO:0007601]	actin cytoskeleton [GO:0015629]; cytoplasm [GO:0005737]; lamellipodium [GO:0030027]; stress fiber [GO:0001725]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; metal ion binding [GO:0046872]	LCSSEKSK	0.99753	0	0	0	0	0	9.17854	0	0	0	0	0	0
Q32MZ4	LRRF1_HUMAN	Leucine-rich repeat flightless-interacting protein 1 (LRR FLII-interacting protein 1) (GC-binding factor 2) (TAR RNA-interacting protein)	LRRFIP1 GCF2 TRIP	Homo sapiens (Human)	negative regulation of transcription by RNA polymerase II [GO:0000122]; regulation of transcription by RNA polymerase II [GO:0006357]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	"cadherin binding [GO:0045296]; DNA binding [GO:0003677]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; double-stranded RNA binding [GO:0003725]; protein homodimerization activity [GO:0042803]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	QYEEKNK	0.9974	0	0	0	0	0	9.17854	0	0	0	0	0	0
O14581	OR7AH_HUMAN	Olfactory receptor 7A17	OR7A17	Homo sapiens (Human)	signal transduction [GO:0007165]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; olfactory receptor activity [GO:0004984]	FVAICHPLHYTVIMNPR	0.82766	0	0	0	0	9.17415	0	0	0	0	0	0	0
Q8TE76	MORC4_HUMAN	MORC family CW-type zinc finger protein 4 (Zinc finger CW-type coiled-coil domain protein 2) (Zinc finger CW-type domain protein 4)	MORC4 ZCW4 ZCWCC2	Homo sapiens (Human)		nucleoplasm [GO:0005654]; nucleus [GO:0005634]	ATP hydrolysis activity [GO:0016887]; methylated histone binding [GO:0035064]; zinc ion binding [GO:0008270]	VPDQTWVQCDECLKWRK	0.94524	9.174	0	0	0	0	0	0	0	0	0	0	0
Q7Z3E2	CC186_HUMAN	Coiled-coil domain-containing protein 186 (CTCL tumor antigen HD-CL-01/L14-2)	CCDC186 C10orf118	Homo sapiens (Human)	insulin secretion involved in cellular response to glucose stimulus [GO:0035773]; response to bacterium [GO:0009617]; vesicle cytoskeletal trafficking [GO:0099518]	trans-Golgi network [GO:0005802]	small GTPase binding [GO:0031267]	TYSESPYDTDCTK	0.82441	9.17288	0	0	0	0	0	0	0	0	0	0	0
Q8NB14	UBP38_HUMAN	Ubiquitin carboxyl-terminal hydrolase 38 (EC 3.4.19.12) (Deubiquitinating enzyme 38) (HP43.8KD) (Ubiquitin thioesterase 38) (Ubiquitin-specific-processing protease 38)	USP38 KIAA1891	Homo sapiens (Human)	protein deubiquitination [GO:0016579]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytosol [GO:0005829]; nucleus [GO:0005634]	cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]	DASMTQALCR	0.94282	0	0	0	0	0	0	0	0	0	0	9.17228	0
Q96S55	WRIP1_HUMAN	ATPase WRNIP1 (EC 3.6.1.-) (Werner helicase-interacting protein 1)	WRNIP1 WHIP	Homo sapiens (Human)	DNA synthesis involved in DNA repair [GO:0000731]; DNA-templated DNA replication [GO:0006261]; innate immune response [GO:0045087]; regulation of DNA repair [GO:0006282]; regulation of DNA-templated DNA replication initiation [GO:0030174]	membrane [GO:0016020]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; DNA binding [GO:0003677]; enzyme activator activity [GO:0008047]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; single-stranded DNA helicase activity [GO:0017116]	GPSPPGAKRR	0.87587	0	0	0	0	0	0	0	0	9.16734	0	0	0
Q96JB1	DYH8_HUMAN	Dynein axonemal heavy chain 8 (Axonemal beta dynein heavy chain 8) (Ciliary dynein heavy chain 8)	DNAH8	Homo sapiens (Human)	cilium-dependent cell motility [GO:0060285]; microtubule-based movement [GO:0007018]; outer dynein arm assembly [GO:0036158]	axonemal dynein complex [GO:0005858]; axoneme [GO:0005930]; dynein complex [GO:0030286]; microtubule [GO:0005874]; outer dynein arm [GO:0036157]; sperm flagellum [GO:0036126]	ATP binding [GO:0005524]; dynein intermediate chain binding [GO:0045505]; dynein light intermediate chain binding [GO:0051959]; microtubule motor activity [GO:0003777]; minus-end-directed microtubule motor activity [GO:0008569]	FETLITIHVHQR	0.57613	0	0	0	9.16669	0	0	0	0	0	0	0	0
Q96Q05	TPPC9_HUMAN	Trafficking protein particle complex subunit 9 (NIK- and IKBKB-binding protein) (Tularik gene 1 protein)	TRAPPC9 KIAA1882 NIBP T1	Homo sapiens (Human)	cerebral cortex development [GO:0021987]; endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; neuron differentiation [GO:0030182]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; vesicle coating [GO:0006901]; vesicle tethering [GO:0099022]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; trans-Golgi network [GO:0005802]; TRAPP complex [GO:0030008]; TRAPPII protein complex [GO:1990071]		VLYIRYR	0.86332	0	9.1638	0	0	0	0	0	0	0	0	0	0
Q13571	LAPM5_HUMAN	Lysosomal-associated transmembrane protein 5 (Lysosomal-associated multitransmembrane protein 5) (Retinoic acid-inducible E3 protein)	LAPTM5 KIAA0085	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; defense response to tumor cell [GO:0002357]; Golgi to lysosome transport [GO:0090160]; induction of programmed cell death [GO:0012502]; intracellular protein transport [GO:0006886]; negative regulation of autophagic cell death [GO:1904093]; negative regulation of B cell activation [GO:0050869]; negative regulation of interferon-gamma production [GO:0032689]; negative regulation of interleukin-2 production [GO:0032703]; negative regulation of T cell activation [GO:0050868]; negative regulation of T cell receptor signaling pathway [GO:0050860]; positive regulation of cytokine production involved in immune response [GO:0002720]; positive regulation of interleukin-12 production [GO:0032735]; positive regulation of lysosomal membrane permeability [GO:0097214]; positive regulation of macrophage cytokine production [GO:0060907]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of protein ubiquitination [GO:0031398]; positive regulation of receptor catabolic process [GO:2000646]; positive regulation of tumor necrosis factor-mediated signaling pathway [GO:1903265]; positive regulation of ubiquitin-dependent protein catabolic process [GO:2000060]; protein targeting to lysosome [GO:0006622]	cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; integral component of plasma membrane [GO:0005887]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; perinuclear region of cytoplasm [GO:0048471]; protein-containing complex [GO:0032991]; transport vesicle [GO:0030133]	protein sequestering activity [GO:0140311]; ubiquitin protein ligase binding [GO:0031625]; ubiquitin-dependent protein binding [GO:0140036]	CMNSVEEKR	0.99836	0	0	0	9.1553	0	0	0	0	0	0	0	0
Q7RTR2	NLRC3_HUMAN	"NLR family CARD domain-containing protein 3 (CARD15-like protein) (Caterpiller protein 16.2) (CLR16.2) (NACHT, LRR and CARD domains-containing protein 3) (Nucleotide-binding oligomerization domain protein 3)"	NLRC3 NOD3	Homo sapiens (Human)	I-kappaB kinase/NF-kappaB signaling [GO:0007249]; intracellular signal transduction [GO:0035556]; negative regulation of cytokine production involved in inflammatory response [GO:1900016]; negative regulation of epithelial cell proliferation [GO:0050680]; negative regulation of fibroblast proliferation [GO:0048147]; negative regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043124]; negative regulation of inflammatory response [GO:0050728]; negative regulation of innate immune response [GO:0045824]; negative regulation of interferon-alpha production [GO:0032687]; negative regulation of interferon-beta production [GO:0032688]; negative regulation of interleukin-6 production [GO:0032715]; negative regulation of NF-kappaB transcription factor activity [GO:0032088]; negative regulation of NIK/NF-kappaB signaling [GO:1901223]; negative regulation of NLRP3 inflammasome complex assembly [GO:1900226]; negative regulation of phosphatidylinositol 3-kinase signaling [GO:0014067]; negative regulation of tumor necrosis factor production [GO:0032720]; T cell activation [GO:0042110]	centriolar satellite [GO:0034451]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; perinuclear region of cytoplasm [GO:0048471]	ATP binding [GO:0005524]; phosphatidylinositol 3-kinase regulatory subunit binding [GO:0036312]	GGGHPAR	0.90035	0	0	0	0	0	0	0	0	9.15502	0	0	0
P54296	MYOM2_HUMAN	Myomesin-2 (165 kDa connectin-associated protein) (165 kDa titin-associated protein) (M-protein) (Myomesin family member 2)	MYOM2	Homo sapiens (Human)	muscle contraction [GO:0006936]; sarcomere organization [GO:0045214]	M band [GO:0031430]; mitochondrion [GO:0005739]; myosin filament [GO:0032982]	actin filament binding [GO:0051015]; kinase binding [GO:0019900]; structural constituent of muscle [GO:0008307]	GVTSEDSGKYSINIK	0.93998	0	0	0	9.15244	0	0	0	0	0	0	0	0
Q9NXD2	MTMRA_HUMAN	Myotubularin-related protein 10 (Inactive phosphatidylinositol 3-phosphatase 10)	MTMR10	Homo sapiens (Human)	phosphatidylinositol dephosphorylation [GO:0046856]	cytoplasm [GO:0005737]; cytosol [GO:0005829]	phosphatidylinositol-3-phosphatase activity [GO:0004438]	INGIPSGDGGGGGGGGNGAGGGSSQK	0.87365	0	0	0	9.15244	0	0	0	0	0	0	0	0
Q8NAA6	CO053_HUMAN	Putative uncharacterized protein encoded by LINC02694	LINC02694 C15orf53	Homo sapiens (Human)				SPFGAGK	0.81454	0	9.15196	0	0	0	0	0	0	0	0	0	0
Q96CN5	LRC45_HUMAN	Leucine-rich repeat-containing protein 45	LRRC45	Homo sapiens (Human)		centrosome [GO:0005813]; cytosol [GO:0005829]; growth cone [GO:0030426]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]		EVEHMTR	0.99201	9.15089	0	0	0	0	0	0	0	0	0	0	0
P08684	CP3A4_HUMAN	"Cytochrome P450 3A4 (EC 1.14.14.1) (1,4-cineole 2-exo-monooxygenase) (1,8-cineole 2-exo-monooxygenase) (EC 1.14.14.56) (Albendazole monooxygenase (sulfoxide-forming)) (EC 1.14.14.73) (Albendazole sulfoxidase) (CYPIIIA3) (CYPIIIA4) (Cholesterol 25-hydroxylase) (Cytochrome P450 3A3) (Cytochrome P450 HLp) (Cytochrome P450 NF-25) (Cytochrome P450-PCN1) (Nifedipine oxidase) (Quinine 3-monooxygenase) (EC 1.14.14.55)"	CYP3A4 CYP3A3	Homo sapiens (Human)	aflatoxin metabolic process [GO:0046222]; alkaloid catabolic process [GO:0009822]; androgen metabolic process [GO:0008209]; cholesterol metabolic process [GO:0008203]; estrogen metabolic process [GO:0008210]; heterocycle metabolic process [GO:0046483]; lipid hydroxylation [GO:0002933]; lipid metabolic process [GO:0006629]; long-chain fatty acid biosynthetic process [GO:0042759]; monoterpenoid metabolic process [GO:0016098]; oxidative demethylation [GO:0070989]; retinoic acid metabolic process [GO:0042573]; retinol metabolic process [GO:0042572]; steroid catabolic process [GO:0006706]; steroid metabolic process [GO:0008202]; vitamin D catabolic process [GO:0042369]; vitamin D metabolic process [GO:0042359]; xenobiotic catabolic process [GO:0042178]; xenobiotic metabolic process [GO:0006805]	cytoplasm [GO:0005737]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]	"1,8-cineole 2-exo-monooxygenase activity [GO:0102320]; 1-alpha,25-dihydroxyvitamin D3 23-hydroxylase activity [GO:0062181]; anandamide 11,12 epoxidase activity [GO:0062188]; anandamide 14,15 epoxidase activity [GO:0062189]; anandamide 8,9 epoxidase activity [GO:0062187]; aromatase activity [GO:0070330]; caffeine oxidase activity [GO:0034875]; enzyme binding [GO:0019899]; estrogen 16-alpha-hydroxylase activity [GO:0101020]; estrogen 2-hydroxylase activity [GO:0101021]; heme binding [GO:0020037]; iron ion binding [GO:0005506]; monooxygenase activity [GO:0004497]; oxidoreductase activity [GO:0016491]; oxygen binding [GO:0019825]; quinine 3-monooxygenase activity [GO:0050591]; retinoic acid 4-hydroxylase activity [GO:0008401]; steroid binding [GO:0005496]; steroid hydroxylase activity [GO:0008395]; testosterone 6-beta-hydroxylase activity [GO:0050649]; vitamin D 24-hydroxylase activity [GO:0070576]; vitamin D3 25-hydroxylase activity [GO:0030343]"	DPKYWTEPEKFLPER	0.91922	0	0	0	9.13296	0	0	0	0	0	0	0	0
Q9H2K2	TNKS2_HUMAN	Poly [ADP-ribose] polymerase tankyrase-2 (EC 2.4.2.30) (ADP-ribosyltransferase diphtheria toxin-like 6) (ARTD6) (Poly [ADP-ribose] polymerase 5B) (Protein poly-ADP-ribosyltransferase tankyrase-2) (EC 2.4.2.-) (TNKS-2) (TRF1-interacting ankyrin-related ADP-ribose polymerase 2) (Tankyrase II) (Tankyrase-2) (TANK2) (Tankyrase-like protein) (Tankyrase-related protein)	TNKS2 PARP5B TANK2 TNKL	Homo sapiens (Human)	"multicellular organism growth [GO:0035264]; negative regulation of telomere maintenance via telomere lengthening [GO:1904357]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of telomere capping [GO:1904355]; positive regulation of telomere maintenance via telomerase [GO:0032212]; protein ADP-ribosylation [GO:0006471]; protein auto-ADP-ribosylation [GO:0070213]; protein localization to chromosome, telomeric region [GO:0070198]; protein poly-ADP-ribosylation [GO:0070212]; protein polyubiquitination [GO:0000209]; regulation of multicellular organism growth [GO:0040014]; Wnt signaling pathway [GO:0016055]"	"chromosome, telomeric region [GO:0000781]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; Golgi membrane [GO:0000139]; nuclear envelope [GO:0005635]; nucleus [GO:0005634]; pericentriolar material [GO:0000242]; perinuclear region of cytoplasm [GO:0048471]"	enzyme binding [GO:0019899]; metal ion binding [GO:0046872]; NAD+ ADP-ribosyltransferase activity [GO:0003950]; NAD+-protein ADP-ribosyltransferase activity [GO:1990404]; protein N-terminus binding [GO:0047485]	KLCTVQSVNCRDIEGR	0.94232	0	0	0	9.13296	0	0	0	0	0	0	0	0
Q9Y371	SHLB1_HUMAN	Endophilin-B1 (Bax-interacting factor 1) (Bif-1) (SH3 domain-containing GRB2-like protein B1)	SH3GLB1 KIAA0491 CGI-61	Homo sapiens (Human)	apoptotic process [GO:0006915]; autophagic cell death [GO:0048102]; autophagy [GO:0006914]; cellular response to amino acid starvation [GO:0034198]; cellular response to glucose starvation [GO:0042149]; membrane fission [GO:0090148]; membrane organization [GO:0061024]; positive regulation of autophagosome assembly [GO:2000786]; positive regulation of autophagy [GO:0010508]; positive regulation of membrane tubulation [GO:1903527]; positive regulation of protein targeting to mitochondrion [GO:1903955]; positive regulation of protein-containing complex assembly [GO:0031334]; protein localization to vacuolar membrane [GO:1903778]; receptor catabolic process [GO:0032801]; regulation of cytokinesis [GO:0032465]; regulation of macroautophagy [GO:0016241]; regulation of protein stability [GO:0031647]	autophagosome membrane [GO:0000421]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; Golgi membrane [GO:0000139]; membrane [GO:0016020]; midbody [GO:0030496]; mitochondrial outer membrane [GO:0005741]; protein-containing complex [GO:0032991]	cadherin binding [GO:0045296]; identical protein binding [GO:0042802]; lipid binding [GO:0008289]; protein homodimerization activity [GO:0042803]	ITQSEFDRQAEITR	0.99908	0	0	0	0	0	9.12897	0	0	0	0	0	0
Q16880	CGT_HUMAN	2-hydroxyacylsphingosine 1-beta-galactosyltransferase (EC 2.4.1.47) (Ceramide UDP-galactosyltransferase) (Cerebroside synthase) (UDP-galactose-ceramide galactosyltransferase)	UGT8 CGT UGT4	Homo sapiens (Human)	central nervous system development [GO:0007417]; cytoskeleton organization [GO:0007010]; galactosylceramide biosynthetic process [GO:0006682]; glycosphingolipid metabolic process [GO:0006687]; neuron projection morphogenesis [GO:0048812]; paranodal junction assembly [GO:0030913]; peripheral nervous system development [GO:0007422]; protein localization to paranode region of axon [GO:0002175]	endoplasmic reticulum [GO:0005783]; integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	"2-hydroxyacylsphingosine 1-beta-galactosyltransferase activity [GO:0003851]; N-acylsphingosine galactosyltransferase activity [GO:0047263]; UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity [GO:0008489]"	AQKLSEIHK	0.99814	9.12701	0	0	0	0	0	0	0	0	0	0	0
P36896	ACV1B_HUMAN	Activin receptor type-1B (EC 2.7.11.30) (Activin receptor type IB) (ACTR-IB) (Activin receptor-like kinase 4) (ALK-4) (Serine/threonine-protein kinase receptor R2) (SKR2)	ACVR1B ACVRLK4 ALK4	Homo sapiens (Human)	activin receptor signaling pathway [GO:0032924]; cellular response to growth factor stimulus [GO:0071363]; extrinsic apoptotic signaling pathway [GO:0097191]; G1/S transition of mitotic cell cycle [GO:0000082]; hair follicle development [GO:0001942]; in utero embryonic development [GO:0001701]; negative regulation of cell growth [GO:0030308]; negative regulation of gene expression [GO:0010629]; nervous system development [GO:0007399]; nodal signaling pathway [GO:0038092]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of activin receptor signaling pathway [GO:0032927]; positive regulation of erythrocyte differentiation [GO:0045648]; positive regulation of gene expression [GO:0010628]; positive regulation of trophoblast cell migration [GO:1901165]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; regulation of DNA-templated transcription [GO:0006355]; signal transduction [GO:0007165]; transmembrane receptor protein serine/threonine kinase signaling pathway [GO:0007178]	activin receptor complex [GO:0048179]; cell surface [GO:0009986]; cytosol [GO:0005829]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]	"activin binding [GO:0048185]; activin receptor activity, type I [GO:0016361]; ATP binding [GO:0005524]; inhibin binding [GO:0034711]; metal ion binding [GO:0046872]; protein serine/threonine kinase activity [GO:0004674]; SMAD binding [GO:0046332]; transmembrane receptor protein serine/threonine kinase activity [GO:0004675]; ubiquitin protein ligase binding [GO:0031625]"	LRPNIPNWWQSYEALR	0.89165	0	9.12629	0	0	0	0	0	0	0	0	0	0
O14813	PHX2A_HUMAN	Paired mesoderm homeobox protein 2A (ARIX1 homeodomain protein) (Aristaless homeobox protein homolog) (Paired-like homeobox 2A)	PHOX2A ARIX PMX2A	Homo sapiens (Human)	dopaminergic neuron differentiation [GO:0071542]; enteric nervous system development [GO:0048484]; locus ceruleus development [GO:0021703]; midbrain development [GO:0030901]; noradrenergic neuron differentiation [GO:0003357]; oculomotor nerve formation [GO:0021623]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of respiratory gaseous exchange [GO:0043576]; regulation of transcription by RNA polymerase II [GO:0006357]; somatic motor neuron differentiation [GO:0021523]; sympathetic nervous system development [GO:0048485]; trochlear nerve formation [GO:0021642]	chromatin [GO:0000785]; nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; sequence-specific double-stranded DNA binding [GO:1990837]"	IRTTFTSAQLK	0.99888	0	0	0	0	0	0	9.12588	0	0	0	0	0
Q8WV28	BLNK_HUMAN	B-cell linker protein (B-cell adapter containing a SH2 domain protein) (B-cell adapter containing a Src homology 2 domain protein) (Cytoplasmic adapter protein) (Src homology 2 domain-containing leukocyte protein of 65 kDa) (SLP-65)	BLNK BASH SLP65	Homo sapiens (Human)	B cell differentiation [GO:0030183]; B cell receptor signaling pathway [GO:0050853]; humoral immune response [GO:0006959]; inflammatory response [GO:0006954]; intracellular signal transduction [GO:0035556]; positive regulation of gene expression [GO:0010628]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; plasma membrane [GO:0005886]	enzyme binding [GO:0019899]; lipid binding [GO:0008289]; phospholipase binding [GO:0043274]; protein kinase binding [GO:0019901]; protein tyrosine kinase binding [GO:1990782]; SH2 domain binding [GO:0042169]; signaling adaptor activity [GO:0035591]; transmembrane receptor protein tyrosine kinase adaptor activity [GO:0005068]	KPTTPLK	0.9275	0	0	0	0	0	0	0	0	0	9.11793	0	0
O94822	LTN1_HUMAN	E3 ubiquitin-protein ligase listerin (EC 2.3.2.27) (RING finger protein 160) (RING-type E3 ubiquitin transferase listerin) (Zinc finger protein 294)	LTN1 C21orf10 C21orf98 KIAA0714 RNF160 ZNF294 HSPC087	Homo sapiens (Human)	protein autoubiquitination [GO:0051865]; rescue of stalled ribosome [GO:0072344]; ribosome-associated ubiquitin-dependent protein catabolic process [GO:1990116]	cytosol [GO:0005829]; RQC complex [GO:1990112]	ribosomal large subunit binding [GO:0043023]; ubiquitin protein ligase activity [GO:0061630]; zinc ion binding [GO:0008270]	KQLAPYLK	0.99687	0	0	0	0	0	0	0	0	0	0	0	9.11785
Q7Z6I6	RHG30_HUMAN	Rho GTPase-activating protein 30 (Rho-type GTPase-activating protein 30)	ARHGAP30	Homo sapiens (Human)	regulation of small GTPase mediated signal transduction [GO:0051056]; small GTPase mediated signal transduction [GO:0007264]	cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]	GTPase activator activity [GO:0005096]	SVPVVPPKPQFAK	0.57551	0	9.11598	0	0	0	0	0	0	0	0	0	0
Q15382	RHEB_HUMAN	GTP-binding protein Rheb (Ras homolog enriched in brain)	RHEB RHEB2	Homo sapiens (Human)	negative regulation of cold-induced thermogenesis [GO:0120163]; oligodendrocyte differentiation [GO:0048709]; positive regulation of oligodendrocyte differentiation [GO:0048714]; positive regulation of TOR signaling [GO:0032008]; regulation of cell cycle [GO:0051726]; regulation of macroautophagy [GO:0016241]; regulation of type B pancreatic cell development [GO:2000074]; signal transduction [GO:0007165]; small GTPase mediated signal transduction [GO:0007264]	cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; extracellular exosome [GO:0070062]; Golgi membrane [GO:0000139]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; plasma membrane [GO:0005886]; postsynaptic density [GO:0014069]; spliceosomal complex [GO:0005681]	GDP binding [GO:0019003]; GTP binding [GO:0005525]; GTPase activity [GO:0003924]; magnesium ion binding [GO:0000287]; protein kinase binding [GO:0019901]	VISYEEGK	0.936	0	0	0	0	0	0	0	0	9.11567	0	0	0
Q9NWQ4	GPT2L_HUMAN	G patch domain-containing protein 2-like	GPATCH2L C14orf118 KIAA1152	Homo sapiens (Human)				WAPDHCSEVER	0.93854	9.11228	0	0	0	0	0	0	0	0	0	0	0
Q9C093	SPEF2_HUMAN	Sperm flagellar protein 2 (Protein KPL2)	SPEF2 KIAA1770 KPL2	Homo sapiens (Human)	brain morphogenesis [GO:0048854]; epithelial cilium movement involved in extracellular fluid movement [GO:0003351]; respiratory system development [GO:0060541]; skeletal system morphogenesis [GO:0048705]; sperm axoneme assembly [GO:0007288]; spermatogenesis [GO:0007283]	cytoplasm [GO:0005737]; extracellular region [GO:0005576]; Golgi apparatus [GO:0005794]; manchette [GO:0002177]; sperm flagellum [GO:0036126]; sperm midpiece [GO:0097225]		IENIYAEGFIK	0.86369	0	0	0	9.11147	0	0	0	0	0	0	0	0
Q14517	FAT1_HUMAN	"Protocadherin Fat 1 (Cadherin family member 7) (Cadherin-related tumor suppressor homolog) (Protein fat homolog) [Cleaved into: Protocadherin Fat 1, nuclear form]"	FAT1 CDHF7 FAT	Homo sapiens (Human)	actin filament organization [GO:0007015]; anatomical structure morphogenesis [GO:0009653]; cell adhesion [GO:0007155]; cell migration [GO:0016477]; cell-cell adhesion [GO:0098609]; cell-cell signaling [GO:0007267]; epithelial cell morphogenesis [GO:0003382]; establishment of epithelial cell apical/basal polarity involved in camera-type eye morphogenesis [GO:0003412]; establishment or maintenance of cell polarity [GO:0007163]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; lens development in camera-type eye [GO:0002088]	apical plasma membrane [GO:0016324]; cell-cell junction [GO:0005911]; extracellular exosome [GO:0070062]; filopodium [GO:0030175]; focal adhesion [GO:0005925]; integral component of plasma membrane [GO:0005887]; lamellipodium [GO:0030027]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]	AGPVKFEK	0.99886	0	0	0	0	0	0	0	0	0	0	0	9.11121
Q9UBR2	CATZ_HUMAN	Cathepsin Z (EC 3.4.18.1) (Cathepsin P) (Cathepsin X)	CTSZ	Homo sapiens (Human)	angiotensin maturation [GO:0002003]; epithelial tube branching involved in lung morphogenesis [GO:0060441]; negative regulation of plasminogen activation [GO:0010757]; negative regulation of protein binding [GO:0032091]; proteolysis [GO:0006508]; proteolysis involved in protein catabolic process [GO:0051603]; regulation of neuron death [GO:1901214]	cell cortex [GO:0005938]; collagen-containing extracellular matrix [GO:0062023]; COPII-coated ER to Golgi transport vesicle [GO:0030134]; cytoplasmic vesicle [GO:0031410]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; intracellular membrane-bounded organelle [GO:0043231]; lysosome [GO:0005764]; plasma membrane [GO:0005886]; specific granule lumen [GO:0035580]	carboxypeptidase activity [GO:0004180]; cysteine-type endopeptidase activity [GO:0004197]; cysteine-type peptidase activity [GO:0008234]	IVTSTYK	0.12632	9.11119	0	0	0	0	0	0	0	0	0	0	0
P18084	ITB5_HUMAN	Integrin beta-5	ITGB5	Homo sapiens (Human)	cell adhesion mediated by integrin [GO:0033627]; cell migration [GO:0016477]; cell-matrix adhesion [GO:0007160]; endodermal cell differentiation [GO:0035987]; epithelial cell-cell adhesion [GO:0090136]; integrin-mediated signaling pathway [GO:0007229]; stress fiber assembly [GO:0043149]; transforming growth factor beta receptor signaling pathway [GO:0007179]	cell surface [GO:0009986]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; integrin alphav-beta5 complex [GO:0034684]; phagocytic vesicle [GO:0045335]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]	integrin binding [GO:0005178]; signaling receptor activity [GO:0038023]; virus receptor activity [GO:0001618]	EDFGSPRSITSRCDLR	0.95213	0	0	0	0	0	0	0	0	0	0	9.10884	0
Q8N8J6	ZN615_HUMAN	Zinc finger protein 615	ZNF615	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	SNLSFENQK	0.93644	0	0	9.10418	0	0	0	0	0	0	0	0	0
Q8WYN0	ATG4A_HUMAN	Cysteine protease ATG4A (EC 3.4.22.-) (AUT-like 2 cysteine endopeptidase) (Autophagy-related cysteine endopeptidase 2) (Autophagin-2) (Autophagy-related protein 4 homolog A) (HsAPG4A) (hAPG4A)	ATG4A APG4A AUTL2	Homo sapiens (Human)	autophagy [GO:0006914]; lipid metabolic process [GO:0006629]; protein delipidation [GO:0051697]; protein transport [GO:0015031]; proteolysis [GO:0006508]	cytoplasm [GO:0005737]	Atg8-specific peptidase activity [GO:0019786]; cysteine-type endopeptidase activity [GO:0004197]; cysteine-type peptidase activity [GO:0008234]	ILQCFLDR	0.8692	0	0	0	0	0	0	9.10415	0	0	0	0	0
A3KMH1	VWA8_HUMAN	von Willebrand factor A domain-containing protein 8 (PEX7-binding protein 2) (P7BP2)	VWA8 KIAA0564	Homo sapiens (Human)		cytoplasm [GO:0005737]; mitochondrion [GO:0005739]; peroxisome [GO:0005777]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]	SIAMQYLELTK	0.91725	0	0	0	0	0	0	0	0	9.10284	0	0	0
Q9UFH2	DYH17_HUMAN	Dynein axonemal heavy chain 17 (Axonemal beta dynein heavy chain 17) (Axonemal dynein heavy chain-like protein 1) (Ciliary dynein heavy chain 17) (Ciliary dynein heavy chain-like protein 1) (Dynein axonemal light chain 2)	DNAH17 DNAHL1 DNEL2	Homo sapiens (Human)	cilium movement [GO:0003341]; cilium-dependent cell motility [GO:0060285]; microtubule-based movement [GO:0007018]; outer dynein arm assembly [GO:0036158]	axonemal dynein complex [GO:0005858]; axoneme [GO:0005930]; dynein complex [GO:0030286]; microtubule [GO:0005874]; motile cilium [GO:0031514]; outer dynein arm [GO:0036157]; sperm flagellum [GO:0036126]	ATP binding [GO:0005524]; dynein intermediate chain binding [GO:0045505]; dynein light intermediate chain binding [GO:0051959]; microtubule motor activity [GO:0003777]; minus-end-directed microtubule motor activity [GO:0008569]	QLKACHREVR	0.84221	0	0	0	0	0	0	0	0	9.10284	0	0	0
Q9H9Y2	RPF1_HUMAN	Ribosome production factor 1 (Brix domain-containing protein 5) (Ribosome biogenesis protein RPF1)	RPF1 BXDC5	Homo sapiens (Human)	maturation of 5.8S rRNA [GO:0000460]; maturation of LSU-rRNA [GO:0000470]; rRNA processing [GO:0006364]	"nucleolus [GO:0005730]; preribosome, large subunit precursor [GO:0030687]"	RNA binding [GO:0003723]; rRNA primary transcript binding [GO:0042134]	MAKAGDK	0.58868	0	0	0	0	0	0	0	0	9.09677	0	0	0
Q14573	ITPR3_HUMAN	"Inositol 1,4,5-trisphosphate receptor type 3 (IP3 receptor isoform 3) (IP3R 3) (InsP3R3) (Type 3 inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor)"	ITPR3	Homo sapiens (Human)	G protein-coupled receptor signaling pathway [GO:0007186]; long-term synaptic potentiation [GO:0060291]; memory [GO:0007613]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; response to calcium ion [GO:0051592]; sensory perception of bitter taste [GO:0050913]; sensory perception of sweet taste [GO:0050916]; sensory perception of taste [GO:0050909]; sensory perception of umami taste [GO:0050917]	apical part of cell [GO:0045177]; brush border [GO:0005903]; cytoplasm [GO:0005737]; cytoplasmic vesicle membrane [GO:0030659]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; myelin sheath [GO:0043209]; neuronal cell body [GO:0043025]; nuclear outer membrane [GO:0005640]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; platelet dense tubular network membrane [GO:0031095]; receptor complex [GO:0043235]; sarcoplasmic reticulum [GO:0016529]; secretory granule membrane [GO:0030667]	"calcium ion binding [GO:0005509]; calcium-release channel activity [GO:0015278]; inositol 1,3,4,5 tetrakisphosphate binding [GO:0043533]; inositol 1,4,5 trisphosphate binding [GO:0070679]; inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity [GO:0005220]; inositol hexakisphosphate binding [GO:0000822]; phosphatidylinositol binding [GO:0035091]"	LVCDLITSTK	0.57778	0	0	9.09669	0	0	0	0	0	0	0	0	0
P54277	PMS1_HUMAN	PMS1 protein homolog 1 (DNA mismatch repair protein PMS1)	PMS1 PMSL1	Homo sapiens (Human)	mismatch repair [GO:0006298]; response to xenobiotic stimulus [GO:0009410]	mismatch repair complex [GO:0032300]; nucleus [GO:0005634]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent DNA damage sensor activity [GO:0140664]; DNA binding [GO:0003677]; enzyme binding [GO:0019899]; mismatched DNA binding [GO:0030983]	IKPTSAWNLAQKHK	0.99915	0	9.09125	0	0	0	0	0	0	0	0	0	0
Q9BVL4	SELO_HUMAN	"Protein adenylyltransferase SelO, mitochondrial (EC 2.7.7.-) (EC 2.7.7.n1) (Selenoprotein O) (SelO)"	SELENOO SELO	Homo sapiens (Human)	protein adenylylation [GO:0018117]	chromosome [GO:0005694]; mitochondrion [GO:0005739]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; protein adenylyltransferase activity [GO:0070733]	CSPSPAPRSTLSGAAMEPAPR	0.87366	0	0	0	0	0	0	0	0	0	0	0	9.08531
P29074	PTN4_HUMAN	Tyrosine-protein phosphatase non-receptor type 4 (EC 3.1.3.48) (Protein-tyrosine phosphatase MEG1) (MEG) (PTPase-MEG1)	PTPN4	Homo sapiens (Human)	peptidyl-tyrosine phosphorylation [GO:0018108]; protein dephosphorylation [GO:0006470]	cytoplasm [GO:0005737]; cytoplasmic side of plasma membrane [GO:0009898]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]	cytoskeletal protein binding [GO:0008092]; glutamate receptor binding [GO:0035254]; non-membrane spanning protein tyrosine phosphatase activity [GO:0004726]; protein tyrosine phosphatase activity [GO:0004725]	LQEEYTR	0.92447	0	0	0	9.08321	0	0	0	0	0	0	0	0
Q9Y239	NOD1_HUMAN	Nucleotide-binding oligomerization domain-containing protein 1 (Caspase recruitment domain-containing protein 4)	NOD1 CARD4	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; apoptotic process [GO:0006915]; cellular response to muramyl dipeptide [GO:0071225]; defense response [GO:0006952]; defense response to bacterium [GO:0042742]; defense response to Gram-positive bacterium [GO:0050830]; detection of bacterium [GO:0016045]; detection of biotic stimulus [GO:0009595]; ERK1 and ERK2 cascade [GO:0070371]; I-kappaB kinase/NF-kappaB signaling [GO:0007249]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; intracellular signal transduction [GO:0035556]; JNK cascade [GO:0007254]; pattern recognition receptor signaling pathway [GO:0002221]; positive regulation of cell death [GO:0010942]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of dendritic cell antigen processing and presentation [GO:0002606]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of JNK cascade [GO:0046330]; positive regulation of macrophage cytokine production [GO:0060907]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; positive regulation of nitric-oxide synthase activity [GO:0051000]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of xenophagy [GO:1904417]; regulation of apoptotic process [GO:0042981]; signal transduction [GO:0007165]; xenophagy [GO:0098792]	anchored component of plasma membrane [GO:0046658]; apical plasma membrane [GO:0016324]; basolateral plasma membrane [GO:0016323]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; phagocytic vesicle [GO:0045335]	ATP binding [GO:0005524]; CARD domain binding [GO:0050700]; cysteine-type endopeptidase activator activity involved in apoptotic process [GO:0008656]; identical protein binding [GO:0042802]; pattern recognition receptor activity [GO:0038187]; peptidoglycan binding [GO:0042834]; protein homodimerization activity [GO:0042803]; protein-containing complex binding [GO:0044877]	VGTQELLR	0.99721	0	0	0	9.08321	0	0	0	0	0	0	0	0
Q93008	USP9X_HUMAN	"Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC 3.4.19.12) (Deubiquitinating enzyme FAF-X) (Fat facets in mammals) (hFAM) (Fat facets protein-related, X-linked) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific protease 9, X chromosome) (Ubiquitin-specific-processing protease FAF-X)"	USP9X DFFRX FAM USP9	Homo sapiens (Human)	amyloid fibril formation [GO:1990000]; axon extension [GO:0048675]; BMP signaling pathway [GO:0030509]; cell cycle [GO:0007049]; cell division [GO:0051301]; cell migration [GO:0016477]; chromosome segregation [GO:0007059]; female gamete generation [GO:0007292]; negative regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032435]; negative regulation of transcription by RNA polymerase II [GO:0000122]; neuron migration [GO:0001764]; positive regulation of DNA demethylation [GO:1901537]; positive regulation of protein binding [GO:0032092]; positive regulation of TORC2 signaling [GO:1904515]; protein deubiquitination [GO:0016579]; protein deubiquitination involved in ubiquitin-dependent protein catabolic process [GO:0071947]; protein K63-linked deubiquitination [GO:0070536]; protein localization [GO:0008104]; protein stabilization [GO:0050821]; protein ubiquitination [GO:0016567]; regulation of circadian rhythm [GO:0042752]; rhythmic process [GO:0048511]; transforming growth factor beta receptor signaling pathway [GO:0007179]	cilium [GO:0005929]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; growth cone [GO:0030426]; membrane [GO:0016020]; nucleus [GO:0005634]	co-SMAD binding [GO:0070410]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; cysteine-type peptidase activity [GO:0008234]; deubiquitinase activity [GO:0101005]; Lys48-specific deubiquitinase activity [GO:1990380]; Lys63-specific deubiquitinase activity [GO:0061578]	FIEELRTNDK	0.99853	0	0	9.07967	0	0	0	0	0	0	0	0	0
A6PVC2	TTLL8_HUMAN	Protein monoglycylase TTLL8 (EC 6.3.2.-) (Tubulin--tyrosine ligase-like protein 8)	TTLL8	Homo sapiens (Human)	cilium assembly [GO:0060271]; cilium movement [GO:0003341]; flagellated sperm motility [GO:0030317]; protein polyglycylation [GO:0018094]	axoneme [GO:0005930]; cilium [GO:0005929]; cytosol [GO:0005829]; microtubule [GO:0005874]; microtubule cytoskeleton [GO:0015630]; sperm flagellum [GO:0036126]	"ATP binding [GO:0005524]; metal ion binding [GO:0046872]; protein-glycine ligase activity [GO:0070735]; protein-glycine ligase activity, initiating [GO:0070736]"	LGGRSCSPR	0.99501	9.07722	0	0	0	0	0	0	0	0	0	0	0
Q502W7	CCD38_HUMAN	Coiled-coil domain-containing protein 38	CCDC38	Homo sapiens (Human)		centrosome [GO:0005813]; cytoplasm [GO:0005737]		EGILEESGR	0.93123	9.07722	0	0	0	0	0	0	0	0	0	0	0
Q8TE59	ATS19_HUMAN	A disintegrin and metalloproteinase with thrombospondin motifs 19 (ADAM-TS 19) (ADAM-TS19) (ADAMTS-19) (EC 3.4.24.-)	ADAMTS19	Homo sapiens (Human)	extracellular matrix organization [GO:0030198]; proteolysis [GO:0006508]	extracellular matrix [GO:0031012]; extracellular region [GO:0005576]	metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]	CPGLDSEAR	0.93226	9.07666	0	0	0	0	0	0	0	0	0	0	0
Q8N0X7	SPART_HUMAN	Spartin (Spastic paraplegia 20 protein) (Trans-activated by hepatitis C virus core protein 1)	SPART KIAA0610 SPG20 TAHCCP1	Homo sapiens (Human)	abscission [GO:0009838]; adipose tissue development [GO:0060612]; BMP signaling pathway [GO:0030509]; cell division [GO:0051301]; collateral sprouting in absence of injury [GO:0048669]; lipid droplet organization [GO:0034389]; negative regulation of BMP signaling pathway [GO:0030514]; negative regulation of collateral sprouting in absence of injury [GO:0048698]; neuromuscular process [GO:0050905]; regulation of mitochondrial membrane potential [GO:0051881]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; lipid droplet [GO:0005811]; midbody [GO:0030496]; mitochondrial outer membrane [GO:0005741]; plasma membrane [GO:0005886]; synapse [GO:0045202]	ubiquitin protein ligase binding [GO:0031625]	GEKDEQTKEVK	0.86222	0	0	0	0	0	0	0	9.07428	0	0	0	0
Q86T29	ZN605_HUMAN	Zinc finger protein 605	ZNF605	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	YCDCSTCR	0.93563	9.06934	0	0	0	0	0	0	0	0	0	0	0
Q96RK0	CIC_HUMAN	Protein capicua homolog	CIC KIAA0306	Homo sapiens (Human)	brain development [GO:0007420]; learning [GO:0007612]; memory [GO:0007613]; negative regulation of DNA-templated transcription [GO:0045892]; regulation of transcription by RNA polymerase II [GO:0006357]; social behavior [GO:0035176]	chromatin [GO:0000785]; intracellular membrane-bounded organelle [GO:0043231]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	AAAPSGPAPTTSIR	0.95758	0	0	0	0	0	0	0	0	0	0	9.06784	0
Q9UBM4	OPT_HUMAN	Opticin (Oculoglycan)	OPTC OPT	Homo sapiens (Human)	collagen fibril organization [GO:0030199]	extracellular matrix [GO:0031012]; extracellular region [GO:0005576]	extracellular matrix structural constituent [GO:0005201]	FNRISRIR	0.9457	0	0	9.06547	0	0	0	0	0	0	0	0	0
P09238	MMP10_HUMAN	Stromelysin-2 (SL-2) (EC 3.4.24.22) (Matrix metalloproteinase-10) (MMP-10) (Transin-2)	MMP10 STMY2	Homo sapiens (Human)	collagen catabolic process [GO:0030574]; extracellular matrix disassembly [GO:0022617]; extracellular matrix organization [GO:0030198]; proteolysis [GO:0006508]	extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]	metalloendopeptidase activity [GO:0004222]; serine-type endopeptidase activity [GO:0004252]; zinc ion binding [GO:0008270]	TYFFAADK	0.97809	0	0	0	0	0	9.06525	0	0	0	0	0	0
Q92599	SEPT8_HUMAN	Septin-8	SEPTIN8 KIAA0202 SEPT8	Homo sapiens (Human)	cytoskeleton-dependent cytokinesis [GO:0061640]; protein localization [GO:0008104]; regulation of intracellular protein transport [GO:0033157]; regulation of protein stability [GO:0031647]; regulation of SNARE complex assembly [GO:0035542]	anchoring junction [GO:0070161]; axon [GO:0030424]; cell division site [GO:0032153]; microtubule cytoskeleton [GO:0015630]; presynapse [GO:0098793]; septin complex [GO:0031105]; septin ring [GO:0005940]; synaptic vesicle membrane [GO:0030672]	GTP binding [GO:0005525]; GTPase activity [GO:0003924]; molecular adaptor activity [GO:0060090]	EFLSELQR	1.0002	0	9.06126	0	0	0	0	0	0	0	0	0	0
Q9P2Z0	THA10_HUMAN	THAP domain-containing protein 10	THAP10	Homo sapiens (Human)			DNA binding [GO:0003677]; metal ion binding [GO:0046872]	SLFRFPK	0.99813	0	9.05517	0	0	0	0	0	0	0	0	0	0
Q5H9R4	ARMX4_HUMAN	Armadillo repeat-containing X-linked protein 4	ARMCX4	Homo sapiens (Human)		integral component of membrane [GO:0016021]		AENVVGIGTWAR	0.99125	0	9.05164	0	0	0	0	0	0	0	0	0	0
P11532	DMD_HUMAN	Dystrophin	DMD	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; cardiac muscle cell action potential [GO:0086001]; cardiac muscle contraction [GO:0060048]; maintenance of blood-brain barrier [GO:0035633]; motile cilium assembly [GO:0044458]; muscle cell cellular homeostasis [GO:0046716]; muscle cell development [GO:0055001]; muscle organ development [GO:0007517]; negative regulation of peptidyl-cysteine S-nitrosylation [GO:1902083]; negative regulation of peptidyl-serine phosphorylation [GO:0033137]; neuron development [GO:0048666]; peptide biosynthetic process [GO:0043043]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of neuron projection development [GO:0010976]; positive regulation of sodium ion transmembrane transporter activity [GO:2000651]; protein localization [GO:0008104]; protein-containing complex assembly [GO:0065003]; regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion [GO:0010881]; regulation of cellular response to growth factor stimulus [GO:0090287]; regulation of heart rate [GO:0002027]; regulation of muscle system process [GO:0090257]; regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum [GO:0010880]; regulation of ryanodine-sensitive calcium-release channel activity [GO:0060314]; regulation of skeletal muscle contraction [GO:0014819]; regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion [GO:0014809]; regulation of voltage-gated calcium channel activity [GO:1901385]; response to muscle stretch [GO:0035994]; skeletal muscle tissue development [GO:0007519]	cell junction [GO:0030054]; cell projection [GO:0042995]; cell surface [GO:0009986]; cell-substrate junction [GO:0030055]; cortical actin cytoskeleton [GO:0030864]; costamere [GO:0043034]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; dystrophin-associated glycoprotein complex [GO:0016010]; filopodium [GO:0030175]; filopodium membrane [GO:0031527]; membrane raft [GO:0045121]; neuron projection terminus [GO:0044306]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; postsynaptic membrane [GO:0045211]; protein-containing complex [GO:0032991]; sarcolemma [GO:0042383]; synapse [GO:0045202]; syntrophin complex [GO:0016013]; Z disc [GO:0030018]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; dystroglycan binding [GO:0002162]; myosin binding [GO:0017022]; nitric-oxide synthase binding [GO:0050998]; structural constituent of cytoskeleton [GO:0005200]; structural constituent of muscle [GO:0008307]; vinculin binding [GO:0017166]; zinc ion binding [GO:0008270]	EKPATQPVKRK	0.99878	0	0	0	0	0	0	0	0	0	9.04731	0	0
O60826	CCD22_HUMAN	Coiled-coil domain-containing protein 22	CCDC22 CXorf37 JM1	Homo sapiens (Human)	cellular copper ion homeostasis [GO:0006878]; cytoplasmic sequestering of NF-kappaB [GO:0007253]; endocytic recycling [GO:0032456]; Golgi to plasma membrane transport [GO:0006893]; negative regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043124]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of ubiquitin-dependent protein catabolic process [GO:2000060]; protein transport [GO:0015031]	cytosol [GO:0005829]; endosome [GO:0005768]; nucleoplasm [GO:0005654]	cullin family protein binding [GO:0097602]	LQKQLTEHLR	0.9996	0	0	0	0	0	0	0	9.04671	0	0	0	0
Q4G0N8	SL9C1_HUMAN	Sodium/hydrogen exchanger 10 (Na(+)/H(+) exchanger 10) (NHE-10) (Solute carrier family 9 member 10) (Solute carrier family 9 member C1) (Sperm-specific Na(+)/H(+) exchanger) (sNHE)	SLC9C1 SLC9A10	Homo sapiens (Human)	cell differentiation [GO:0030154]; flagellated sperm motility [GO:0030317]; potassium ion transmembrane transport [GO:0071805]; regulation of intracellular pH [GO:0051453]; sodium ion import across plasma membrane [GO:0098719]; spermatogenesis [GO:0007283]	integral component of membrane [GO:0016021]; motile cilium [GO:0031514]; plasma membrane [GO:0005886]	ion channel activity [GO:0005216]; potassium:proton antiporter activity [GO:0015386]; sodium:proton antiporter activity [GO:0015385]	EIDEIFNTEAMELANR	0.89721	0	0	0	0	0	0	0	9.03991	0	0	0	0
O75648	MTU1_HUMAN	Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)	TRMU MTU1 TRMT1	Homo sapiens (Human)	tRNA wobble position uridine thiolation [GO:0002143]	mitochondrion [GO:0005739]	ATP binding [GO:0005524]; tRNA binding [GO:0000049]; tRNA-5-taurinomethyluridine 2-sulfurtransferase [GO:0061708]	TPNPDIVCNKHIK	0.86516	0	0	0	0	9.0354	0	0	0	0	0	0	0
Q96SN8	CK5P2_HUMAN	CDK5 regulatory subunit-associated protein 2 (CDK5 activator-binding protein C48) (Centrosome-associated protein 215)	CDK5RAP2 CEP215 KIAA1633	Homo sapiens (Human)	brain development [GO:0007420]; centriole replication [GO:0007099]; centrosome cycle [GO:0007098]; chromosome segregation [GO:0007059]; establishment of mitotic spindle orientation [GO:0000132]; microtubule bundle formation [GO:0001578]; microtubule cytoskeleton organization [GO:0000226]; microtubule organizing center organization [GO:0031023]; negative regulation of centriole replication [GO:0046600]; negative regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0045736]; negative regulation of neuron differentiation [GO:0045665]; neurogenesis [GO:0022008]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of microtubule polymerization [GO:0031116]; regulation of mitotic cell cycle spindle assembly checkpoint [GO:0090266]; regulation of neuron differentiation [GO:0045664]	cell junction [GO:0030054]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; microtubule [GO:0005874]; microtubule plus-end [GO:0035371]; mitotic spindle pole [GO:0097431]; pericentriolar material [GO:0000242]; perinuclear region of cytoplasm [GO:0048471]; spindle pole [GO:0000922]	calmodulin binding [GO:0005516]; gamma-tubulin binding [GO:0043015]; microtubule binding [GO:0008017]; protein kinase binding [GO:0019901]; protein-containing complex binding [GO:0044877]; transcription cis-regulatory region binding [GO:0000976]; tubulin binding [GO:0015631]	LEKLFLNGK	0.99099	0	0	0	0	0	9.03488	0	0	0	0	0	0
Q7Z7K2	ZN467_HUMAN	Zinc finger protein 467	ZNF467	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	SFFCPDCGR	0.9429	0	0	0	0	0	0	0	9.03469	0	0	0	0
O75807	PR15A_HUMAN	Protein phosphatase 1 regulatory subunit 15A (Growth arrest and DNA damage-inducible protein GADD34) (Myeloid differentiation primary response protein MyD116 homolog)	PPP1R15A GADD34	Homo sapiens (Human)	apoptotic process [GO:0006915]; cellular response to DNA damage stimulus [GO:0006974]; intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress [GO:0070059]; negative regulation of PERK-mediated unfolded protein response [GO:1903898]; negative regulation of phosphoprotein phosphatase activity [GO:0032515]; negative regulation of protein dephosphorylation [GO:0035308]; positive regulation of endoplasmic reticulum stress-induced eIF2 alpha dephosphorylation [GO:1903917]; positive regulation of peptidyl-serine dephosphorylation [GO:1902310]; positive regulation of phosphoprotein phosphatase activity [GO:0032516]; positive regulation of translational initiation in response to stress [GO:0032058]; protein localization to endoplasmic reticulum [GO:0070972]; regulation of cell cycle [GO:0051726]; regulation of translational initiation by eIF2 alpha dephosphorylation [GO:0036496]; response to endoplasmic reticulum stress [GO:0034976]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; Golgi apparatus [GO:0005794]; membrane [GO:0016020]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; protein phosphatase type 1 complex [GO:0000164]	protein kinase binding [GO:0019901]; protein phosphatase 1 binding [GO:0008157]; protein phosphatase activator activity [GO:0072542]; protein phosphatase regulator activity [GO:0019888]	SSGSDPRSWEYR	0.88364	0	0	0	0	0	0	9.02934	0	0	0	0	0
Q12968	NFAC3_HUMAN	"Nuclear factor of activated T-cells, cytoplasmic 3 (NF-ATc3) (NFATc3) (NFATx) (T-cell transcription factor NFAT4) (NF-AT4) (NF-AT4c)"	NFATC3 NFAT4	Homo sapiens (Human)	calcineurin-NFAT signaling cascade [GO:0033173]; inflammatory response [GO:0006954]; negative regulation of miRNA transcription [GO:1902894]; negative regulation of vascular associated smooth muscle cell differentiation [GO:1905064]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific double-stranded DNA binding [GO:1990837]"	NYEGTCEIPESK	0.78756	0	0	0	0	0	0	9.02934	0	0	0	0	0
Q9ULL8	SHRM4_HUMAN	Protein Shroom4 (Second homolog of apical protein)	SHROOM4 KIAA1202 SHAP	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; actin filament organization [GO:0007015]; brain development [GO:0007420]; cognition [GO:0050890]	actin filament [GO:0005884]; adherens junction [GO:0005912]; apical junction complex [GO:0043296]; apical plasma membrane [GO:0016324]; basal plasma membrane [GO:0009925]; cortical actin cytoskeleton [GO:0030864]; cytoplasm [GO:0005737]; cytoplasmic side of plasma membrane [GO:0009898]; focal adhesion [GO:0005925]; intracellular membrane-bounded organelle [GO:0043231]; nucleoplasm [GO:0005654]; stress fiber [GO:0001725]	actin filament binding [GO:0051015]; myosin II binding [GO:0045159]	IQLIESISRKLSVLR	0.95636	9.02851	0	0	0	0	0	0	0	0	0	0	0
Q86SS6	SYT9_HUMAN	Synaptotagmin-9 (Synaptotagmin IX) (SytIX)	SYT9	Homo sapiens (Human)	calcium-dependent activation of synaptic vesicle fusion [GO:0099502]; calcium-ion regulated exocytosis [GO:0017156]; cellular response to calcium ion [GO:0071277]; positive regulation of calcium ion-dependent exocytosis [GO:0045956]; regulation of calcium ion-dependent exocytosis [GO:0017158]; regulation of dopamine secretion [GO:0014059]; regulation of insulin secretion [GO:0050796]; vesicle-mediated transport [GO:0016192]	anchoring junction [GO:0070161]; clathrin-coated endocytic vesicle membrane [GO:0030669]; dense core granule [GO:0031045]; exocytic vesicle [GO:0070382]; hippocampal mossy fiber to CA3 synapse [GO:0098686]; integral component of synaptic vesicle membrane [GO:0030285]; plasma membrane [GO:0005886]; secretory granule membrane [GO:0030667]	"calcium ion binding [GO:0005509]; calcium-dependent phospholipid binding [GO:0005544]; clathrin binding [GO:0030276]; identical protein binding [GO:0042802]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]; phosphatidylserine binding [GO:0001786]; SNARE binding [GO:0000149]; syntaxin binding [GO:0019905]"	DRARPRLR	0.99861	9.02666	0	0	0	0	0	0	0	0	0	0	0
P10909	CLUS_HUMAN	"Clusterin (Aging-associated gene 4 protein) (Apolipoprotein J) (Apo-J) (Complement cytolysis inhibitor) (CLI) (Complement-associated protein SP-40,40) (Ku70-binding protein 1) (NA1/NA2) (Sulfated glycoprotein 2) (SGP-2) (Testosterone-repressed prostate message 2) (TRPM-2) [Cleaved into: Clusterin beta chain (ApoJalpha) (Complement cytolysis inhibitor a chain); Clusterin alpha chain (ApoJbeta) (Complement cytolysis inhibitor b chain)]"	CLU APOJ CLI KUB1 AAG4	Homo sapiens (Human)	"cell morphogenesis [GO:0000902]; central nervous system myelin maintenance [GO:0032286]; chaperone-mediated protein complex assembly [GO:0051131]; chaperone-mediated protein folding [GO:0061077]; complement activation [GO:0006956]; complement activation, classical pathway [GO:0006958]; immune complex clearance [GO:0002434]; innate immune response [GO:0045087]; intrinsic apoptotic signaling pathway [GO:0097193]; lipid metabolic process [GO:0006629]; microglial cell activation [GO:0001774]; microglial cell proliferation [GO:0061518]; negative regulation of amyloid fibril formation [GO:1905907]; negative regulation of amyloid-beta formation [GO:1902430]; negative regulation of cell death [GO:0060548]; negative regulation of cellular response to thapsigargin [GO:1905892]; negative regulation of cellular response to tunicamycin [GO:1905895]; negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage [GO:1902230]; negative regulation of protein-containing complex assembly [GO:0031333]; negative regulation of release of cytochrome c from mitochondria [GO:0090201]; negative regulation of response to endoplasmic reticulum stress [GO:1903573]; positive regulation of amyloid fibril formation [GO:1905908]; positive regulation of amyloid-beta formation [GO:1902004]; positive regulation of apoptotic process [GO:0043065]; positive regulation of gene expression [GO:0010628]; positive regulation of intrinsic apoptotic signaling pathway [GO:2001244]; positive regulation of neurofibrillary tangle assembly [GO:1902998]; positive regulation of neuron death [GO:1901216]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; positive regulation of protein-containing complex assembly [GO:0031334]; positive regulation of receptor-mediated endocytosis [GO:0048260]; positive regulation of tau-protein kinase activity [GO:1902949]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of ubiquitin-dependent protein catabolic process [GO:2000060]; protein import [GO:0017038]; protein stabilization [GO:0050821]; protein targeting to lysosome involved in chaperone-mediated autophagy [GO:0061740]; regulation of amyloid-beta clearance [GO:1900221]; regulation of apoptotic process [GO:0042981]; regulation of cell population proliferation [GO:0042127]; regulation of neuron death [GO:1901214]; regulation of neuronal signal transduction [GO:1902847]; release of cytochrome c from mitochondria [GO:0001836]; response to misfolded protein [GO:0051788]; response to virus [GO:0009615]; reverse cholesterol transport [GO:0043691]"	apical dendrite [GO:0097440]; blood microparticle [GO:0072562]; cell surface [GO:0009986]; chromaffin granule [GO:0042583]; collagen-containing extracellular matrix [GO:0062023]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]; neurofibrillary tangle [GO:0097418]; nucleus [GO:0005634]; perinuclear endoplasmic reticulum lumen [GO:0099020]; perinuclear region of cytoplasm [GO:0048471]; platelet alpha granule lumen [GO:0031093]; protein-containing complex [GO:0032991]; spherical high-density lipoprotein particle [GO:0034366]; synapse [GO:0045202]	amyloid-beta binding [GO:0001540]; chaperone binding [GO:0051087]; low-density lipoprotein particle receptor binding [GO:0050750]; misfolded protein binding [GO:0051787]; protein carrier chaperone [GO:0140597]; protein heterodimerization activity [GO:0046982]; protein-containing complex binding [GO:0044877]; signaling receptor binding [GO:0005102]; tau protein binding [GO:0048156]; ubiquitin protein ligase binding [GO:0031625]; unfolded protein binding [GO:0051082]	EIQNAVNGVK	0	0	0	0	0	0	0	0	0	0	0	9.02278	0
Q9H4A3	WNK1_HUMAN	Serine/threonine-protein kinase WNK1 (EC 2.7.11.1) (Erythrocyte 65 kDa protein) (p65) (Kinase deficient protein) (Protein kinase lysine-deficient 1) (Protein kinase with no lysine 1) (hWNK1)	WNK1 HSN2 KDP KIAA0344 PRKWNK1	Homo sapiens (Human)	cation homeostasis [GO:0055080]; cellular chloride ion homeostasis [GO:0030644]; cellular response to chemokine [GO:1990869]; chemokine (C-C motif) ligand 21 signaling pathway [GO:0038116]; intracellular signal transduction [GO:0035556]; ion homeostasis [GO:0050801]; ion transport [GO:0006811]; lymphocyte migration into lymph node [GO:0097022]; negative regulation of cell-cell adhesion mediated by integrin [GO:0033633]; negative regulation of GTPase activity [GO:0034260]; negative regulation of heterotypic cell-cell adhesion [GO:0034115]; negative regulation of leukocyte cell-cell adhesion [GO:1903038]; negative regulation of pancreatic juice secretion [GO:0090188]; negative regulation of sodium ion transport [GO:0010766]; neuron development [GO:0048666]; peptidyl-serine phosphorylation [GO:0018105]; peptidyl-threonine phosphorylation [GO:0018107]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of potassium ion import across plasma membrane [GO:1903288]; positive regulation of sodium ion transmembrane transporter activity [GO:2000651]; positive regulation of systemic arterial blood pressure [GO:0003084]; positive regulation of T cell chemotaxis [GO:0010820]; potassium ion homeostasis [GO:0055075]; protein phosphorylation [GO:0006468]; regulation of cation transmembrane transport [GO:1904062]; regulation of sodium ion transport [GO:0002028]; signal transduction [GO:0007165]; sodium ion transmembrane transport [GO:0035725]; T cell receptor signaling pathway [GO:0050852]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; protein-containing complex [GO:0032991]	ATP binding [GO:0005524]; chloride channel inhibitor activity [GO:0019869]; phosphatase binding [GO:0019902]; potassium channel inhibitor activity [GO:0019870]; protein kinase activator activity [GO:0030295]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein kinase inhibitor activity [GO:0004860]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	TTASEAKSDTGQPTKVGR	0.95943	0	9.02101	0	0	0	0	0	0	0	0	0	0
Q7Z494	NPHP3_HUMAN	Nephrocystin-3	NPHP3 KIAA2000	Homo sapiens (Human)	"atrial septum development [GO:0003283]; cilium assembly [GO:0060271]; convergent extension [GO:0060026]; convergent extension involved in gastrulation [GO:0060027]; determination of intestine left/right asymmetry [GO:0071908]; determination of left/right symmetry [GO:0007368]; determination of liver left/right asymmetry [GO:0071910]; determination of pancreatic left/right asymmetry [GO:0035469]; determination of stomach left/right asymmetry [GO:0071909]; epithelial cilium movement involved in determination of left/right asymmetry [GO:0060287]; establishment or maintenance of cell polarity [GO:0007163]; extracellular matrix organization [GO:0030198]; heart looping [GO:0001947]; kidney development [GO:0001822]; kidney morphogenesis [GO:0060993]; lipid metabolic process [GO:0006629]; lung development [GO:0030324]; maintenance of animal organ identity [GO:0048496]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; non-motile cilium assembly [GO:1905515]; photoreceptor cell maintenance [GO:0045494]; positive regulation of protein binding [GO:0032092]; regulation of planar cell polarity pathway involved in neural tube closure [GO:2000167]; regulation of Wnt signaling pathway, planar cell polarity pathway [GO:2000095]; ureter development [GO:0072189]; Wnt signaling pathway [GO:0016055]"	ciliary base [GO:0097546]; ciliary inversin compartment [GO:0097543]; cilium [GO:0005929]; cytosol [GO:0005829]; extracellular region [GO:0005576]		LLEEFPR	0.97575	0	9.0202	0	0	0	0	0	0	0	0	0	0
Q66K89	E4F1_HUMAN	Transcription factor E4F1 (EC 2.3.2.27) (E4F transcription factor 1) (Putative E3 ubiquitin-protein ligase E4F1) (RING-type E3 ubiquitin transferase E4F1) (Transcription factor E4F) (p120E4F) (p50E4F)	E4F1 E4F	Homo sapiens (Human)	"cell cycle [GO:0007049]; cell division [GO:0051301]; DNA replication [GO:0006260]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein ubiquitination [GO:0016567]; regulation of cell cycle [GO:0051726]; regulation of cell cycle process [GO:0010564]; regulation of mitotic cell cycle, embryonic [GO:0009794]; regulation of transcription by RNA polymerase II [GO:0006357]"	cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]; spindle [GO:0005819]	"cAMP response element binding [GO:0035497]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; transferase activity [GO:0016740]"	HHTGEKPFKCYK	0.99813	0	0	9.02001	0	0	0	0	0	0	0	0	0
Q8N9C0	IGS22_HUMAN	Immunoglobulin superfamily member 22 (IgSF22)	IGSF22	Homo sapiens (Human)				EMLEILSKVPKK	0.86624	0	0	0	0	0	9.01801	0	0	0	0	0	0
Q9BUZ4	TRAF4_HUMAN	TNF receptor-associated factor 4 (EC 2.3.2.27) (Cysteine-rich domain associated with RING and Traf domains protein 1) (Metastatic lymph node gene 62 protein) (MLN 62) (RING finger protein 83)	TRAF4 CART1 MLN62 RNF83	Homo sapiens (Human)	activation of NF-kappaB-inducing kinase activity [GO:0007250]; apoptotic process [GO:0006915]; innate immune response [GO:0045087]; positive regulation of JNK cascade [GO:0046330]; positive regulation of protein kinase activity [GO:0045860]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; regulation of apoptotic process [GO:0042981]; regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043122]; respiratory gaseous exchange by respiratory system [GO:0007585]; respiratory tube development [GO:0030323]	bicellular tight junction [GO:0005923]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; fibrillar center [GO:0001650]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]	identical protein binding [GO:0042802]; protein kinase binding [GO:0019901]; thioesterase binding [GO:0031996]; transferase activity [GO:0016740]; tumor necrosis factor receptor binding [GO:0005164]; ubiquitin protein ligase binding [GO:0031625]; WW domain binding [GO:0050699]; zinc ion binding [GO:0008270]	DSCNTALVLCPFKDSGCK	0.87414	0	0	0	0	0	9.01801	0	0	0	0	0	0
Q6ZMT1	STAC2_HUMAN	SH3 and cysteine-rich domain-containing protein 2 (24b2/STAC2) (Src homology 3 and cysteine-rich domain-containing protein 2)	STAC2	Homo sapiens (Human)	positive regulation of protein localization to plasma membrane [GO:1903078]; positive regulation of voltage-gated calcium channel activity [GO:1901387]; skeletal muscle contraction [GO:0003009]	cytosol [GO:0005829]; extrinsic component of cytoplasmic side of plasma membrane [GO:0031234]; sarcolemma [GO:0042383]	metal ion binding [GO:0046872]	SLSERDELTEDGEGSIR	0.83735	0	0	0	0	0	0	9.01262	0	0	0	0	0
A0A2R8Y4Y8	OSP4B_HUMAN	Oocyte-secreted protein 4B	OOSP4B	Homo sapiens (Human)		extracellular region [GO:0005576]		FPSVMHFGMSGFDAHTLK	0.77419	0	0	0	0	9.01114	0	0	0	0	0	0	0
Q5T7M9	DIK1A_HUMAN	Divergent protein kinase domain 1A (Protein FAM69A)	DIPK1A FAM69A	Homo sapiens (Human)		endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]		DCKKIICDK	0.95954	0	9.011	0	0	0	0	0	0	0	0	0	0
O76041	NEBL_HUMAN	Nebulette (Actin-binding Z-disk protein)	NEBL C10orf113 LNEBL	Homo sapiens (Human)	cardiac muscle thin filament assembly [GO:0071691]	extracellular exosome [GO:0070062]; I band [GO:0031674]; stress fiber [GO:0001725]; Z disc [GO:0030018]	actin filament binding [GO:0051015]; cytoskeletal protein binding [GO:0008092]; filamin binding [GO:0031005]; structural constituent of muscle [GO:0008307]; tropomyosin binding [GO:0005523]	NISNVYYR	0.96678	0	9.01019	0	0	0	0	0	0	0	0	0	0
Q96ED9	HOOK2_HUMAN	Protein Hook homolog 2 (h-hook2) (hHK2)	HOOK2	Homo sapiens (Human)	cytoplasmic microtubule organization [GO:0031122]; cytoskeleton-dependent intracellular transport [GO:0030705]; early endosome to late endosome transport [GO:0045022]; endocytosis [GO:0006897]; endosome organization [GO:0007032]; endosome to lysosome transport [GO:0008333]; lysosome organization [GO:0007040]; protein localization to perinuclear region of cytoplasm [GO:1905719]; protein transport [GO:0015031]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; FHF complex [GO:0070695]; intracellular membrane-bounded organelle [GO:0043231]; microtubule [GO:0005874]; trans-Golgi network [GO:0005802]	dynein light intermediate chain binding [GO:0051959]; identical protein binding [GO:0042802]; microtubule binding [GO:0008017]	IRHLEMDFEKSR	0.8679	0	0	0	0	9.00848	0	0	0	0	0	0	0
Q5T4S7	UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 (EC 2.3.2.27) (600 kDa retinoblastoma protein-associated factor) (N-recognin-4) (RING-type E3 ubiquitin transferase UBR4) (Retinoblastoma-associated factor of 600 kDa) (RBAF600) (p600) (Zinc finger UBR1-type protein 1)	UBR4 KIAA0462 KIAA1307 RBAF600 ZUBR1	Homo sapiens (Human)	ubiquitin-dependent protein catabolic process [GO:0006511]	centrosome [GO:0005813]; cytosol [GO:0005829]; ficolin-1-rich granule membrane [GO:0101003]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; specific granule membrane [GO:0035579]; tertiary granule membrane [GO:0070821]	calmodulin binding [GO:0005516]; ubiquitin protein ligase activity [GO:0061630]; ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270]	APSYIEIFGR	0.94328	9.00658	0	0	0	0	0	0	0	0	0	0	0
P22033	MUTA_HUMAN	"Methylmalonyl-CoA mutase, mitochondrial (MCM) (EC 5.4.99.2) (Methylmalonyl-CoA isomerase)"	MMUT MUT	Homo sapiens (Human)	"homocysteine metabolic process [GO:0050667]; positive regulation of GTPase activity [GO:0043547]; post-embryonic development [GO:0009791]; propionate metabolic process, methylmalonyl pathway [GO:0019678]"	cytoplasm [GO:0005737]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]	cobalamin binding [GO:0031419]; GTPase activity [GO:0003924]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; methylmalonyl-CoA mutase activity [GO:0004494]; modified amino acid binding [GO:0072341]; protein homodimerization activity [GO:0042803]	LWAHLIEK	0.93411	0	0	0	0	0	0	9.00644	0	0	0	0	0
Q14296	FASTK_HUMAN	Fas-activated serine/threonine kinase (FAST kinase) (EC 2.7.11.1) (EC 2.7.11.8)	FASTK	Homo sapiens (Human)	apoptotic signaling pathway [GO:0097190]; mitochondrial RNA processing [GO:0000963]; protein phosphorylation [GO:0006468]; regulation of mitochondrial mRNA stability [GO:0044528]; regulation of RNA splicing [GO:0043484]	mitochondrial matrix [GO:0005759]; ribonucleoprotein granule [GO:0035770]	ATP binding [GO:0005524]; Fas-activated serine/threonine kinase activity [GO:0033867]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; RNA binding [GO:0003723]	MRRPRGEPGPR	0.95018	0	0	9.00411	0	0	0	0	0	0	0	0	0
Q96P66	GP101_HUMAN	Probable G-protein coupled receptor 101	GPR101	Homo sapiens (Human)	adenylate cyclase-activating adrenergic receptor signaling pathway [GO:0071880]	integral component of plasma membrane [GO:0005887]; receptor complex [GO:0043235]	G protein-coupled receptor activity [GO:0004930]	DCVENEDEEGAEK	0.98172	0	0	9.00411	0	0	0	0	0	0	0	0	0
Q9NPB8	GPCP1_HUMAN	Glycerophosphocholine phosphodiesterase GPCPD1 (EC 3.1.4.2) (Glycerophosphodiester phosphodiesterase 5)	GPCPD1 GDE5 KIAA1434	Homo sapiens (Human)	glycerophospholipid catabolic process [GO:0046475]; skeletal muscle tissue development [GO:0007519]	cytosol [GO:0005829]	glycerophosphocholine phosphodiesterase activity [GO:0047389]; starch binding [GO:2001070]	TIGGPCQVIVHK	0.9416	0	0	9.00411	0	0	0	0	0	0	0	0	0
Q0D2J5	ZN763_HUMAN	Zinc finger protein 763	ZNF763	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	DNA-binding transcription factor activity [GO:0003700]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]	NHTGEKPYACK	0.99783	0	0	9.00177	0	0	0	0	0	0	0	0	0
Q6P5Q4	LMOD2_HUMAN	Leiomodin-2 (Cardiac leiomodin) (C-LMOD) (Leiomodin)	LMOD2	Homo sapiens (Human)	actin filament organization [GO:0007015]; actin filament polymerization [GO:0030041]; actin nucleation [GO:0045010]; muscle contraction [GO:0006936]; myofibril assembly [GO:0030239]; pointed-end actin filament capping [GO:0051694]; positive regulation of actin filament polymerization [GO:0030838]; sarcomere organization [GO:0045214]	actin filament [GO:0005884]; cytoskeleton [GO:0005856]; M band [GO:0031430]; myofibril [GO:0030016]; sarcomere [GO:0030017]; striated muscle thin filament [GO:0005865]	actin binding [GO:0003779]; actin monomer binding [GO:0003785]; tropomyosin binding [GO:0005523]	GINGTVNYDSVNSDNSKPK	0.82418	0	0	0	9.00158	0	0	0	0	0	0	0	0
Q9H0M4	ZCPW1_HUMAN	Zinc finger CW-type PWWP domain protein 1	ZCWPW1	Homo sapiens (Human)	cell differentiation [GO:0030154]; homologous chromosome pairing at meiosis [GO:0007129]; meiosis I [GO:0007127]; positive regulation of DNA recombination [GO:0045911]; positive regulation of double-strand break repair [GO:2000781]; spermatogenesis [GO:0007283]	chromosome [GO:0005694]; nucleus [GO:0005634]	methyl-CpG binding [GO:0008327]; methylated histone binding [GO:0035064]; zinc ion binding [GO:0008270]	DQQKGEISGFGQCLVWVQCSFPNCGKWR	0.8744	9.00101	0	0	0	0	0	0	0	0	0	0	0
A6NGH8	ANR61_HUMAN	Ankyrin repeat domain-containing protein 61	ANKRD61	Homo sapiens (Human)		nucleoplasm [GO:0005654]		DLVVDSAKSLEDGPSAALHSK	0.86252	0	9.00099	0	0	0	0	0	0	0	0	0	0
O60361	NDK8_HUMAN	Putative nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6)	NME2P1	Homo sapiens (Human)	CTP biosynthetic process [GO:0006241]; GTP biosynthetic process [GO:0006183]; nucleoside diphosphate phosphorylation [GO:0006165]; regulation of apoptotic process [GO:0042981]; UTP biosynthetic process [GO:0006228]	extracellular exosome [GO:0070062]; nucleus [GO:0005634]	ATP binding [GO:0005524]; metal ion binding [GO:0046872]; nucleoside diphosphate kinase activity [GO:0004550]	FLPASEEHLKQHYIDLK	0.86938	0	0	0	8.9989	0	0	0	0	0	0	0	0
Q9H9A7	RMI1_HUMAN	RecQ-mediated genome instability protein 1 (BLM-associated protein of 75 kDa) (BLAP75) (FAAP75)	RMI1 C9orf76	Homo sapiens (Human)	DNA replication [GO:0006260]; double-strand break repair via homologous recombination [GO:0000724]; glucose homeostasis [GO:0042593]; multicellular organism growth [GO:0035264]; reduction of food intake in response to dietary excess [GO:0002023]; resolution of meiotic recombination intermediates [GO:0000712]; resolution of recombination intermediates [GO:0071139]; response to glucose [GO:0009749]	nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; RecQ family helicase-topoisomerase III complex [GO:0031422]	nucleotide binding [GO:0000166]	AMVLALQDVNMEHLENLK	0.49741	0	0	0	8.9989	0	0	0	0	0	0	0	0
Q9BPZ7	SIN1_HUMAN	Target of rapamycin complex 2 subunit MAPKAP1 (TORC2 subunit MAPKAP1) (Mitogen-activated protein kinase 2-associated protein 1) (Stress-activated map kinase-interacting protein 1) (SAPK-interacting protein 1) (mSIN1)	MAPKAP1 MIP1 SIN1	Homo sapiens (Human)	cellular response to nutrient levels [GO:0031669]; cytoskeleton organization [GO:0007010]; negative regulation of apoptotic process [GO:0043066]; negative regulation of Ras protein signal transduction [GO:0046580]; phosphorylation [GO:0016310]; positive regulation of cell growth [GO:0030307]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; regulation of cellular response to oxidative stress [GO:1900407]; substantia nigra development [GO:0021762]; TORC2 signaling [GO:0038203]	cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; TORC2 complex [GO:0031932]	"molecular adaptor activity [GO:0060090]; phosphatidic acid binding [GO:0070300]; phosphatidylinositol-3,4,5-trisphosphate binding [GO:0005547]; phosphatidylinositol-3,4-bisphosphate binding [GO:0043325]; phosphatidylinositol-3,5-bisphosphate binding [GO:0080025]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]; protein kinase binding [GO:0019901]; small GTPase binding [GO:0031267]"	IDVYLPLHSSQDR	0.67532	8.99613	0	0	0	0	0	0	0	0	0	0	0
P27824	CALX_HUMAN	Calnexin (IP90) (Major histocompatibility complex class I antigen-binding protein p88) (p90)	CANX	Homo sapiens (Human)	aging [GO:0007568]; clathrin-dependent endocytosis [GO:0072583]; protein folding [GO:0006457]; protein folding in endoplasmic reticulum [GO:0034975]; protein secretion [GO:0009306]; synaptic vesicle endocytosis [GO:0048488]; ubiquitin-dependent ERAD pathway [GO:0030433]; viral protein processing [GO:0019082]	axon [GO:0030424]; dendrite cytoplasm [GO:0032839]; dendritic spine [GO:0043197]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum quality control compartment [GO:0044322]; extracellular exosome [GO:0070062]; glutamatergic synapse [GO:0098978]; integral component of lumenal side of endoplasmic reticulum membrane [GO:0071556]; integral component of postsynaptic membrane [GO:0099055]; integral component of presynaptic active zone membrane [GO:0099059]; melanosome [GO:0042470]; membrane [GO:0016020]; mitochondria-associated endoplasmic reticulum membrane [GO:0044233]; neuronal cell body [GO:0043025]; protein-containing complex [GO:0032991]; ribosome [GO:0005840]; rough endoplasmic reticulum [GO:0005791]; smooth endoplasmic reticulum [GO:0005790]	apolipoprotein binding [GO:0034185]; calcium ion binding [GO:0005509]; carbohydrate binding [GO:0030246]; ionotropic glutamate receptor binding [GO:0035255]; RNA binding [GO:0003723]; unfolded protein binding [GO:0051082]	DKGDEEEEGEEK	0.99861	8.99461	0	0	0	0	0	0	0	0	0	0	0
Q8N1W1	ARG28_HUMAN	Rho guanine nucleotide exchange factor 28 (190 kDa guanine nucleotide exchange factor) (p190-RhoGEF) (p190RhoGEF) (Rho guanine nucleotide exchange factor)	ARHGEF28 KIAA1998 RGNEF	Homo sapiens (Human)	cell differentiation [GO:0030154]; cell morphogenesis [GO:0000902]; ephrin receptor signaling pathway [GO:0048013]; regulation of Rho protein signal transduction [GO:0035023]; regulation of small GTPase mediated signal transduction [GO:0051056]	cytosol [GO:0005829]; plasma membrane [GO:0005886]	guanyl-nucleotide exchange factor activity [GO:0005085]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]	KFQNFIKLR	0.96559	0	8.99449	0	0	0	0	0	0	0	0	0	0
Q16706	MA2A1_HUMAN	"Alpha-mannosidase 2 (EC 3.2.1.114) (Golgi alpha-mannosidase II) (AMan II) (Man II) (Mannosidase alpha class 2A member 1) (Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase)"	MAN2A1 MANA2	Homo sapiens (Human)	in utero embryonic development [GO:0001701]; liver development [GO:0001889]; lung alveolus development [GO:0048286]; mannose metabolic process [GO:0006013]; mitochondrion organization [GO:0007005]; N-glycan processing [GO:0006491]; positive regulation of neurogenesis [GO:0050769]; protein deglycosylation [GO:0006517]; protein glycosylation [GO:0006486]; respiratory gaseous exchange by respiratory system [GO:0007585]; retina morphogenesis in camera-type eye [GO:0060042]; vacuole organization [GO:0007033]; viral protein processing [GO:0019082]	cis-Golgi network [GO:0005801]; extracellular exosome [GO:0070062]; Golgi medial cisterna [GO:0005797]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; membrane [GO:0016020]	"alpha-mannosidase activity [GO:0004559]; carbohydrate binding [GO:0030246]; hydrolase activity, hydrolyzing N-glycosyl compounds [GO:0016799]; mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase activity [GO:0004572]; metal ion binding [GO:0046872]; protein homodimerization activity [GO:0042803]"	RSAVNTEEEKK	0.92211	0	0	0	0	0	0	0	0	0	0	8.99421	0
Q9Y5F2	PCDBB_HUMAN	Protocadherin beta-11 (PCDH-beta-11)	PCDHB11	Homo sapiens (Human)	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules [GO:0016339]; cell adhesion [GO:0007155]; chemical synaptic transmission [GO:0007268]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; nervous system development [GO:0007399]; synapse assembly [GO:0007416]	integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; synapse [GO:0045202]	calcium ion binding [GO:0005509]	AASVGSCSVPK	0.92984	0	0	0	0	8.99144	0	0	0	0	0	0	0
Q5BJF6	ODFP2_HUMAN	Outer dense fiber protein 2 (Cenexin) (Outer dense fiber of sperm tails protein 2)	ODF2	Homo sapiens (Human)	centriole-centriole cohesion [GO:0010457]; cilium organization [GO:0044782]; protein localization [GO:0008104]; regulation of cilium assembly [GO:1902017]; spermatid development [GO:0007286]	centriolar subdistal appendage [GO:0120103]; centriole [GO:0005814]; centrosome [GO:0005813]; ciliary basal body [GO:0036064]; ciliary transition fiber [GO:0097539]; cilium [GO:0005929]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; microtubule [GO:0005874]; nucleus [GO:0005634]; outer dense fiber [GO:0001520]; sperm flagellum [GO:0036126]; spindle pole [GO:0000922]	small GTPase binding [GO:0031267]; structural molecule activity [GO:0005198]	EDRDSLVER	1.0008	0	0	8.98971	0	0	0	0	0	0	0	0	0
Q6PIJ6	FBX38_HUMAN	F-box only protein 38	FBXO38 SP329	Homo sapiens (Human)	adaptive immune response [GO:0002250]; positive regulation of neuron projection development [GO:0010976]; positive regulation of T cell mediated immune response to tumor cell [GO:0002842]; protein K48-linked ubiquitination [GO:0070936]; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process [GO:0031146]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleus [GO:0005634]; SCF ubiquitin ligase complex [GO:0019005]		FDYAQCK	0.58935	0	0	0	0	0	8.98453	0	0	0	0	0	0
P35568	IRS1_HUMAN	Insulin receptor substrate 1 (IRS-1)	IRS1	Homo sapiens (Human)	cellular response to fatty acid [GO:0071398]; cellular response to insulin stimulus [GO:0032869]; glucose homeostasis [GO:0042593]; insulin receptor signaling pathway [GO:0008286]; insulin-like growth factor receptor signaling pathway [GO:0048009]; negative regulation of insulin receptor signaling pathway [GO:0046627]; negative regulation of insulin secretion [GO:0046676]; phosphatidylinositol 3-kinase signaling [GO:0014065]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of fatty acid beta-oxidation [GO:0032000]; positive regulation of glucose import [GO:0046326]; positive regulation of glucose metabolic process [GO:0010907]; positive regulation of glycogen biosynthetic process [GO:0045725]; positive regulation of insulin receptor signaling pathway [GO:0046628]; positive regulation of phosphatidylinositol 3-kinase activity [GO:0043552]; response to insulin [GO:0032868]; response to peptide hormone [GO:0043434]; signal transduction [GO:0007165]	caveola [GO:0005901]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; insulin receptor complex [GO:0005899]; intracellular membrane-bounded organelle [GO:0043231]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	insulin receptor binding [GO:0005158]; insulin-like growth factor receptor binding [GO:0005159]; phosphatidylinositol 3-kinase binding [GO:0043548]; phosphotyrosine residue binding [GO:0001784]; protein kinase C binding [GO:0005080]; SH2 domain binding [GO:0042169]; signaling receptor complex adaptor activity [GO:0030159]; transmembrane receptor protein tyrosine kinase adaptor activity [GO:0005068]	VIRADPQGCR	0.9945	8.98165	0	0	0	0	0	0	0	0	0	0	0
Q499Z3	SLNL1_HUMAN	Schlafen-like protein 1	SLFNL1	Homo sapiens (Human)			ATP binding [GO:0005524]	GSGEYLSLAFK	0.87057	8.98165	0	0	0	0	0	0	0	0	0	0	0
Q9Y2U5	M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 (EC 2.7.11.25) (MAPK/ERK kinase kinase 2) (MEK kinase 2) (MEKK 2)	MAP3K2 MAPKKK2 MEKK2	Homo sapiens (Human)	cellular response to mechanical stimulus [GO:0071260]; intracellular signal transduction [GO:0035556]; protein phosphorylation [GO:0006468]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]	ATP binding [GO:0005524]; MAP kinase kinase kinase activity [GO:0004709]; metal ion binding [GO:0046872]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	IVQYYGCLR	0.86033	8.98165	0	0	0	0	0	0	0	0	0	0	0
Q96FN5	KIF12_HUMAN	Kinesin-like protein KIF12	KIF12	Homo sapiens (Human)	microtubule-based movement [GO:0007018]	cytoplasm [GO:0005737]; extracellular exosome [GO:0070062]; kinesin complex [GO:0005871]; microtubule [GO:0005874]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; microtubule binding [GO:0008017]; microtubule motor activity [GO:0003777]	SHSDWTQTR	0.94405	8.98097	0	0	0	0	0	0	0	0	0	0	0
O60832	DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 (EC 5.4.99.-) (CBF5 homolog) (Dyskerin) (Nopp140-associated protein of 57 kDa) (Nucleolar protein NAP57) (Nucleolar protein family A member 4) (snoRNP protein DKC1)	DKC1 NOLA4	Homo sapiens (Human)	box H/ACA RNA 3'-end processing [GO:0000495]; enzyme-directed rRNA pseudouridine synthesis [GO:0000455]; mRNA pseudouridine synthesis [GO:1990481]; positive regulation of establishment of protein localization to telomere [GO:1904851]; positive regulation of protein localization to Cajal body [GO:1904871]; positive regulation of telomerase activity [GO:0051973]; positive regulation of telomerase RNA localization to Cajal body [GO:1904874]; positive regulation of telomere maintenance via telomerase [GO:0032212]; regulation of telomerase RNA localization to Cajal body [GO:1904872]; RNA processing [GO:0006396]; rRNA processing [GO:0006364]; rRNA pseudouridine synthesis [GO:0031118]; scaRNA localization to Cajal body [GO:0090666]; snRNA pseudouridine synthesis [GO:0031120]; telomerase RNA stabilization [GO:0090669]; telomere maintenance via telomerase [GO:0007004]	box H/ACA scaRNP complex [GO:0072589]; box H/ACA snoRNP complex [GO:0031429]; box H/ACA telomerase RNP complex [GO:0090661]; cytoplasm [GO:0005737]; fibrillar center [GO:0001650]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; telomerase holoenzyme complex [GO:0005697]	box H/ACA snoRNA binding [GO:0034513]; pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]; telomerase activity [GO:0003720]; telomerase RNA binding [GO:0070034]	DESYLRR	0.99902	0	0	0	0	0	0	0	0	0	8.97825	0	0
P42785	PCP_HUMAN	Lysosomal Pro-X carboxypeptidase (EC 3.4.16.2) (Angiotensinase C) (Lysosomal carboxypeptidase C) (Proline carboxypeptidase) (Prolylcarboxypeptidase) (PRCP)	PRCP PCP	Homo sapiens (Human)	angiogenesis involved in wound healing [GO:0060055]; energy homeostasis [GO:0097009]; glucose homeostasis [GO:0042593]; negative regulation of systemic arterial blood pressure [GO:0003085]; plasma kallikrein-kinin cascade [GO:0002353]; proteolysis [GO:0006508]; regulation of blood vessel endothelial cell migration [GO:0043535]; regulation of reactive oxygen species metabolic process [GO:2000377]; regulation of thyroid hormone mediated signaling pathway [GO:0002155]	azurophil granule membrane [GO:0035577]; basal part of cell [GO:0045178]; extracellular exosome [GO:0070062]; ficolin-1-rich granule membrane [GO:0101003]; intracellular membrane-bounded organelle [GO:0043231]; plasma membrane [GO:0005886]	dipeptidyl-peptidase activity [GO:0008239]; serine-type carboxypeptidase activity [GO:0004185]	NYSVLYFQQK	0.93209	0	0	0	0	0	0	0	0	8.97779	0	0	0
P83436	COG7_HUMAN	Conserved oligomeric Golgi complex subunit 7 (COG complex subunit 7) (Component of oligomeric Golgi complex 7)	COG7 UNQ3082/PRO10013	Homo sapiens (Human)	"glycosylation [GO:0070085]; Golgi organization [GO:0007030]; intracellular protein transport [GO:0006886]; protein glycosylation [GO:0006486]; protein localization to Golgi apparatus [GO:0034067]; protein localization to organelle [GO:0033365]; protein stabilization [GO:0050821]; retrograde transport, vesicle recycling within Golgi [GO:0000301]; retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum [GO:0006890]"	Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; Golgi transport complex [GO:0017119]; intracellular membrane-bounded organelle [GO:0043231]; nucleolus [GO:0005730]; trans-Golgi network membrane [GO:0032588]		MPQLLAYYYK	0.93524	0	0	0	0	0	0	0	0	8.97779	0	0	0
Q8TF62	AT8B4_HUMAN	Probable phospholipid-transporting ATPase IM (EC 7.6.2.1) (ATPase class I type 8B member 4) (P4-ATPase flippase complex alpha subunit ATP8B4)	ATP8B4 KIAA1939	Homo sapiens (Human)	Golgi organization [GO:0007030]; phospholipid translocation [GO:0045332]	Golgi apparatus [GO:0005794]; integral component of membrane [GO:0016021]; phospholipid-translocating ATPase complex [GO:1990531]; plasma membrane [GO:0005886]; specific granule membrane [GO:0035579]; tertiary granule membrane [GO:0070821]; trans-Golgi network [GO:0005802]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATPase-coupled intramembrane lipid transporter activity [GO:0140326]; magnesium ion binding [GO:0000287]	FKRTSIDR	0.9977	0	0	0	0	0	0	0	0	8.97779	0	0	0
Q99500	S1PR3_HUMAN	Sphingosine 1-phosphate receptor 3 (S1P receptor 3) (S1P3) (Endothelial differentiation G-protein coupled receptor 3) (Sphingosine 1-phosphate receptor Edg-3) (S1P receptor Edg-3)	S1PR3 C9orf108 C9orf47 EDG3	Homo sapiens (Human)	adenylate cyclase-activating G protein-coupled receptor signaling pathway [GO:0007189]; adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway [GO:0007193]; anatomical structure morphogenesis [GO:0009653]; G protein-coupled receptor signaling pathway [GO:0007186]; inflammatory response [GO:0006954]; negative regulation of establishment of endothelial barrier [GO:1903141]; Notch signaling pathway [GO:0007219]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; regulation of interleukin-1 beta production [GO:0032651]; regulation of metabolic process [GO:0019222]	cytoplasm [GO:0005737]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; integrin binding [GO:0005178]; lipid binding [GO:0008289]; sphingosine-1-phosphate receptor activity [GO:0038036]	MRPYDANKR	0.99884	0	8.97467	0	0	0	0	0	0	0	0	0	0
Q9Y5H1	PCDG2_HUMAN	Protocadherin gamma-A2 (PCDH-gamma-A2)	PCDHGA2	Homo sapiens (Human)	cell adhesion [GO:0007155]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; nervous system development [GO:0007399]	integral component of plasma membrane [GO:0005887]	calcium ion binding [GO:0005509]	AGQIRYSVREEIDR	0.87026	0	0	8.97384	0	0	0	0	0	0	0	0	0
Q96N46	TTC14_HUMAN	Tetratricopeptide repeat protein 14 (TPR repeat protein 14)	TTC14 KIAA1980 UNQ5813/PRO19630	Homo sapiens (Human)			nucleic acid binding [GO:0003676]	EHSESSVK	0.90504	8.97341	0	0	0	0	0	0	0	0	0	0	0
Q15172	2A5A_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform (PP2A B subunit isoform B'-alpha) (PP2A B subunit isoform B56-alpha) (PP2A B subunit isoform PR61-alpha) (PR61alpha) (PP2A B subunit isoform R5-alpha)	PPP2R5A	Homo sapiens (Human)	negative regulation of lipid kinase activity [GO:0090219]; negative regulation of protein localization to plasma membrane [GO:1903077]; positive regulation of protein dephosphorylation [GO:0035307]; protein dephosphorylation [GO:0006470]; signal transduction [GO:0007165]	"centrosome [GO:0005813]; chromosome, centromeric region [GO:0000775]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; M band [GO:0031430]; membrane [GO:0016020]; nucleus [GO:0005634]; protein phosphatase type 2A complex [GO:0000159]; Z disc [GO:0030018]"	kinase binding [GO:0019900]; phosphoprotein phosphatase activity [GO:0004721]; protein phosphatase activator activity [GO:0072542]; protein phosphatase regulator activity [GO:0019888]	KELEREELWK	0.93175	0	8.97249	0	0	0	0	0	0	0	0	0	0
P35913	PDE6B_HUMAN	"Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta (GMP-PDE beta) (EC 3.1.4.35)"	PDE6B PDEB	Homo sapiens (Human)	"entrainment of circadian clock by photoperiod [GO:0043153]; phototransduction, visible light [GO:0007603]; retina development in camera-type eye [GO:0060041]; retinal cell apoptotic process [GO:1990009]; signal transduction [GO:0007165]; visual perception [GO:0007601]"	photoreceptor disc membrane [GO:0097381]; photoreceptor outer segment membrane [GO:0042622]; plasma membrane [GO:0005886]	"3',5'-cyclic-GMP phosphodiesterase activity [GO:0047555]; 3',5'-cyclic-nucleotide phosphodiesterase activity [GO:0004114]; metal ion binding [GO:0046872]"	QFHKAFYTVR	0.99665	0	0	0	0	0	0	0	0	0	8.97111	0	0
Q5T890	ER6L2_HUMAN	DNA excision repair protein ERCC-6-like 2 (EC 3.6.4.-) (DNA repair and recombination protein RAD26-like)	ERCC6L2 C9orf102 RAD26L	Homo sapiens (Human)	cellular response to reactive oxygen species [GO:0034614]; interstrand cross-link repair [GO:0036297]	cytoplasm [GO:0005737]; microtubule organizing center [GO:0005815]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; protein-containing complex [GO:0032991]	ATP binding [GO:0005524]; ATP-dependent chromatin remodeler activity [GO:0140658]; DNA binding [GO:0003677]; helicase activity [GO:0004386]; hydrolase activity [GO:0016787]; protein kinase binding [GO:0019901]	EKHIFYKSEK	0.9338	0	0	0	0	0	0	0	8.97065	0	0	0	0
Q9GZS1	RPA49_HUMAN	DNA-directed RNA polymerase I subunit RPA49 (RNA polymerase I subunit A49) (DNA-directed RNA polymerase I subunit E) (RNA polymerase I-associated factor 1) (RNA polymerase I-associated factor 53)	POLR1E PAF53 PRAF1	Homo sapiens (Human)	nucleolar large rRNA transcription by RNA polymerase I [GO:0042790]; RNA polymerase I preinitiation complex assembly [GO:0001188]; transcription elongation by RNA polymerase I [GO:0006362]	fibrillar center [GO:0001650]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; RNA polymerase I complex [GO:0005736]	DNA binding [GO:0003677]; RNA polymerase I general transcription initiation factor binding [GO:0001179]	CIWFLDTLIK	0.94295	0	0	0	0	0	0	0	8.97065	0	0	0	0
Q68DQ2	CRBG3_HUMAN	Very large A-kinase anchor protein (vlAKAP) (Beta/gamma crystallin domain-containing protein 3)	CRYBG3	Homo sapiens (Human)	lens development in camera-type eye [GO:0002088]; visual perception [GO:0007601]	protein-containing complex [GO:0032991]	carbohydrate binding [GO:0030246]; protein kinase A binding [GO:0051018]; structural constituent of eye lens [GO:0005212]	IRQSEDKR	0.9988	0	0	0	0	0	0	0	0	8.96861	0	0	0
Q9GZW5	SCND2_HUMAN	Putative SCAN domain-containing protein SCAND2P (SCAN domain-containing protein 2 pseudogene)	SCAND2P SCAND2	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	STSSCARAAR	0.99863	0	0	0	0	0	0	0	0	8.96532	0	0	0
Q8N205	SYNE4_HUMAN	Nesprin-4 (KASH domain-containing protein 4) (KASH4) (Nuclear envelope spectrin repeat protein 4)	SYNE4 C19orf46	Homo sapiens (Human)	establishment of epithelial cell apical/basal polarity [GO:0045198]	integral component of nuclear outer membrane [GO:0031309]; meiotic nuclear membrane microtubule tethering complex [GO:0034993]		HSLLRKPQDK	0.99623	0	0	0	0	0	0	0	0	8.96327	0	0	0
Q9C0F1	CEP44_HUMAN	Centrosomal protein of 44 kDa (Cep44) (HBV PreS1-transactivated protein 3) (PS1TP3)	CEP44 KIAA1712	Homo sapiens (Human)	centriole replication [GO:0007099]; centriole-centriole cohesion [GO:0010457]; centrosome cycle [GO:0007098]	centriole [GO:0005814]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; midbody [GO:0030496]; spindle pole [GO:0000922]	microtubule binding [GO:0008017]	FIDAVYKLLR	1	0	0	0	0	0	8.96301	0	0	0	0	0	0
P61978	HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K (hnRNP K) (Transformation up-regulated nuclear protein) (TUNP)	HNRNPK HNRPK	Homo sapiens (Human)	"mRNA splicing, via spliceosome [GO:0000398]; negative regulation of apoptotic process [GO:0043066]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of mRNA splicing, via spliceosome [GO:0048025]; positive regulation of low-density lipoprotein receptor activity [GO:1905599]; positive regulation of receptor-mediated endocytosis [GO:0048260]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of gene expression [GO:0010468]; regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [GO:1902165]; regulation of low-density lipoprotein particle clearance [GO:0010988]; regulation of mRNA splicing, via spliceosome [GO:0048024]; regulation of transcription by RNA polymerase II [GO:0006357]; RNA processing [GO:0006396]; signal transduction [GO:0007165]"	catalytic step 2 spliceosome [GO:0071013]; cell projection [GO:0042995]; chromatin [GO:0000785]; cytoplasm [GO:0005737]; cytoplasmic stress granule [GO:0010494]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; podosome [GO:0002102]; ribonucleoprotein complex [GO:1990904]	cadherin binding [GO:0045296]; DNA binding [GO:0003677]; identical protein binding [GO:0042802]; mRNA binding [GO:0003729]; protein domain specific binding [GO:0019904]; RNA binding [GO:0003723]	RDYDDMSPR	0.99694	8.96214	0	0	0	0	0	0	0	0	0	0	0
Q86TA1	MOB3B_HUMAN	MOB kinase activator 3B (Mob1 homolog 2b) (Mps one binder kinase activator-like 2B) (MOB kinase activator-like 2B)	MOB3B C9orf35 MOBKL2B	Homo sapiens (Human)	positive regulation of protein phosphorylation [GO:0001934]; regulation of hippo signaling [GO:0035330]; signal transduction [GO:0007165]	cytoplasm [GO:0005737]; nucleus [GO:0005634]	metal ion binding [GO:0046872]; protein kinase activator activity [GO:0030295]	EMTSRMCH	0.92749	0	0	0	0	8.95262	0	0	0	0	0	0	0
O43497	CAC1G_HUMAN	Voltage-dependent T-type calcium channel subunit alpha-1G (Cav3.1c) (NBR13) (Voltage-gated calcium channel subunit alpha Cav3.1)	CACNA1G KIAA1123	Homo sapiens (Human)	AV node cell action potential [GO:0086016]; AV node cell to bundle of His cell signaling [GO:0086027]; calcium ion import [GO:0070509]; calcium ion transmembrane transport [GO:0070588]; cardiac muscle cell action potential involved in contraction [GO:0086002]; chemical synaptic transmission [GO:0007268]; membrane depolarization during action potential [GO:0086010]; membrane depolarization during AV node cell action potential [GO:0086045]; membrane depolarization during SA node cell action potential [GO:0086046]; neuronal action potential [GO:0019228]; positive regulation of calcium ion-dependent exocytosis [GO:0045956]; regulation of atrial cardiac muscle cell membrane depolarization [GO:0060371]; regulation of heart rate by cardiac conduction [GO:0086091]; regulation of ion transmembrane transport [GO:0034765]; regulation of membrane potential [GO:0042391]; response to nickel cation [GO:0010045]; SA node cell action potential [GO:0086015]; SA node cell to atrial cardiac muscle cell signaling [GO:0086018]; sinoatrial node development [GO:0003163]	cytoplasm [GO:0005737]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]; synapse [GO:0045202]; voltage-gated calcium channel complex [GO:0005891]; voltage-gated sodium channel complex [GO:0001518]	low voltage-gated calcium channel activity [GO:0008332]; scaffold protein binding [GO:0097110]; voltage-gated calcium channel activity involved in AV node cell action potential [GO:0086056]; voltage-gated calcium channel activity involved SA node cell action potential [GO:0086059]; voltage-gated sodium channel activity [GO:0005248]	CRQHQEEEEARR	0.95767	0	8.94802	0	0	0	0	0	0	0	0	0	0
Q86TI2	DPP9_HUMAN	Dipeptidyl peptidase 9 (DP9) (EC 3.4.14.5) (Dipeptidyl peptidase IV-related protein 2) (DPRP-2) (Dipeptidyl peptidase IX) (DPP IX) (Dipeptidyl peptidase-like protein 9) (DPLP9)	DPP9 DPRP2	Homo sapiens (Human)	proteolysis [GO:0006508]; pyroptosis [GO:0070269]	cell leading edge [GO:0031252]; cytosol [GO:0005829]; microtubule [GO:0005874]; nucleus [GO:0005634]	aminopeptidase activity [GO:0004177]; dipeptidyl-peptidase activity [GO:0008239]; identical protein binding [GO:0042802]; serine-type peptidase activity [GO:0008236]	ANECKTGFCHLYK	0.87067	0	8.94802	0	0	0	0	0	0	0	0	0	0
Q6ZVT6	CF20D_HUMAN	Protein CFAP20DC (Uncharacterized protein C3orf67)	CFAP20DC C3orf67	Homo sapiens (Human)				DIFTFSSRPR	0.9955	0	0	0	0	0	0	8.9426	0	0	0	0	0
O94986	CE152_HUMAN	Centrosomal protein of 152 kDa (Cep152)	CEP152 KIAA0912	Homo sapiens (Human)	cell projection organization [GO:0030030]; centriole replication [GO:0007099]; centrosome duplication [GO:0051298]; de novo centriole assembly involved in multi-ciliated epithelial cell differentiation [GO:0098535]	centriole [GO:0005814]; centrosome [GO:0005813]; cytosol [GO:0005829]; deuterosome [GO:0098536]; nucleoplasm [GO:0005654]; pericentriolar material [GO:0000242]; procentriole [GO:0120098]; procentriole replication complex [GO:0120099]	protein kinase binding [GO:0019901]	KIEDLHQVKK	0.95675	0	0	0	8.94067	0	0	0	0	0	0	0	0
Q14004	CDK13_HUMAN	Cyclin-dependent kinase 13 (EC 2.7.11.22) (EC 2.7.11.23) (CDC2-related protein kinase 5) (Cell division cycle 2-like protein kinase 5) (Cell division protein kinase 13) (hCDK13) (Cholinesterase-related cell division controller)	CDK13 CDC2L CDC2L5 CHED KIAA1791	Homo sapiens (Human)	"alternative mRNA splicing, via spliceosome [GO:0000380]; hemopoiesis [GO:0030097]; negative regulation of stem cell differentiation [GO:2000737]; phosphorylation of RNA polymerase II C-terminal domain [GO:0070816]; positive regulation of transcription elongation by RNA polymerase II [GO:0032968]; protein phosphorylation [GO:0006468]; regulation of signal transduction [GO:0009966]; transcription elongation by RNA polymerase II promoter [GO:0006368]"	cyclin K-CDK13 complex [GO:0002945]; cyclin-dependent protein kinase holoenzyme complex [GO:0000307]; cyclin/CDK positive transcription elongation factor complex [GO:0008024]; cytosol [GO:0005829]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; Golgi apparatus [GO:0005794]; nuclear cyclin-dependent protein kinase holoenzyme complex [GO:0019908]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	ATP binding [GO:0005524]; cyclin binding [GO:0030332]; cyclin-dependent protein serine/threonine kinase activity [GO:0004693]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein serine kinase activity [GO:0106310]; RNA binding [GO:0003723]; RNA polymerase II CTD heptapeptide repeat kinase activity [GO:0008353]	ASNTSTPTK	0.88746	0	0	0	0	0	0	8.93814	0	0	0	0	0
Q8NGF4	O5AP2_HUMAN	Olfactory receptor 5AP2	OR5AP2	Homo sapiens (Human)	G protein-coupled receptor signaling pathway [GO:0007186]; sensory perception of smell [GO:0007608]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; odorant binding [GO:0005549]; olfactory receptor activity [GO:0004984]	INHFYCDTPPLLK	0.92077	0	0	0	0	0	0	0	0	0	0	0	8.93664
Q68EA5	ZNF57_HUMAN	Zinc finger protein 57 (Zinc finger protein 424)	ZNF57 ZNF424	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]"	DVMLETFR	0.94281	0	0	8.93599	0	0	0	0	0	0	0	0	0
O95900	TRUB2_HUMAN	"Pseudouridylate synthase TRUB2, mitochondrial (EC 5.4.99.-) (TruB pseudouridine synthase homolog 2) (tRNA pseudouridine 55 synthase TRUB2) (Psi55 synthase TRUB2) (EC 5.4.99.25)"	TRUB2	Homo sapiens (Human)	mRNA processing [GO:0006397]; mRNA pseudouridine synthesis [GO:1990481]; positive regulation of mitochondrial translation [GO:0070131]; tRNA processing [GO:0008033]	mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]; ribonucleoprotein granule [GO:0035770]	pseudouridine synthase activity [GO:0009982]; RNA binding [GO:0003723]	LVHEIGLELK	0.93761	0	0	0	0	8.9305	0	0	0	0	0	0	0
P09603	CSF1_HUMAN	Macrophage colony-stimulating factor 1 (CSF-1) (M-CSF) (MCSF) (Lanimostim) [Cleaved into: Processed macrophage colony-stimulating factor 1]	CSF1	Homo sapiens (Human)	branching involved in mammary gland duct morphogenesis [GO:0060444]; cellular response to parathyroid hormone stimulus [GO:0071374]; developmental process involved in reproduction [GO:0003006]; homeostasis of number of cells within a tissue [GO:0048873]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; macrophage colony-stimulating factor signaling pathway [GO:0038145]; macrophage differentiation [GO:0030225]; macrophage homeostasis [GO:0061519]; mammary duct terminal end bud growth [GO:0060763]; mammary gland fat development [GO:0060611]; microglial cell proliferation [GO:0061518]; monocyte activation [GO:0042117]; monocyte differentiation [GO:0030224]; monocyte homeostasis [GO:0035702]; myeloid leukocyte migration [GO:0097529]; negative regulation of neuron death [GO:1901215]; neutrophil homeostasis [GO:0001780]; odontogenesis [GO:0042476]; ossification [GO:0001503]; osteoclast differentiation [GO:0030316]; osteoclast proliferation [GO:0002158]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of cell-matrix adhesion [GO:0001954]; positive regulation of gene expression [GO:0010628]; positive regulation of macrophage chemotaxis [GO:0010759]; positive regulation of macrophage colony-stimulating factor signaling pathway [GO:1902228]; positive regulation of macrophage derived foam cell differentiation [GO:0010744]; positive regulation of macrophage differentiation [GO:0045651]; positive regulation of macrophage migration [GO:1905523]; positive regulation of macrophage proliferation [GO:0120041]; positive regulation of microglial cell migration [GO:1904141]; positive regulation of monocyte differentiation [GO:0045657]; positive regulation of mononuclear cell migration [GO:0071677]; positive regulation of mononuclear cell proliferation [GO:0032946]; positive regulation of multicellular organism growth [GO:0040018]; positive regulation of odontogenesis of dentin-containing tooth [GO:0042488]; positive regulation of osteoclast differentiation [GO:0045672]; positive regulation of protein kinase activity [GO:0045860]; positive regulation of protein metabolic process [GO:0051247]; positive regulation of Ras protein signal transduction [GO:0046579]; Ras protein signal transduction [GO:0007265]; regulation of macrophage derived foam cell differentiation [GO:0010743]; regulation of ossification [GO:0030278]; response to ischemia [GO:0002931]; response to lipopolysaccharide [GO:0032496]; response to mechanical stimulus [GO:0009612]; response to organic cyclic compound [GO:0014070]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	CSF1-CSF1R complex [GO:1990682]; endoplasmic reticulum lumen [GO:0005788]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; nuclear body [GO:0016604]; perinuclear region of cytoplasm [GO:0048471]; plasma membrane [GO:0005886]	cytokine activity [GO:0005125]; growth factor activity [GO:0008083]; identical protein binding [GO:0042802]; macrophage colony-stimulating factor receptor binding [GO:0005157]; protein homodimerization activity [GO:0042803]	VKNVFNETKNLLDK	0.8653	0	0	0	0	8.9279	0	0	0	0	0	0	0
P19823	ITIH2_HUMAN	Inter-alpha-trypsin inhibitor heavy chain H2 (ITI heavy chain H2) (ITI-HC2) (Inter-alpha-inhibitor heavy chain 2) (Inter-alpha-trypsin inhibitor complex component II) (Serum-derived hyaluronan-associated protein) (SHAP)	ITIH2 IGHEP2	Homo sapiens (Human)	hyaluronan metabolic process [GO:0030212]	blood microparticle [GO:0072562]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]	endopeptidase inhibitor activity [GO:0004866]; hyaluronic acid binding [GO:0005540]; serine-type endopeptidase inhibitor activity [GO:0004867]	IYLQPGR	0	8.92324	0	0	0	0	0	0	0	0	0	0	0
P06396	GELS_HUMAN	Gelsolin (AGEL) (Actin-depolymerizing factor) (ADF) (Brevin)	GSN	Homo sapiens (Human)	"actin filament capping [GO:0051693]; actin filament depolymerization [GO:0030042]; actin filament polymerization [GO:0030041]; actin filament reorganization [GO:0090527]; actin filament severing [GO:0051014]; actin nucleation [GO:0045010]; actin polymerization or depolymerization [GO:0008154]; amyloid fibril formation [GO:1990000]; barbed-end actin filament capping [GO:0051016]; cardiac muscle cell contraction [GO:0086003]; cell projection assembly [GO:0030031]; cellular response to interferon-gamma [GO:0071346]; central nervous system development [GO:0007417]; cilium assembly [GO:0060271]; hepatocyte apoptotic process [GO:0097284]; negative regulation of viral entry into host cell [GO:0046597]; phagocytosis, engulfment [GO:0006911]; positive regulation of actin nucleation [GO:0051127]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway [GO:2001269]; positive regulation of gene expression [GO:0010628]; positive regulation of keratinocyte apoptotic process [GO:1902174]; positive regulation of protein processing in phagocytic vesicle [GO:1903923]; protein destabilization [GO:0031648]; regulation of establishment of T cell polarity [GO:1903903]; regulation of plasma membrane raft polarization [GO:1903906]; regulation of podosome assembly [GO:0071801]; regulation of receptor clustering [GO:1903909]; relaxation of cardiac muscle [GO:0055119]; renal protein absorption [GO:0097017]; response to muscle stretch [GO:0035994]; sequestering of actin monomers [GO:0042989]; striated muscle atrophy [GO:0014891]"	actin cap [GO:0030478]; actin cytoskeleton [GO:0015629]; blood microparticle [GO:0072562]; cortical actin cytoskeleton [GO:0030864]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; ficolin-1-rich granule lumen [GO:1904813]; focal adhesion [GO:0005925]; lamellipodium [GO:0030027]; phagocytic vesicle [GO:0045335]; plasma membrane [GO:0005886]; podosome [GO:0002102]; sarcoplasm [GO:0016528]; secretory granule lumen [GO:0034774]	"actin binding [GO:0003779]; actin filament binding [GO:0051015]; calcium ion binding [GO:0005509]; myosin II binding [GO:0045159]; phosphatidylinositol 3-kinase catalytic subunit binding [GO:0036313]; phosphatidylinositol-4,5-bisphosphate binding [GO:0005546]"	AGALNSNDAFVLK	0.077778	8.91779	0	0	0	0	0	0	0	0	0	0	0
P30566	PUR8_HUMAN	Adenylosuccinate lyase (ADSL) (ASL) (EC 4.3.2.2) (Adenylosuccinase) (ASase)	ADSL AMPS	Homo sapiens (Human)	'de novo' AMP biosynthetic process [GO:0044208]; 'de novo' IMP biosynthetic process [GO:0006189]; 'de novo' XMP biosynthetic process [GO:0097294]; aerobic respiration [GO:0009060]; AMP biosynthetic process [GO:0006167]; AMP salvage [GO:0044209]; GMP biosynthetic process [GO:0006177]; purine nucleotide biosynthetic process [GO:0006164]; response to hypoxia [GO:0001666]; response to muscle activity [GO:0014850]; response to nutrient [GO:0007584]; response to starvation [GO:0042594]	cytosol [GO:0005829]; protein-containing complex [GO:0032991]	"(S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido) succinate lyase (fumarate-forming) activity [GO:0070626]; identical protein binding [GO:0042802]; N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity [GO:0004018]"	VEQLDKMVTEK	0.94601	8.91779	0	0	0	0	0	0	0	0	0	0	0
P32119	PRDX2_HUMAN	Peroxiredoxin-2 (EC 1.11.1.24) (Natural killer cell-enhancing factor B) (NKEF-B) (PRP) (Thiol-specific antioxidant protein) (TSA) (Thioredoxin peroxidase 1) (Thioredoxin-dependent peroxide reductase 1) (Thioredoxin-dependent peroxiredoxin 2)	PRDX2 NKEFB TDPX1	Homo sapiens (Human)	cell redox homeostasis [GO:0045454]; cellular response to oxidative stress [GO:0034599]; defense response to tumor cell [GO:0002357]; extrinsic apoptotic signaling pathway [GO:0097191]; hydrogen peroxide catabolic process [GO:0042744]; leukocyte activation [GO:0045321]; negative regulation of apoptotic process [GO:0043066]; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand [GO:2001240]; negative regulation of lipopolysaccharide-mediated signaling pathway [GO:0031665]; negative regulation of NF-kappaB transcription factor activity [GO:0032088]; negative regulation of T cell differentiation [GO:0045581]; positive regulation of blood coagulation [GO:0030194]; positive regulation of MAPK cascade [GO:0043410]; regulation of apoptotic process [GO:0042981]; regulation of hydrogen peroxide metabolic process [GO:0010310]; removal of superoxide radicals [GO:0019430]; respiratory burst involved in inflammatory response [GO:0002536]; response to lipopolysaccharide [GO:0032496]; response to oxidative stress [GO:0006979]; T cell homeostasis [GO:0043029]; T cell proliferation [GO:0042098]; thymus development [GO:0048538]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]	antioxidant activity [GO:0016209]; thioredoxin peroxidase activity [GO:0008379]; thioredoxin-dependent peroxiredoxin activity [GO:0140824]	LSEDYGVLKTDEGIAYR	0.9962	8.91564	0	0	0	0	0	0	0	0	0	0	0
Q8N0Z3	SPICE_HUMAN	Spindle and centriole-associated protein 1 (Coiled-coil domain-containing protein 52) (Spindle and centriole-associated protein)	SPICE1 CCDC52 SPICE	Homo sapiens (Human)	cell division [GO:0051301]; metaphase plate congression [GO:0051310]; mitotic spindle assembly [GO:0090307]; regulation of centriole replication [GO:0046599]	centriole [GO:0005814]; centrosome [GO:0005813]; cytoplasm [GO:0005737]; spindle [GO:0005819]		LWTDIQQK	0.93855	0	0	0	0	0	0	0	8.90707	0	0	0	0
P52948	NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 (EC 3.4.21.-) [Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96)]	NUP98 ADAR2	Homo sapiens (Human)	"mRNA transport [GO:0051028]; nuclear pore complex assembly [GO:0051292]; nuclear pore organization [GO:0006999]; nucleocytoplasmic transport [GO:0006913]; positive regulation of mRNA splicing, via spliceosome [GO:0048026]; protein import into nucleus [GO:0006606]; proteolysis [GO:0006508]"	cytosol [GO:0005829]; nuclear body [GO:0016604]; nuclear envelope [GO:0005635]; nuclear inclusion body [GO:0042405]; nuclear membrane [GO:0031965]; nuclear periphery [GO:0034399]; nuclear pore [GO:0005643]; nuclear pore nuclear basket [GO:0044615]; nuclear pore outer ring [GO:0031080]; nucleoplasm [GO:0005654]; ribonucleoprotein complex [GO:1990904]	mRNA binding [GO:0003729]; nuclear localization sequence binding [GO:0008139]; promoter-specific chromatin binding [GO:1990841]; serine-type peptidase activity [GO:0008236]; structural constituent of nuclear pore [GO:0017056]; transcription coactivator activity [GO:0003713]	ELAVGSL	0.77212	8.90614	0	0	0	0	0	0	0	0	0	0	0
O60353	FZD6_HUMAN	Frizzled-6 (Fz-6) (hFz6)	FZD6	Homo sapiens (Human)	"canonical Wnt signaling pathway [GO:0060070]; cell proliferation in midbrain [GO:0033278]; embryonic nail plate morphogenesis [GO:0035880]; establishment of body hair planar orientation [GO:0048105]; hair follicle development [GO:0001942]; inner ear morphogenesis [GO:0042472]; midbrain morphogenesis [GO:1904693]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of DNA-binding transcription factor activity [GO:0043433]; neural tube closure [GO:0001843]; non-canonical Wnt signaling pathway [GO:0035567]; platelet activation [GO:0030168]; Wnt signaling pathway, planar cell polarity pathway [GO:0060071]"	apical plasma membrane [GO:0016324]; apicolateral plasma membrane [GO:0016327]; cell surface [GO:0009986]; cytoplasmic vesicle membrane [GO:0030659]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; ubiquitin protein ligase binding [GO:0031625]; Wnt receptor activity [GO:0042813]; Wnt-protein binding [GO:0017147]	WSCEAIEQK	0.99859	0	0	8.90509	0	0	0	0	0	0	0	0	0
Q6ZNJ1	NBEL2_HUMAN	Neurobeachin-like protein 2	NBEAL2 KIAA0540 UNQ253/PRO290	Homo sapiens (Human)	platelet formation [GO:0030220]; protein localization [GO:0008104]	cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; ficolin-1-rich granule membrane [GO:0101003]; membrane [GO:0016020]; plasma membrane [GO:0005886]; tertiary granule membrane [GO:0070821]	protein kinase binding [GO:0019901]	NQVYSWLLR	0.92119	8.90409	0	0	0	0	0	0	0	0	0	0	0
Q9HCJ5	ZSWM6_HUMAN	Zinc finger SWIM domain-containing protein 6	ZSWIM6 KIAA1577	Homo sapiens (Human)	striatal medium spiny neuron differentiation [GO:0021773]	Cul2-RING ubiquitin ligase complex [GO:0031462]	zinc ion binding [GO:0008270]	GYPMRAYK	0.86404	8.90319	0	0	0	0	0	0	0	0	0	0	0
A5PLN7	F149A_HUMAN	Protein FAM149A	FAM149A MST119	Homo sapiens (Human)				LVSYRGR	0.9986	0	0	8.90011	0	0	0	0	0	0	0	0	0
Q6IN85	P4R3A_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 3A (SMEK homolog 1)	PPP4R3A KIAA2010 PP4R3A SMEK1 MSTP033	Homo sapiens (Human)	cellular response to DNA damage stimulus [GO:0006974]; protein dephosphorylation [GO:0006470]	cytosol [GO:0005829]; microtubule organizing center [GO:0005815]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; protein phosphatase 4 complex [GO:0030289]	protein phosphatase activator activity [GO:0072542]	VYTLNEDR	0.87387	0	0	0	0	0	0	0	8.89254	0	0	0	0
O15353	FOXN1_HUMAN	Forkhead box protein N1 (Winged-helix transcription factor nude)	FOXN1 RONU WHN	Homo sapiens (Human)	animal organ morphogenesis [GO:0009887]; blood vessel morphogenesis [GO:0048514]; defense response [GO:0006952]; epidermis development [GO:0008544]; hair follicle development [GO:0001942]; keratinocyte differentiation [GO:0030216]; lymphoid lineage cell migration into thymus [GO:0097535]; nail development [GO:0035878]; positive regulation of epithelial cell differentiation [GO:0030858]; positive regulation of hair follicle development [GO:0051798]; regulation of positive thymic T cell selection [GO:1902232]; regulation of transcription by RNA polymerase II [GO:0006357]; T cell homeostasis [GO:0043029]; T cell lineage commitment [GO:0002360]; thymus epithelium morphogenesis [GO:0097536]	chromatin [GO:0000785]; nucleus [GO:0005634]	"DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; transcription cis-regulatory region binding [GO:0000976]"	TPSLPPHSPR	0.99709	0	8.89069	0	0	0	0	0	0	0	0	0	0
Q10472	GALT1_HUMAN	Polypeptide N-acetylgalactosaminyltransferase 1 (EC 2.4.1.41) (Polypeptide GalNAc transferase 1) (GalNAc-T1) (pp-GaNTase 1) (Protein-UDP acetylgalactosaminyltransferase 1) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1) [Cleaved into: Polypeptide N-acetylgalactosaminyltransferase 1 soluble form]	GALNT1	Homo sapiens (Human)	O-glycan processing [GO:0016266]; protein O-linked glycosylation [GO:0006493]; protein O-linked glycosylation via serine [GO:0018242]; protein O-linked glycosylation via threonine [GO:0018243]; viral protein processing [GO:0019082]	endoplasmic reticulum membrane [GO:0005789]; endoplasmic reticulum-Golgi intermediate compartment membrane [GO:0033116]; extracellular region [GO:0005576]; Golgi cisterna membrane [GO:0032580]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]; membrane [GO:0016020]; perinuclear region of cytoplasm [GO:0048471]	carbohydrate binding [GO:0030246]; manganese ion binding [GO:0030145]; polypeptide N-acetylgalactosaminyltransferase activity [GO:0004653]	DFLKRPLESYVK	0.87139	0	0	0	8.8895	0	0	0	0	0	0	0	0
O75330	HMMR_HUMAN	Hyaluronan mediated motility receptor (Intracellular hyaluronic acid-binding protein) (Receptor for hyaluronan-mediated motility) (CD antigen CD168)	HMMR IHABP RHAMM	Homo sapiens (Human)	hyaluronan catabolic process [GO:0030214]; receptor-mediated endocytosis [GO:0006898]	cell surface [GO:0009986]; centrosome [GO:0005813]; cytosol [GO:0005829]; membrane [GO:0016020]; microtubule cytoskeleton [GO:0015630]; plasma membrane [GO:0005886]; spindle [GO:0005819]	cargo receptor activity [GO:0038024]; hyaluronic acid binding [GO:0005540]	EKEDHVNR	0.99912	8.8838	0	0	0	0	0	0	0	0	0	0	0
Q8IYF1	ELOA2_HUMAN	Elongin-A2 (EloA2) (RNA polymerase II transcription factor SIII subunit A2) (Transcription elongation factor B polypeptide 3B)	ELOA2 TCEB3B TCEB3L	Homo sapiens (Human)	regulation of DNA-templated transcription elongation [GO:0032784]; transcription by RNA polymerase II [GO:0006366]; transcription elongation by RNA polymerase II promoter [GO:0006368]	elongin complex [GO:0070449]; nucleoplasm [GO:0005654]		EAKMICFK	0.99576	8.8838	0	0	0	0	0	0	0	0	0	0	0
Q9BQ52	RNZ2_HUMAN	Zinc phosphodiesterase ELAC protein 2 (EC 3.1.26.11) (ElaC homolog protein 2) (Heredity prostate cancer protein 2) (Ribonuclease Z 2) (RNase Z 2) (tRNA 3 endonuclease 2) (tRNase Z 2)	ELAC2 HPC2	Homo sapiens (Human)	"mitochondrial tRNA 3'-trailer cleavage, endonucleolytic [GO:0072684]; mitochondrial tRNA processing [GO:0090646]; tRNA 3'-end processing [GO:0042780]; tRNA catabolic process [GO:0016078]"	cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; mitochondrial nucleoid [GO:0042645]; mitochondrion [GO:0005739]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	3'-tRNA processing endoribonuclease activity [GO:0042781]; endoribonuclease activity [GO:0004521]; metal ion binding [GO:0046872]; RNA binding [GO:0003723]; tRNA-specific ribonuclease activity [GO:0004549]	RSAQDGPAPAEK	0.99693	0	8.87866	0	0	0	0	0	0	0	0	0	0
P49006	MRP_HUMAN	MARCKS-related protein (MARCKS-like protein 1) (Macrophage myristoylated alanine-rich C kinase substrate) (Mac-MARCKS) (MacMARCKS)	MARCKSL1 MLP MRP	Homo sapiens (Human)	actin filament organization [GO:0007015]; cell population proliferation [GO:0008283]; central nervous system development [GO:0007417]; positive regulation of cell population proliferation [GO:0008284]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; extracellular exosome [GO:0070062]; plasma membrane [GO:0005886]	actin filament binding [GO:0051015]; calmodulin binding [GO:0005516]	LSGLSFKRNR	0.96311	0	0	0	0	0	0	8.86515	0	0	0	0	0
Q9UHQ7	TCAL9_HUMAN	Transcription elongation factor A protein-like 9 (TCEA-like protein 9) (Transcription elongation factor S-II protein-like 9) (WW domain-binding protein 5) (WBP-5)	TCEAL9 WBP5	Homo sapiens (Human)		nucleus [GO:0005634]	WW domain binding [GO:0050699]	EVDEIDEIR	0.93555	0	8.86341	0	0	0	0	0	0	0	0	0	0
Q96P31	FCRL3_HUMAN	Fc receptor-like protein 3 (FcR-like protein 3) (FcRL3) (Fc receptor homolog 3) (FcRH3) (IFGP family protein 3) (hIFGP3) (Immune receptor translocation-associated protein 3) (SH2 domain-containing phosphatase anchor protein 2) (CD antigen CD307c)	FCRL3 FCRH3 IFGP3 IRTA3 SPAP2	Homo sapiens (Human)	cell surface receptor signaling pathway [GO:0007166]; negative regulation of B cell receptor signaling pathway [GO:0050859]; negative regulation of immunoglobulin production [GO:0002638]; positive regulation of B cell proliferation [GO:0030890]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of protein serine/threonine phosphatase activity [GO:1905184]; regulation of B cell activation [GO:0050864]; regulation of B cell differentiation [GO:0045577]; regulation of calcium ion import [GO:0090279]; regulation of toll-like receptor 9 signaling pathway [GO:0034163]	cell surface [GO:0009986]; integral component of plasma membrane [GO:0005887]	kinase binding [GO:0019900]; phosphatase binding [GO:0019902]; protein phosphatase binding [GO:0019903]; protein tyrosine kinase binding [GO:1990782]; transmembrane signaling receptor activity [GO:0004888]	IPVSHPVLTFR	0.93391	0	0	0	0	0	0	0	0	8.86022	0	0	0
O95248	MTMR5_HUMAN	Myotubularin-related protein 5 (Inactive phosphatidylinositol 3-phosphatase 5) (SET-binding factor 1) (Sbf1)	SBF1 MTMR5	Homo sapiens (Human)	protein dephosphorylation [GO:0006470]; regulation of GTPase activity [GO:0043087]; spermatid development [GO:0007286]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; nuclear body [GO:0016604]; perinuclear region of cytoplasm [GO:0048471]	guanyl-nucleotide exchange factor activity [GO:0005085]; phosphatase regulator activity [GO:0019208]; protein tyrosine/serine/threonine phosphatase activity [GO:0008138]	SCTFQLLKMAFDEEVGSDSAELFRK	0.57851	0	8.85966	0	0	0	0	0	0	0	0	0	0
Q00722	PLCB2_HUMAN	"1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-2) (Phospholipase C-beta-2) (PLC-beta-2)"	PLCB2	Homo sapiens (Human)	activation of phospholipase C activity [GO:0007202]; detection of chemical stimulus involved in sensory perception of bitter taste [GO:0001580]; G protein-coupled receptor signaling pathway [GO:0007186]; lipid catabolic process [GO:0016042]; phosphatidylinositol metabolic process [GO:0046488]; phosphatidylinositol-mediated signaling [GO:0048015]; phospholipase C-activating G protein-coupled receptor signaling pathway [GO:0007200]; phospholipid metabolic process [GO:0006644]	cytosol [GO:0005829]; G-protein beta/gamma-subunit complex [GO:0031680]; Golgi apparatus [GO:0005794]; plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]; G-protein beta/gamma-subunit complex binding [GO:0031683]; phosphatidylinositol phospholipase C activity [GO:0004435]; phospholipase C activity [GO:0004629]; phospholipid binding [GO:0005543]	STFLDKILVK	1	8.8572	0	0	0	0	0	0	0	0	0	0	0
Q5QP82	DCA10_HUMAN	DDB1- and CUL4-associated factor 10 (WD repeat-containing protein 32)	DCAF10 WDR32	Homo sapiens (Human)	protein ubiquitination [GO:0016567]	Cul4-RING E3 ubiquitin ligase complex [GO:0080008]; nucleoplasm [GO:0005654]		TLSEAHEDCVNNIR	0.95721	0	8.85649	0	0	0	0	0	0	0	0	0	0
Q9UHP3	UBP25_HUMAN	Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.4.19.12) (Deubiquitinating enzyme 25) (USP on chromosome 21) (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25)	USP25 USP21	Homo sapiens (Human)	negative regulation of ERAD pathway [GO:1904293]; protein deubiquitination [GO:0016579]; protein K48-linked deubiquitination [GO:0071108]; protein K63-linked deubiquitination [GO:0070536]; protein modification process [GO:0036211]; proteolysis [GO:0006508]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; nucleus [GO:0005634]	ATPase binding [GO:0051117]; cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; peptidase activity [GO:0008233]; SUMO binding [GO:0032183]; ubiquitin binding [GO:0043130]; ubiquitin protein ligase binding [GO:0031625]; ubiquitin-like protein peptidase activity [GO:0019783]	ELRYLFALLVGTKR	0.87318	0	0	0	0	0	0	0	8.85244	0	0	0	0
Q9UET6	TRM7_HUMAN	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase (EC 2.1.1.205) (2'-O-ribose RNA methyltransferase TRM7 homolog) (Protein ftsJ homolog 1)	FTSJ1 JM23	Homo sapiens (Human)	cytoplasmic translation [GO:0002181]; RNA methylation [GO:0001510]; tRNA methylation [GO:0030488]; tRNA modification [GO:0006400]; tRNA nucleoside ribose methylation [GO:0002128]	cytoplasm [GO:0005737]; cytosol [GO:0005829]	RNA methyltransferase activity [GO:0008173]; tRNA (cytosine-2'-O-)-methyltransferase activity [GO:0052666]; tRNA (guanosine-2'-O-)-methyltransferase activity [GO:0009020]; tRNA methyltransferase activity [GO:0008175]	DVYYRLAK	0.99829	8.85066	0	0	0	0	0	0	0	0	0	0	0
P80365	DHI2_HUMAN	11-beta-hydroxysteroid dehydrogenase type 2 (11-DH2) (11-beta-HSD2) (EC 1.1.1.-) (11-beta-hydroxysteroid dehydrogenase type II) (11-HSD type II) (11-beta-HSD type II) (Corticosteroid 11-beta-dehydrogenase isozyme 2) (NAD-dependent 11-beta-hydroxysteroid dehydrogenase) (Short chain dehydrogenase/reductase family 9C member 3)	HSD11B2 HSD11K SDR9C3	Homo sapiens (Human)	cortisol metabolic process [GO:0034650]; female pregnancy [GO:0007565]; glucocorticoid metabolic process [GO:0008211]; regulation of blood volume by renal aldosterone [GO:0002017]; response to food [GO:0032094]; response to glucocorticoid [GO:0051384]; response to hypoxia [GO:0001666]; response to insulin [GO:0032868]; response to xenobiotic stimulus [GO:0009410]; steroid metabolic process [GO:0008202]	endoplasmic reticulum membrane [GO:0005789]; intracellular membrane-bounded organelle [GO:0043231]; lipid droplet [GO:0005811]; nucleoplasm [GO:0005654]	11-beta-hydroxysteroid dehydrogenase (NAD+) activity [GO:0070523]; NAD binding [GO:0051287]; oxidoreductase activity [GO:0016491]; steroid binding [GO:0005496]; steroid dehydrogenase activity [GO:0016229]	TESVRNVGQWEK	0.875	0	0	0	0	8.84966	0	0	0	0	0	0	0
O75310	UDB11_HUMAN	UDP-glucuronosyltransferase 2B11 (UDPGT 2B11) (EC 2.4.1.17)	UGT2B11	Homo sapiens (Human)	cellular glucuronidation [GO:0052695]; estrogen metabolic process [GO:0008210]; xenobiotic glucuronidation [GO:0052697]; xenobiotic metabolic process [GO:0006805]	endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]	glucuronosyltransferase activity [GO:0015020]	TVINDPLYKENIMK	0.8738	8.84894	0	0	0	0	0	0	0	0	0	0	0
O94906	PRP6_HUMAN	Pre-mRNA-processing factor 6 (Androgen receptor N-terminal domain-transactivating protein 1) (ANT-1) (PRP6 homolog) (U5 snRNP-associated 102 kDa protein) (U5-102 kDa protein)	PRPF6 C20orf14	Homo sapiens (Human)	"mRNA splicing, via spliceosome [GO:0000398]; positive regulation of transcription by RNA polymerase II [GO:0045944]; RNA localization [GO:0006403]; RNA splicing [GO:0008380]; RNA splicing, via transesterification reactions [GO:0000375]; spliceosomal complex assembly [GO:0000245]; spliceosomal tri-snRNP complex assembly [GO:0000244]"	catalytic step 2 spliceosome [GO:0071013]; membrane [GO:0016020]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; spliceosomal complex [GO:0005681]; U2-type precatalytic spliceosome [GO:0071005]; U4/U6 x U5 tri-snRNP complex [GO:0046540]; U5 snRNP [GO:0005682]	identical protein binding [GO:0042802]; nuclear androgen receptor binding [GO:0050681]; ribonucleoprotein complex binding [GO:0043021]; RNA binding [GO:0003723]; transcription coactivator activity [GO:0003713]	GQIEEQKEMMEK	0.5916	0	8.84668	0	0	0	0	0	0	0	0	0	0
Q8TEW8	PAR3L_HUMAN	Partitioning defective 3 homolog B (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein) (PAR3-beta) (Partitioning defective 3-like protein) (PAR3-L protein)	PARD3B ALS2CR19 PAR3B PAR3L	Homo sapiens (Human)	cell adhesion [GO:0007155]; cell cycle [GO:0007049]; cell division [GO:0051301]; establishment of cell polarity [GO:0030010]; establishment of centrosome localization [GO:0051660]; establishment or maintenance of epithelial cell apical/basal polarity [GO:0045197]; microtubule cytoskeleton organization [GO:0000226]; protein localization [GO:0008104]	adherens junction [GO:0005912]; apical junction complex [GO:0043296]; apical plasma membrane [GO:0016324]; bicellular tight junction [GO:0005923]; cell cortex [GO:0005938]; cell junction [GO:0030054]; endomembrane system [GO:0012505]; protein-containing complex [GO:0032991]	phosphatidylinositol binding [GO:0035091]	EYYQARR	0.99647	8.8454	0	0	0	0	0	0	0	0	0	0	0
Q9UIW2	PLXA1_HUMAN	Plexin-A1 (Semaphorin receptor NOV)	PLXNA1 NOV PLXN1	Homo sapiens (Human)	dichotomous subdivision of terminal units involved in salivary gland branching [GO:0060666]; gonadotrophin-releasing hormone neuronal migration to the hypothalamus [GO:0021828]; negative regulation of cell adhesion [GO:0007162]; neuron projection extension [GO:1990138]; olfactory nerve formation [GO:0021628]; positive regulation of axonogenesis [GO:0050772]; regulation of cell migration [GO:0030334]; regulation of cell shape [GO:0008360]; regulation of GTPase activity [GO:0043087]; regulation of smooth muscle cell migration [GO:0014910]; semaphorin-plexin signaling pathway involved in axon guidance [GO:1902287]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; integral component of plasma membrane [GO:0005887]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]; semaphorin receptor complex [GO:0002116]	semaphorin receptor activity [GO:0017154]	FPAFDIYYVYSFR	0.86724	0	0	0	0	0	8.84109	0	0	0	0	0	0
Q8TF39	ZN483_HUMAN	Zinc finger protein 483 (Zinc finger protein with KRAB and SCAN domains 16)	ZNF483 KIAA1962 ZKSCAN16	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	SFSHSSSLSK	0.94447	0	0	0	0	0	8.83857	0	0	0	0	0	0
Q96NL0	RUN3B_HUMAN	RUN domain-containing protein 3B (Rap2-binding protein 9) (Rap2-interacting protein 9) (RPIP-9)	RUNDC3B RPIB9 RPIP9	Homo sapiens (Human)				GGGGGGGK	0.8789	0	0	8.83851	0	0	0	0	0	0	0	0	0
Q9Y5X2	SNX8_HUMAN	Sorting nexin-8	SNX8	Homo sapiens (Human)	early endosome to Golgi transport [GO:0034498]; intracellular protein transport [GO:0006886]	cytosol [GO:0005829]; early endosome membrane [GO:0031901]; intracellular membrane-bounded organelle [GO:0043231]	identical protein binding [GO:0042802]; phosphatidylinositol binding [GO:0035091]	QMMSATAQNR	0.99765	0	8.83665	0	0	0	0	0	0	0	0	0	0
P62249	RS16_HUMAN	40S ribosomal protein S16 (Small ribosomal subunit protein uS9)	RPS16	Homo sapiens (Human)	"cellular response to leukemia inhibitory factor [GO:1990830]; cytoplasmic translation [GO:0002181]; maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [GO:0000462]; ribosomal small subunit biogenesis [GO:0042274]; rRNA processing [GO:0006364]; translation [GO:0006412]"	cytoplasm [GO:0005737]; cytosol [GO:0005829]; cytosolic ribosome [GO:0022626]; cytosolic small ribosomal subunit [GO:0022627]; extracellular exosome [GO:0070062]; focal adhesion [GO:0005925]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; small ribosomal subunit [GO:0015935]	RNA binding [GO:0003723]; structural constituent of ribosome [GO:0003735]	FGGPGAR	0.88926	0	0	8.83112	0	0	0	0	0	0	0	0	0
P30622	CLIP1_HUMAN	CAP-Gly domain-containing linker protein 1 (Cytoplasmic linker protein 1) (Cytoplasmic linker protein 170 alpha-2) (CLIP-170) (Reed-Sternberg intermediate filament-associated protein) (Restin)	CLIP1 CYLN1 RSN	Homo sapiens (Human)	cytoplasmic microtubule organization [GO:0031122]; microtubule bundle formation [GO:0001578]; mitotic cell cycle [GO:0000278]; positive regulation of microtubule polymerization [GO:0031116]	centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytoplasmic vesicle membrane [GO:0030659]; cytosol [GO:0005829]; intermediate filament [GO:0005882]; kinetochore [GO:0000776]; microtubule [GO:0005874]; microtubule cytoskeleton [GO:0015630]; nucleus [GO:0005634]; ruffle [GO:0001726]	identical protein binding [GO:0042802]; microtubule binding [GO:0008017]; microtubule plus-end binding [GO:0051010]; tubulin binding [GO:0015631]; zinc ion binding [GO:0008270]	LRQQLEAAEK	0.9982	8.83086	0	0	0	0	0	0	0	0	0	0	0
P28039	AOAH_HUMAN	Acyloxyacyl hydrolase (EC 3.1.1.77) [Cleaved into: Acyloxyacyl hydrolase small subunit; Acyloxyacyl hydrolase large subunit]	AOAH	Homo sapiens (Human)	fatty acid metabolic process [GO:0006631]; lipopolysaccharide catabolic process [GO:0009104]; negative regulation of inflammatory response [GO:0050728]	cytoplasmic vesicle [GO:0031410]; extracellular region [GO:0005576]; intracellular membrane-bounded organelle [GO:0043231]	acyloxyacyl hydrolase activity [GO:0050528]; calcium ion binding [GO:0005509]	VQLQWPQILGK	0.93889	0	0	0	0	0	0	8.82988	0	0	0	0	0
Q96MI6	PPM1M_HUMAN	Protein phosphatase 1M (EC 3.1.3.16) (Protein phosphatase 2C isoform eta) (PP2C-eta) (PP2CE)	PPM1M PPM1E	Homo sapiens (Human)	protein dephosphorylation [GO:0006470]	nucleus [GO:0005634]	manganese ion binding [GO:0030145]; myosin phosphatase activity [GO:0017018]	MSAGWFRR	0.9988	0	8.8269	0	0	0	0	0	0	0	0	0	0
Q15697	ZN174_HUMAN	Zinc finger protein 174 (AW-1) (Zinc finger and SCAN domain-containing protein 8)	ZNF174 ZSCAN8	Homo sapiens (Human)	negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]; regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]; fibrillar center [GO:0001650]; nuclear body [GO:0016604]; nucleus [GO:0005634]	"DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; protein homodimerization activity [GO:0042803]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]; sequence-specific double-stranded DNA binding [GO:1990837]; transcription cis-regulatory region binding [GO:0000976]"	NCPDPELCR	0.93506	8.8226	0	0	0	0	0	0	0	0	0	0	0
Q96PE6	ZIM3_HUMAN	Zinc finger imprinted 3 (Zinc finger protein 657)	ZIM3 ZNF657	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	TYRCSECGK	0.87656	8.8226	0	0	0	0	0	0	0	0	0	0	0
Q17R98	ZN827_HUMAN	Zinc finger protein 827	ZNF827	Homo sapiens (Human)	chromatin remodeling [GO:0006338]; establishment of protein localization to telomere [GO:0070200]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of shelterin complex assembly [GO:1904791]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of gene expression [GO:0010468]; telomere maintenance [GO:0000723]	"chromatin [GO:0000785]; chromosome, telomeric region [GO:0000781]; nucleus [GO:0005634]; ribonucleoprotein complex [GO:1990904]"	DNA binding [GO:0003677]; metal ion binding [GO:0046872]; NuRD complex binding [GO:0120325]	CHQHFLR	0.93207	0	0	0	0	0	0	0	0	0	0	0	8.81548
P15259	PGAM2_HUMAN	Phosphoglycerate mutase 2 (EC 5.4.2.11) (EC 5.4.2.4) (BPG-dependent PGAM 2) (Muscle-specific phosphoglycerate mutase) (Phosphoglycerate mutase isozyme M) (PGAM-M)	PGAM2 PGAMM	Homo sapiens (Human)	canonical glycolysis [GO:0061621]; gluconeogenesis [GO:0006094]; glycolytic process [GO:0006096]; Notch signaling pathway [GO:0007219]; response to mercury ion [GO:0046689]; spermatogenesis [GO:0007283]; striated muscle contraction [GO:0006941]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; nucleus [GO:0005634]	"2,3-bisphosphoglycerate-dependent phosphoglycerate mutase activity [GO:0046538]; bisphosphoglycerate mutase activity [GO:0004082]; hydrolase activity [GO:0016787]; identical protein binding [GO:0042802]; phosphoglycerate mutase activity [GO:0004619]"	VLIAAHGNSLR	0.94203	0	0	0	0	0	0	0	8.81353	0	0	0	0
Q8NDT2	RB15B_HUMAN	Putative RNA-binding protein 15B (One-twenty two protein 3) (HsOTT3) (HuOTT3) (RNA-binding motif protein 15B)	RBM15B OTT3	Homo sapiens (Human)	"dosage compensation by inactivation of X chromosome [GO:0009048]; mRNA export from nucleus [GO:0006406]; mRNA processing [GO:0006397]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]; RNA methylation [GO:0001510]; RNA splicing [GO:0008380]"	nuclear envelope [GO:0005635]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; RNA N6-methyladenosine methyltransferase complex [GO:0036396]	mRNA binding [GO:0003729]; RNA binding [GO:0003723]	GGGGSSR	0.89848	8.81105	0	0	0	0	0	0	0	0	0	0	0
Q9H5P4	PDZD7_HUMAN	PDZ domain-containing protein 7	PDZD7 PDZK7	Homo sapiens (Human)	auditory receptor cell development [GO:0060117]; auditory receptor cell stereocilium organization [GO:0060088]; detection of mechanical stimulus involved in sensory perception of sound [GO:0050910]; establishment of localization in cell [GO:0051649]; establishment of protein localization [GO:0045184]; inner ear receptor cell differentiation [GO:0060113]; sensory perception of sound [GO:0007605]	cilium [GO:0005929]; extracellular space [GO:0005615]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; stereocilia ankle link [GO:0002141]; stereocilia ankle link complex [GO:0002142]; stereocilium [GO:0032420]; stereocilium tip [GO:0032426]; USH2 complex [GO:1990696]	identical protein binding [GO:0042802]	IVHLYTTSDDFCLGFNIR	0.77297	0	0	0	0	0	0	0	8.80851	0	0	0	0
Q6P3W6	NBPFA_HUMAN	Neuroblastoma breakpoint family member 10	NBPF10	Homo sapiens (Human)		cytoplasm [GO:0005737]	RNA binding [GO:0003723]	LNGVLMEVEER	0.88374	0	0	0	0	0	8.80665	0	0	0	0	0	0
A1A5D9	BICL2_HUMAN	BICD family-like cargo adapter 2 (Bicaudal D-related protein 2) (BICD-related protein 2) (BICDR-2) (Coiled-coil domain-containing protein 64B)	BICDL2 BICDR2 CCDC64B	Homo sapiens (Human)	Golgi to secretory granule transport [GO:0055107]; vesicle transport along microtubule [GO:0047496]	cytoplasm [GO:0005737]	small GTPase binding [GO:0031267]	LQTTHEELLLLRR	0.87157	8.80603	0	0	0	0	0	0	0	0	0	0	0
Q9UBX5	FBLN5_HUMAN	Fibulin-5 (FIBL-5) (Developmental arteries and neural crest EGF-like protein) (Dance) (Urine p50 protein) (UP50)	FBLN5 DANCE UNQ184/PRO210	Homo sapiens (Human)	cell-matrix adhesion [GO:0007160]; elastic fiber assembly [GO:0048251]; protein localization to cell surface [GO:0034394]; regulation of cell growth [GO:0001558]; regulation of removal of superoxide radicals [GO:2000121]; secretion [GO:0046903]	collagen-containing extracellular matrix [GO:0062023]; extracellular exosome [GO:0070062]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]	calcium ion binding [GO:0005509]; integrin binding [GO:0005178]; protein C-terminus binding [GO:0008022]; protein homodimerization activity [GO:0042803]	DQPFTILYR	0.99661	0	0	0	0	8.80555	0	0	0	0	0	0	0
Q13228	SBP1_HUMAN	Methanethiol oxidase (MTO) (EC 1.8.3.4) (56 kDa selenium-binding protein) (SBP56) (SP56) (Selenium-binding protein 1)	SELENBP1 SBP	Homo sapiens (Human)	protein transport [GO:0015031]	cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; fibrillar center [GO:0001650]; membrane [GO:0016020]; nucleolus [GO:0005730]	methanethiol oxidase activity [GO:0018549]; selenium binding [GO:0008430]	LYITTSLYSAWDK	0.8149	0	0	0	0	0	0	0	8.79977	0	0	0	0
Q9BRH9	ZN251_HUMAN	Zinc finger protein 251	ZNF251	Homo sapiens (Human)	hematopoietic stem cell homeostasis [GO:0061484]; regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	YFIHIKKIFQER	0.86616	0	0	0	0	0	0	8.79354	0	0	0	0	0
Q13522	PPR1A_HUMAN	Protein phosphatase 1 regulatory subunit 1A (Protein phosphatase inhibitor 1) (I-1) (IPP-1)	PPP1R1A IPP1	Homo sapiens (Human)	glycogen metabolic process [GO:0005977]; intracellular signal transduction [GO:0035556]	cytoplasm [GO:0005737]	protein serine/threonine phosphatase inhibitor activity [GO:0004865]	IPNPHLKSTLAMSPR	0.86357	0	0	0	0	0	8.791	0	0	0	0	0	0
O75333	TBX10_HUMAN	T-box transcription factor TBX10 (T-box protein 10)	TBX10 TBX7	Homo sapiens (Human)	anatomical structure morphogenesis [GO:0009653]; cell fate specification [GO:0001708]; positive regulation of DNA-templated transcription [GO:0045893]; regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	ASASTSK	0.90893	0	0	0	0	0	0	0	0	8.78313	0	0	0
Q9UBB5	MBD2_HUMAN	Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2)	MBD2	Homo sapiens (Human)	aging [GO:0007568]; cellular response to organic cyclic compound [GO:0071407]; chromatin remodeling [GO:0006338]; DNA methylation-dependent heterochromatin assembly [GO:0006346]; embryonic organ development [GO:0048568]; heart development [GO:0007507]; histone deacetylation [GO:0016575]; maternal behavior [GO:0042711]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of chromatin binding [GO:0035563]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of Wnt signaling pathway [GO:0030177]; protein-containing complex assembly [GO:0065003]; regulation of cell population proliferation [GO:0042127]; regulation of DNA methylation [GO:0044030]; response to estradiol [GO:0032355]; response to mechanical stimulus [GO:0009612]; response to nutrient levels [GO:0031667]; Wnt signaling pathway [GO:0016055]	chromatin [GO:0000785]; cytosol [GO:0005829]; heterochromatin [GO:0000792]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; NuRD complex [GO:0016581]; protein-containing complex [GO:0032991]	C2H2 zinc finger domain binding [GO:0070742]; chromatin binding [GO:0003682]; methyl-CpG binding [GO:0008327]; molecular adaptor activity [GO:0060090]; mRNA binding [GO:0003729]; protein domain specific binding [GO:0019904]; satellite DNA binding [GO:0003696]; siRNA binding [GO:0035197]	AHPGGGR	0.99153	0	0	0	0	0	0	0	0	8.78313	0	0	0
O15205	UBD_HUMAN	Ubiquitin D (Diubiquitin) (Ubiquitin-like protein FAT10)	UBD FAT10	Homo sapiens (Human)	aggresome assembly [GO:0070842]; myeloid dendritic cell differentiation [GO:0043011]; positive regulation of apoptotic process [GO:0043065]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; protein modification by small protein conjugation [GO:0032446]; protein ubiquitination [GO:0016567]; proteolysis [GO:0006508]; regulation of mitotic cell cycle phase transition [GO:1901990]; response to interferon-gamma [GO:0034341]; response to tumor necrosis factor [GO:0034612]; ubiquitin-dependent protein catabolic process [GO:0006511]	aggresome [GO:0016235]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; fibrillar center [GO:0001650]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	proteasome binding [GO:0070628]	SLSSYGIDKEK	0.87485	0	8.78221	0	0	0	0	0	0	0	0	0	0
Q5T5P2	SKT_HUMAN	Sickle tail protein homolog	KIAA1217 SKT	Homo sapiens (Human)	embryonic skeletal system development [GO:0048706]	cytoplasm [GO:0005737]		KNLEFFHEDVR	0.68634	0	0	0	0	0	0	0	8.77969	0	0	0	0
Q9NNW7	TRXR2_HUMAN	"Thioredoxin reductase 2, mitochondrial (EC 1.8.1.9) (Selenoprotein Z) (SelZ) (TR-beta) (Thioredoxin reductase TR3)"	TXNRD2 KIAA1652 TRXR2	Homo sapiens (Human)	cell redox homeostasis [GO:0045454]; response to hyperoxia [GO:0055093]; response to oxygen radical [GO:0000305]; response to selenium ion [GO:0010269]; response to xenobiotic stimulus [GO:0009410]	axon [GO:0030424]; cytosol [GO:0005829]; dendrite [GO:0030425]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]; neuronal cell body [GO:0043025]	flavin adenine dinucleotide binding [GO:0050660]; protein homodimerization activity [GO:0042803]; protein-containing complex binding [GO:0044877]; thioredoxin-disulfide reductase activity [GO:0004791]	DASQCYVK	0.99697	8.77489	0	0	0	0	0	0	0	0	0	0	0
Q14534	ERG1_HUMAN	Squalene monooxygenase (EC 1.14.14.17) (Squalene epoxidase) (SE)	SQLE ERG1	Homo sapiens (Human)	cellular aromatic compound metabolic process [GO:0006725]; cholesterol metabolic process [GO:0008203]; lipid droplet formation [GO:0140042]; regulation of cell population proliferation [GO:0042127]; response to organic substance [GO:0010033]; sterol biosynthetic process [GO:0016126]	endoplasmic reticulum [GO:0005783]; endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; intracellular membrane-bounded organelle [GO:0043231]	FAD binding [GO:0071949]; squalene monooxygenase activity [GO:0004506]	SMPASFLPPSSVK	0.9203	8.77288	0	0	0	0	0	0	0	0	0	0	0
P12270	TPR_HUMAN	Nucleoprotein TPR (Megator) (NPC-associated intranuclear protein) (Translocated promoter region protein)	TPR	Homo sapiens (Human)	cell division [GO:0051301]; cellular response to heat [GO:0034605]; cellular response to interferon-alpha [GO:0035457]; mitotic spindle assembly checkpoint signaling [GO:0007094]; mRNA export from nucleus [GO:0006406]; mRNA export from nucleus in response to heat stress [GO:0031990]; negative regulation of RNA export from nucleus [GO:0046832]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of translational initiation [GO:0045947]; nuclear pore organization [GO:0006999]; nucleocytoplasmic transport [GO:0006913]; positive regulation of heterochromatin assembly [GO:0031453]; positive regulation of intracellular protein transport [GO:0090316]; positive regulation of mitotic cell cycle spindle assembly checkpoint [GO:0090267]; positive regulation of protein export from nucleus [GO:0046827]; positive regulation of protein import into nucleus [GO:0042307]; protein import into nucleus [GO:0006606]; regulation of mitotic sister chromatid separation [GO:0010965]; regulation of mitotic spindle assembly [GO:1901673]; regulation of protein localization [GO:0032880]; response to epidermal growth factor [GO:0070849]; RNA export from nucleus [GO:0006405]; RNA import into nucleus [GO:0006404]	cytoplasm [GO:0005737]; cytoplasmic dynein complex [GO:0005868]; extrinsic component of membrane [GO:0019898]; kinetochore [GO:0000776]; mitotic spindle [GO:0072686]; nuclear envelope [GO:0005635]; nuclear inclusion body [GO:0042405]; nuclear membrane [GO:0031965]; nuclear periphery [GO:0034399]; nuclear pore [GO:0005643]; nuclear pore nuclear basket [GO:0044615]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	chromatin binding [GO:0003682]; dynein complex binding [GO:0070840]; heat shock protein binding [GO:0031072]; mitogen-activated protein kinase binding [GO:0051019]; mRNA binding [GO:0003729]; protein homodimerization activity [GO:0042803]; RNA binding [GO:0003723]; structural constituent of nuclear pore [GO:0017056]; tubulin binding [GO:0015631]	DEVSKCVCR	1	0	8.77182	0	0	0	0	0	0	0	0	0	0
Q96FK6	WDR89_HUMAN	WD repeat-containing protein 89	WDR89 C14orf150 MSTP050	Homo sapiens (Human)				VHSNDSYKR	1	8.76894	0	0	0	0	0	0	0	0	0	0	0
P06858	LIPL_HUMAN	Lipoprotein lipase (LPL) (EC 3.1.1.34) (Phospholipase A1) (EC 3.1.1.32)	LPL LIPD	Homo sapiens (Human)	cellular response to fatty acid [GO:0071398]; cellular response to nutrient [GO:0031670]; cholesterol homeostasis [GO:0042632]; chylomicron remodeling [GO:0034371]; fatty acid biosynthetic process [GO:0006633]; fatty acid metabolic process [GO:0006631]; lipid catabolic process [GO:0016042]; low-density lipoprotein particle mediated signaling [GO:0055096]; negative regulation of cellular response to insulin stimulus [GO:1900077]; phospholipid metabolic process [GO:0006644]; positive regulation of chemokine (C-X-C motif) ligand 2 production [GO:2000343]; positive regulation of chemokine production [GO:0032722]; positive regulation of cholesterol storage [GO:0010886]; positive regulation of fat cell differentiation [GO:0045600]; positive regulation of inflammatory response [GO:0050729]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of lipid storage [GO:0010884]; positive regulation of macrophage derived foam cell differentiation [GO:0010744]; positive regulation of sequestering of triglyceride [GO:0010890]; positive regulation of tumor necrosis factor production [GO:0032760]; response to bacterium [GO:0009617]; response to cold [GO:0009409]; response to glucose [GO:0009749]; response to xenobiotic stimulus [GO:0009410]; triglyceride biosynthetic process [GO:0019432]; triglyceride catabolic process [GO:0019433]; triglyceride homeostasis [GO:0070328]; triglyceride metabolic process [GO:0006641]; very-low-density lipoprotein particle remodeling [GO:0034372]	catalytic complex [GO:1902494]; cell surface [GO:0009986]; chylomicron [GO:0042627]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]; very-low-density lipoprotein particle [GO:0034361]	1-acyl-2-lysophosphatidylserine acylhydrolase activity [GO:0052740]; apolipoprotein binding [GO:0034185]; calcium ion binding [GO:0005509]; heparan sulfate proteoglycan binding [GO:0043395]; heparin binding [GO:0008201]; lipase activity [GO:0016298]; lipoprotein lipase activity [GO:0004465]; lipoprotein particle binding [GO:0071813]; phosphatidylserine 1-acylhydrolase activity [GO:0052739]; phospholipase A1 activity [GO:0008970]; phospholipase activity [GO:0004620]; protein homodimerization activity [GO:0042803]; protein-membrane adaptor activity [GO:0043495]; signaling receptor binding [GO:0005102]; triglyceride binding [GO:0017129]; triglyceride lipase activity [GO:0004806]	TRSQMPYK	0.99703	0	0	0	0	0	0	0	0	0	0	0	8.76845
Q92838	EDA_HUMAN	"Ectodysplasin-A (Ectodermal dysplasia protein) (EDA protein) [Cleaved into: Ectodysplasin-A, membrane form; Ectodysplasin-A, secreted form]"	EDA ED1 EDA2	Homo sapiens (Human)	animal organ development [GO:0048513]; canonical Wnt signaling pathway [GO:0060070]; cell differentiation [GO:0030154]; cell-matrix adhesion [GO:0007160]; cytokine-mediated signaling pathway [GO:0019221]; gene expression [GO:0010467]; hair follicle placode formation [GO:0060789]; immune response [GO:0006955]; odontogenesis of dentin-containing tooth [GO:0042475]; pigmentation [GO:0043473]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of gene expression [GO:0010628]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of NIK/NF-kappaB signaling [GO:1901224]; regulation of NIK/NF-kappaB signaling [GO:1901222]; salivary gland cavitation [GO:0060662]; trachea gland development [GO:0061153]	apical part of cell [GO:0045177]; collagen trimer [GO:0005581]; cytoskeleton [GO:0005856]; endoplasmic reticulum membrane [GO:0005789]; extracellular space [GO:0005615]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; intracellular membrane-bounded organelle [GO:0043231]; lipid droplet [GO:0005811]; membrane [GO:0016020]; plasma membrane [GO:0005886]	death receptor agonist activity [GO:0038177]; death receptor binding [GO:0005123]; receptor ligand activity [GO:0048018]; signaling receptor binding [GO:0005102]; tumor necrosis factor receptor binding [GO:0005164]	LGEAPAS	0.89632	0	0	8.76779	0	0	0	0	0	0	0	0	0
Q8NFT6	DBF4B_HUMAN	Protein DBF4 homolog B (Activator of S phase kinase-like protein 1) (ASK-like protein 1) (Chiffon homolog B) (Dbf4-related factor 1)	DBF4B ASKL1 DRF1	Homo sapiens (Human)	cell cycle [GO:0007049]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of G2/M transition of mitotic cell cycle [GO:0010971]; positive regulation of nuclear cell cycle DNA replication [GO:0010571]; regulation of cell cycle phase transition [GO:1901987]	cytoplasm [GO:0005737]; Dbf4-dependent protein kinase complex [GO:0031431]; intracellular membrane-bounded organelle [GO:0043231]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	nucleic acid binding [GO:0003676]; protein kinase activator activity [GO:0030295]; protein kinase binding [GO:0019901]; protein serine/threonine kinase activator activity [GO:0043539]; zinc ion binding [GO:0008270]	EVKAESSGKSHR	0.93938	0	8.75342	0	0	0	0	0	0	0	0	0	0
Q96D71	REPS1_HUMAN	RalBP1-associated Eps domain-containing protein 1 (RalBP1-interacting protein 1)	REPS1	Homo sapiens (Human)	endocytosis [GO:0006897]; endosomal transport [GO:0016197]; receptor-mediated endocytosis [GO:0006898]	clathrin-coated pit [GO:0005905]; cytosol [GO:0005829]; plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]; SH3 domain binding [GO:0017124]	IHMQEMELKR	0.9988	0	8.75342	0	0	0	0	0	0	0	0	0	0
Q7L590	MCM10_HUMAN	Protein MCM10 homolog (HsMCM10)	MCM10 PRO2249	Homo sapiens (Human)	cell population proliferation [GO:0008283]; cellular response to DNA damage stimulus [GO:0006974]; DNA replication initiation [GO:0006270]	nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; replication fork protection complex [GO:0031298]	DNA replication origin binding [GO:0003688]; enzyme binding [GO:0019899]; identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; single-stranded DNA binding [GO:0003697]	QQKQRMLEMR	0.96388	0	8.7339	0	0	0	0	0	0	0	0	0	0
Q9P2L0	WDR35_HUMAN	WD repeat-containing protein 35 (Intraflagellar transport protein 121 homolog)	WDR35 IFT121 KIAA1336	Homo sapiens (Human)	cellular response to leukemia inhibitory factor [GO:1990830]; cilium assembly [GO:0060271]; intraciliary retrograde transport [GO:0035721]; intraciliary transport [GO:0042073]; protein localization to cilium [GO:0061512]	axoneme [GO:0005930]; centrosome [GO:0005813]; ciliary basal body [GO:0036064]; ciliary tip [GO:0097542]; cilium [GO:0005929]; intraciliary transport particle A [GO:0030991]		LERRDVWDMK	0.86323	0	8.7339	0	0	0	0	0	0	0	0	0	0
P46060	RAGP1_HUMAN	Ran GTPase-activating protein 1 (RanGAP1)	RANGAP1 KIAA1835 SD	Homo sapiens (Human)	activation of GTPase activity [GO:0090630]; cellular response to vasopressin [GO:1904117]; negative regulation of protein export from nucleus [GO:0046826]; nuclear export [GO:0051168]; nucleocytoplasmic transport [GO:0006913]; protein sumoylation [GO:0016925]; response to axon injury [GO:0048678]; signal transduction [GO:0007165]	aggresome [GO:0016235]; axon cytoplasm [GO:1904115]; cytoplasm [GO:0005737]; cytoplasmic periphery of the nuclear pore complex [GO:1990723]; cytosol [GO:0005829]; dendrite [GO:0030425]; intracellular membrane-bounded organelle [GO:0043231]; kinetochore [GO:0000776]; mitotic spindle [GO:0072686]; nuclear envelope [GO:0005635]; nuclear membrane [GO:0031965]; nuclear pore [GO:0005643]; nuclear pore cytoplasmic filaments [GO:0044614]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; SUMO ligase complex [GO:0106068]	cadherin binding [GO:0045296]; GTPase activator activity [GO:0005096]; RNA binding [GO:0003723]; small GTPase binding [GO:0031267]; ubiquitin protein ligase binding [GO:0031625]	ELNLSFCEIK	0.99777	0	0	0	8.72826	0	0	0	0	0	0	0	0
O43463	SUV91_HUMAN	Histone-lysine N-methyltransferase SUV39H1 (EC 2.1.1.355) (Histone H3-K9 methyltransferase 1) (H3-K9-HMTase 1) (Lysine N-methyltransferase 1A) (Position-effect variegation 3-9 homolog) (Suppressor of variegation 3-9 homolog 1) (Su(var)3-9 homolog 1)	SUV39H1 KMT1A SUV39H	Homo sapiens (Human)	cell cycle [GO:0007049]; cell differentiation [GO:0030154]; cellular response to DNA damage stimulus [GO:0006974]; cellular response to glucose starvation [GO:0042149]; cellular response to hypoxia [GO:0071456]; chromatin organization [GO:0006325]; energy homeostasis [GO:0097009]; histone H3-K9 dimethylation [GO:0036123]; histone H3-K9 trimethylation [GO:0036124]; histone lysine methylation [GO:0034968]; negative regulation of cell cycle [GO:0045786]; negative regulation of circadian rhythm [GO:0042754]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of histone deacetylation [GO:0031065]; positive regulation of histone methylation [GO:0031062]; rDNA heterochromatin assembly [GO:0000183]; regulation of transcription by glucose [GO:0046015]; rhythmic process [GO:0048511]; rRNA processing [GO:0006364]	"chromatin silencing complex [GO:0005677]; chromosome, centromeric region [GO:0000775]; condensed nuclear chromosome [GO:0000794]; eNoSc complex [GO:0061773]; heterochromatin [GO:0000792]; nuclear lamina [GO:0005652]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; rDNA heterochromatin [GO:0033553]"	chromatin binding [GO:0003682]; histone methyltransferase activity [GO:0042054]; histone methyltransferase activity (H3-K9 specific) [GO:0046974]; histone-lysine N-methyltransferase activity [GO:0018024]; protein N-terminus binding [GO:0047485]; S-adenosylmethionine-dependent methyltransferase activity [GO:0008757]; transcription cis-regulatory region binding [GO:0000976]; zinc ion binding [GO:0008270]	LSCPALGISK	0.85605	0	8.71994	0	0	0	0	0	0	0	0	0	0
Q9H227	GBA3_HUMAN	Cytosolic beta-glucosidase (EC 3.2.1.21) (Cytosolic beta-glucosidase-like protein 1) (Cytosolic galactosylceramidase) (EC 3.2.1.46) (Cytosolic glucosylceramidase) (EC 3.2.1.45) (Cytosolic glycosylceramidase) (Cytosolic GCase) (Glucosidase beta acid 3) (Glucosylceramidase beta 3) (Klotho-related protein) (KLrP)	GBA3 CBG CBGL1	Homo sapiens (Human)	beta-glucoside catabolic process [GO:1901805]; cellular oligosaccharide catabolic process [GO:0051692]; galactosylceramide catabolic process [GO:0006683]; glucosylceramide catabolic process [GO:0006680]; glycoside catabolic process [GO:0016139]; glycosphingolipid metabolic process [GO:0006687]; glycosylceramide catabolic process [GO:0046477]; positive regulation of exo-alpha-sialidase activity [GO:1903017]; protein stabilization [GO:0050821]	catalytic complex [GO:1902494]; cytosol [GO:0005829]	beta-galactosidase activity [GO:0004565]; beta-glucosidase activity [GO:0008422]; galactosylceramidase activity [GO:0004336]; glucosylceramidase activity [GO:0004348]; glycosylceramidase activity [GO:0017042]; scopolin beta-glucosidase activity [GO:0102483]	SQIASMSQK	0.99732	0	0	0	0	8.71032	0	0	0	0	0	0	0
Q86TW2	ADCK1_HUMAN	AarF domain-containing protein kinase 1 (EC 2.7.-.-)	ADCK1	Homo sapiens (Human)	lipid homeostasis [GO:0055088]; mitochondrion organization [GO:0007005]; negative regulation of mitochondrial fusion [GO:0010637]; phosphorylation [GO:0016310]; positive regulation of cristae formation [GO:1903852]	extracellular region [GO:0005576]; integral component of mitochondrial membrane [GO:0032592]; mitochondrial inner membrane [GO:0005743]	ATP binding [GO:0005524]; protein serine/threonine kinase activity [GO:0004674]	NLPLELDFLNEGRNAEK	0.75375	0	0	0	8.70998	0	0	0	0	0	0	0	0
Q9C000	NLRP1_HUMAN	"NACHT, LRR and PYD domains-containing protein 1 (EC 3.4.-.-) (EC 3.6.4.-) (Caspase recruitment domain-containing protein 7) (Death effector filament-forming ced-4-like apoptosis protein) (Nucleotide-binding domain and caspase recruitment domain) [Cleaved into: NACHT, LRR and PYD domains-containing protein 1, C-terminus (NLRP1-CT); NACHT, LRR and PYD domains-containing protein 1, N-terminus (NLRP1-NT)]"	NLRP1 CARD7 DEFCAP KIAA0926 NAC NALP1	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; antiviral innate immune response [GO:0140374]; apoptotic process [GO:0006915]; defense response to bacterium [GO:0042742]; defense response to virus [GO:0051607]; inflammatory response [GO:0006954]; neuron apoptotic process [GO:0051402]; NLRP1 inflammasome complex assembly [GO:1904784]; pattern recognition receptor signaling pathway [GO:0002221]; positive regulation of inflammatory response [GO:0050729]; positive regulation of interleukin-1 beta production [GO:0032731]; protein homooligomerization [GO:0051260]; pyroptosis [GO:0070269]; regulation of apoptotic process [GO:0042981]; regulation of inflammatory response [GO:0050727]; response to muramyl dipeptide [GO:0032495]; self proteolysis [GO:0097264]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; inflammasome complex [GO:0061702]; NLRP1 inflammasome complex [GO:0072558]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cysteine-type endopeptidase activator activity [GO:0140608]; cysteine-type endopeptidase activator activity involved in apoptotic process [GO:0008656]; double-stranded DNA binding [GO:0003690]; double-stranded RNA binding [GO:0003725]; endopeptidase activity [GO:0004175]; enzyme binding [GO:0019899]; peptidase activity [GO:0008233]; protein domain specific binding [GO:0019904]; protein self-association [GO:0043621]	AGGAWGR	0.8125	8.70701	0	0	0	0	0	0	0	0	0	0	0
Q86V42	F124A_HUMAN	Protein FAM124A	FAM124A	Homo sapiens (Human)				HHHTEQVHGR	0.94595	0	8.70498	0	0	0	0	0	0	0	0	0	0
O15018	PDZD2_HUMAN	PDZ domain-containing protein 2 (Activated in prostate cancer protein) (PDZ domain-containing protein 3) [Cleaved into: Processed PDZ domain-containing protein 2]	PDZD2 AIPC KIAA0300 PDZK3	Homo sapiens (Human)	cell adhesion [GO:0007155]	cell-cell junction [GO:0005911]; centriolar satellite [GO:0034451]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; extracellular region [GO:0005576]; intracellular membrane-bounded organelle [GO:0043231]; nucleus [GO:0005634]; plasma membrane [GO:0005886]		VTVAGFQPGGAVEK	0.83596	8.7048	0	0	0	0	0	0	0	0	0	0	0
Q9UBW8	CSN7A_HUMAN	COP9 signalosome complex subunit 7a (SGN7a) (Signalosome subunit 7a) (Dermal papilla-derived protein 10) (JAB1-containing signalosome subunit 7a)	COPS7A CSN7A DERP10	Homo sapiens (Human)	COP9 signalosome assembly [GO:0010387]; protein deneddylation [GO:0000338]; protein neddylation [GO:0045116]; regulation of protein neddylation [GO:2000434]	COP9 signalosome [GO:0008180]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]		NLPPLTEAQKNKLR	0.9401	0	0	0	0	0	0	0	0	0	8.69905	0	0
Q6P2C8	MED27_HUMAN	Mediator of RNA polymerase II transcription subunit 27 (Cofactor required for Sp1 transcriptional activation subunit 8) (CRSP complex subunit 8) (Mediator complex subunit 27) (P37 TRAP/SMCC/PC2 subunit) (Transcriptional coactivator CRSP34)	MED27 CRSP34 CRSP8	Homo sapiens (Human)	positive regulation of transcription elongation by RNA polymerase II [GO:0032968]; positive regulation of transcription initiation by RNA polymerase II [GO:0060261]; regulation of transcription by RNA polymerase II [GO:0006357]; RNA polymerase II preinitiation complex assembly [GO:0051123]; somatic stem cell population maintenance [GO:0035019]; transcription initiation at RNA polymerase II promoter [GO:0006367]	core mediator complex [GO:0070847]; cytosol [GO:0005829]; mediator complex [GO:0016592]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; transcription regulator complex [GO:0005667]; ubiquitin ligase complex [GO:0000151]	transcription coactivator activity [GO:0003713]; ubiquitin protein ligase activity [GO:0061630]	DFRTLEAFHDTCR	1.0002	0	8.69631	0	0	0	0	0	0	0	0	0	0
Q8IVF7	FMNL3_HUMAN	Formin-like protein 3 (Formin homology 2 domain-containing protein 3) (WW domain-binding protein 3) (WBP-3)	FMNL3 FHOD3 FRL2 KIAA2014 WBP3	Homo sapiens (Human)	angiogenesis [GO:0001525]; cell migration [GO:0016477]; cortical actin cytoskeleton organization [GO:0030866]; cytoskeleton organization [GO:0007010]; regulation of cell shape [GO:0008360]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; plasma membrane [GO:0005886]	actin filament binding [GO:0051015]; GTPase activating protein binding [GO:0032794]; small GTPase binding [GO:0031267]	EFLNDENK	0.94635	0	0	0	0	0	0	8.69282	0	0	0	0	0
Q9C0I9	LRC27_HUMAN	Leucine-rich repeat-containing protein 27	LRRC27 KIAA1674	Homo sapiens (Human)				MWAVEHSLPR	0.93827	0	0	0	0	0	0	0	0	8.6923	0	0	0
Q9Y2F9	BTBD3_HUMAN	BTB/POZ domain-containing protein 3	BTBD3 KIAA0952	Homo sapiens (Human)	cerebral cortex development [GO:0021987]; dendrite morphogenesis [GO:0048813]; neurogenesis [GO:0022008]	cytosol [GO:0005829]; nucleus [GO:0005634]	identical protein binding [GO:0042802]	MAADIFPR	0.93743	0	8.69195	0	0	0	0	0	0	0	0	0	0
Q5VWN6	TASO2_HUMAN	Protein TASOR 2	TASOR2 C10orf18 FAM208B KIAA2006	Homo sapiens (Human)	"negative regulation of gene expression, epigenetic [GO:0045814]"	cytosol [GO:0005829]; nucleoplasm [GO:0005654]		CTGDFSPSPEKLVK	0.99902	8.69105	0	0	0	0	0	0	0	0	0	0	0
Q96ET8	TV23C_HUMAN	Golgi apparatus membrane protein TVP23 homolog C	TVP23C FAM18B2 Nbla10383	Homo sapiens (Human)	protein secretion [GO:0009306]; vesicle-mediated transport [GO:0016192]	integral component of Golgi membrane [GO:0030173]		CPGHPSRK	0.99711	0	0	0	0	0	0	0	8.68422	0	0	0	0
P01008	ANT3_HUMAN	Antithrombin-III (ATIII) (Serpin C1)	SERPINC1 AT3 PRO0309	Homo sapiens (Human)	"blood coagulation [GO:0007596]; negative regulation of endopeptidase activity [GO:0010951]; regulation of blood coagulation, intrinsic pathway [GO:2000266]"	blood microparticle [GO:0072562]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]	heparin binding [GO:0008201]; identical protein binding [GO:0042802]; protease binding [GO:0002020]; serine-type endopeptidase inhibitor activity [GO:0004867]	DIPMNPMCIYR	0	8.68166	0	0	0	0	0	0	0	0	0	0	0
P51795	CLCN5_HUMAN	H(+)/Cl(-) exchange transporter 5 (Chloride channel protein 5) (ClC-5) (Chloride transporter ClC-5)	CLCN5 CLCK2	Homo sapiens (Human)	chloride transport [GO:0006821]; endocytosis [GO:0006897]; ion transmembrane transport [GO:0034220]; renal system process [GO:0003014]	apical part of cell [GO:0045177]; cytosol [GO:0005829]; early endosome [GO:0005769]; endosome membrane [GO:0010008]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of plasma membrane [GO:0005887]; lysosomal membrane [GO:0005765]; membrane [GO:0016020]; plasma membrane [GO:0005886]; synaptic vesicle [GO:0008021]	antiporter activity [GO:0015297]; ATP binding [GO:0005524]; identical protein binding [GO:0042802]; solute:proton antiporter activity [GO:0015299]; voltage-gated chloride channel activity [GO:0005247]	EGIYDAHIR	0.93992	8.68046	0	0	0	0	0	0	0	0	0	0	0
Q8N5U6	RNF10_HUMAN	RING finger protein 10	RNF10 KIAA0262 RIE2	Homo sapiens (Human)	negative regulation of Schwann cell proliferation [GO:0010626]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of myelination [GO:0031643]; positive regulation of transcription by RNA polymerase II [GO:0045944]; postsynapse to nucleus signaling pathway [GO:0099527]; protein autoubiquitination [GO:0051865]	cytoplasm [GO:0005737]; extrinsic component of postsynaptic density membrane [GO:0099147]; glutamatergic synapse [GO:0098978]; nucleus [GO:0005634]	metal ion binding [GO:0046872]; transcription cis-regulatory region binding [GO:0000976]; ubiquitin protein ligase activity [GO:0061630]	RDEVAEAQR	0.99878	8.68046	0	0	0	0	0	0	0	0	0	0	0
P57058	HUNK_HUMAN	Hormonally up-regulated neu tumor-associated kinase (EC 2.7.11.1) (B19) (Serine/threonine-protein kinase MAK-V)	HUNK MAKV	Homo sapiens (Human)	intracellular signal transduction [GO:0035556]; protein phosphorylation [GO:0006468]; signal transduction [GO:0007165]		ATP binding [GO:0005524]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]	ESYEASLDTWTR	0.99904	0	8.67782	0	0	0	0	0	0	0	0	0	0
Q9Y210	TRPC6_HUMAN	Short transient receptor potential channel 6 (TrpC6) (Transient receptor protein 6) (TRP-6)	TRPC6 TRP6	Homo sapiens (Human)	calcium ion transmembrane transport [GO:0070588]; cation transport [GO:0006812]; manganese ion transport [GO:0006828]; positive regulation of calcium ion transport [GO:0051928]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of ion transmembrane transporter activity [GO:0032414]; regulation of cytosolic calcium ion concentration [GO:0051480]; single fertilization [GO:0007338]	cation channel complex [GO:0034703]; cytoplasm [GO:0005737]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; plasma membrane [GO:0005886]; slit diaphragm [GO:0036057]	"calcium channel activity [GO:0005262]; cation channel activity [GO:0005261]; inositol 1,4,5 trisphosphate binding [GO:0070679]; protein homodimerization activity [GO:0042803]; store-operated calcium channel activity [GO:0015279]"	CNDCNQKQK	0.99838	0	8.6685	0	0	0	0	0	0	0	0	0	0
Q92934	BAD_HUMAN	Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-2-like protein 8) (Bcl2-L-8) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)	BAD BBC6 BCL2L8	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity [GO:0097202]; activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; ADP metabolic process [GO:0046031]; apoptotic process [GO:0006915]; ATP metabolic process [GO:0046034]; cellular response to chromate [GO:0071247]; cellular response to hypoxia [GO:0071456]; cellular response to lipid [GO:0071396]; cellular response to mechanical stimulus [GO:0071260]; cellular response to nicotine [GO:0071316]; cerebral cortex development [GO:0021987]; cytokine-mediated signaling pathway [GO:0019221]; extrinsic apoptotic signaling pathway [GO:0097191]; extrinsic apoptotic signaling pathway in absence of ligand [GO:0097192]; extrinsic apoptotic signaling pathway via death domain receptors [GO:0008625]; glucose catabolic process [GO:0006007]; glucose homeostasis [GO:0042593]; intrinsic apoptotic signaling pathway [GO:0097193]; intrinsic apoptotic signaling pathway in response to DNA damage [GO:0008630]; pore complex assembly [GO:0046931]; positive regulation of apoptotic process [GO:0043065]; positive regulation of autophagy [GO:0010508]; positive regulation of B cell differentiation [GO:0045579]; positive regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043280]; positive regulation of epithelial cell proliferation [GO:0050679]; positive regulation of glucokinase activity [GO:0033133]; positive regulation of granulosa cell apoptotic process [GO:1904710]; positive regulation of insulin secretion [GO:0032024]; positive regulation of insulin secretion involved in cellular response to glucose stimulus [GO:0035774]; positive regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [GO:1902220]; positive regulation of mitochondrial membrane potential [GO:0010918]; positive regulation of neuron death [GO:1901216]; positive regulation of proteolysis [GO:0045862]; positive regulation of release of cytochrome c from mitochondria [GO:0090200]; positive regulation of T cell differentiation [GO:0045582]; positive regulation of type B pancreatic cell development [GO:2000078]; regulation of mitochondrial membrane permeability [GO:0046902]; release of cytochrome c from mitochondria [GO:0001836]; response to amino acid [GO:0043200]; response to benzene [GO:1901423]; response to calcium ion [GO:0051592]; response to estradiol [GO:0032355]; response to ethanol [GO:0045471]; response to glucocorticoid [GO:0051384]; response to glucose [GO:0009749]; response to hydrogen peroxide [GO:0042542]; response to oleic acid [GO:0034201]; response to progesterone [GO:0032570]; response to testosterone [GO:0033574]; response to xenobiotic stimulus [GO:0009410]; spermatogenesis [GO:0007283]; type B pancreatic cell proliferation [GO:0044342]	cytosol [GO:0005829]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]	14-3-3 protein binding [GO:0071889]; cysteine-type endopeptidase activator activity involved in apoptotic process [GO:0008656]; lipid binding [GO:0008289]; phospholipid binding [GO:0005543]; protein kinase B binding [GO:0043422]; protein kinase binding [GO:0019901]; protein phosphatase 2B binding [GO:0030346]; protein phosphatase binding [GO:0019903]	NLGRGSSAPSQ	0.99821	0	0	8.66388	0	0	0	0	0	0	0	0	0
P11086	PNMT_HUMAN	Phenylethanolamine N-methyltransferase (PNMTase) (EC 2.1.1.28) (Noradrenaline N-methyltransferase)	PNMT PENT	Homo sapiens (Human)	catecholamine biosynthetic process [GO:0042423]; epinephrine biosynthetic process [GO:0042418]; methylation [GO:0032259]	cytosol [GO:0005829]	N-methyltransferase activity [GO:0008170]; phenylethanolamine N-methyltransferase activity [GO:0004603]	GVFFAWAQK	0.94407	8.66295	0	0	0	0	0	0	0	0	0	0	0
Q96RU3	FNBP1_HUMAN	Formin-binding protein 1 (Formin-binding protein 17) (hFBP17)	FNBP1 FBP17 KIAA0554	Homo sapiens (Human)	endocytosis [GO:0006897]; signal transduction [GO:0007165]	cell cortex [GO:0005938]; clathrin-coated pit [GO:0005905]; cytoplasmic vesicle [GO:0031410]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; intracellular membrane-bounded organelle [GO:0043231]; lysosome [GO:0005764]; plasma membrane [GO:0005886]	identical protein binding [GO:0042802]; lipid binding [GO:0008289]	GDGWTRIRR	0.9352	8.66295	0	0	0	0	0	0	0	0	0	0	0
O95714	HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 (EC 2.3.2.26) (HECT domain and RCC1-like domain-containing protein 2) (HECT-type E3 ubiquitin transferase HERC2)	HERC2	Homo sapiens (Human)	cellular response to DNA damage stimulus [GO:0006974]; DNA repair [GO:0006281]; intracellular protein transport [GO:0006886]; proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161]; protein ubiquitination [GO:0016567]; spermatogenesis [GO:0007283]	centriole [GO:0005814]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	guanyl-nucleotide exchange factor activity [GO:0005085]; SUMO binding [GO:0032183]; ubiquitin protein ligase activity [GO:0061630]; ubiquitin protein ligase binding [GO:0031625]; zinc ion binding [GO:0008270]	LAASLAACAQLSALAASHR	0.99781	0	0	0	0	0	8.66196	0	0	0	0	0	0
Q86XA9	HTR5A_HUMAN	HEAT repeat-containing protein 5A	HEATR5A C14orf125 KIAA1316	Homo sapiens (Human)	"endocytosis [GO:0006897]; protein localization [GO:0008104]; retrograde transport, endosome to Golgi [GO:0042147]"	cytosol [GO:0005829]; endocytic vesicle [GO:0030139]		CVFPASPK	0.9984	0	0	0	0	0	0	0	0	0	0	8.65871	0
Q5JPE7	NOMO2_HUMAN	Nodal modulator 2 (pM5 protein 2)	NOMO2	Homo sapiens (Human)		endoplasmic reticulum membrane [GO:0005789]; integral component of membrane [GO:0016021]; protein-containing complex [GO:0032991]	carbohydrate binding [GO:0030246]; ribosome binding [GO:0043022]	GVNRFCLSKPGVYK	0.45856	0	0	0	0	0	0	0	0	0	0	0	8.65456
Q8TF40	FNIP1_HUMAN	Folliculin-interacting protein 1	FNIP1 KIAA1961	Homo sapiens (Human)	B cell apoptotic process [GO:0001783]; cellular response to starvation [GO:0009267]; immature B cell differentiation [GO:0002327]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0043154]; negative regulation of TOR signaling [GO:0032007]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of B cell apoptotic process [GO:0002904]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein-containing complex assembly [GO:0031334]; positive regulation of TOR signaling [GO:0032008]; regulation of pro-B cell differentiation [GO:2000973]; regulation of protein phosphorylation [GO:0001932]; TOR signaling [GO:0031929]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; lysosomal membrane [GO:0005765]	ATPase inhibitor activity [GO:0042030]; chaperone binding [GO:0051087]; enzyme binding [GO:0019899]; guanyl-nucleotide exchange factor activity [GO:0005085]	APTLFQKLFSK	1.0002	0	0	0	0	8.65015	0	0	0	0	0	0	0
Q14151	SAFB2_HUMAN	Scaffold attachment factor B2 (SAF-B2)	SAFB2 KIAA0138	Homo sapiens (Human)	regulation of androgen receptor signaling pathway [GO:0060765]; regulation of mRNA processing [GO:0050684]; regulation of transcription by RNA polymerase II [GO:0006357]; Sertoli cell differentiation [GO:0060008]	cytoplasm [GO:0005737]; extracellular exosome [GO:0070062]; intracellular membrane-bounded organelle [GO:0043231]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	identical protein binding [GO:0042802]; RNA binding [GO:0003723]; sequence-specific DNA binding [GO:0043565]	VGSGSGR	0.8371	0	0	0	0	0	8.64248	0	0	0	0	0	0
Q96JI7	SPTCS_HUMAN	Spatacsin (Colorectal carcinoma-associated protein) (Spastic paraplegia 11 protein)	SPG11 KIAA1840	Homo sapiens (Human)	autophagosome organization [GO:1905037]; axo-dendritic transport [GO:0008088]; axon extension [GO:0048675]; chemical synaptic transmission [GO:0007268]; cholesterol efflux [GO:0033344]; corticospinal tract morphogenesis [GO:0021957]; localization within membrane [GO:0051668]; lysosome organization [GO:0007040]; memory [GO:0007613]; motor behavior [GO:0061744]; motor neuron apoptotic process [GO:0097049]; neuromuscular junction development [GO:0007528]; phagosome-lysosome fusion involved in apoptotic cell clearance [GO:0090389]; protein import into nucleus [GO:0006606]; regulation of store-operated calcium entry [GO:2001256]; skeletal muscle fiber development [GO:0048741]; synaptic vesicle transport [GO:0048489]; walking behavior [GO:0090659]	axon [GO:0030424]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; dendrite [GO:0030425]; lysosomal membrane [GO:0005765]; nucleolus [GO:0005730]; plasma membrane [GO:0005886]; synapse [GO:0045202]	protein kinase binding [GO:0019901]	LSPENCPFLEK	0.57563	0	0	0	0	0	0	0	0	0	8.63981	0	0
Q9P217	ZSWM5_HUMAN	Zinc finger SWIM domain-containing protein 5	ZSWIM5 KIAA1511	Homo sapiens (Human)		Cul2-RING ubiquitin ligase complex [GO:0031462]; extracellular space [GO:0005615]	zinc ion binding [GO:0008270]	EQVKLFLSQGGYCGSGK	0.86816	0	8.63865	0	0	0	0	0	0	0	0	0	0
O95630	STABP_HUMAN	STAM-binding protein (EC 3.4.19.-) (Associated molecule with the SH3 domain of STAM) (Endosome-associated ubiquitin isopeptidase)	STAMBP AMSH	Homo sapiens (Human)	hippocampal neuron apoptotic process [GO:0110088]; mitotic cytokinesis [GO:0000281]; negative regulation of hippocampal neuron apoptotic process [GO:0110091]; negative regulation of phosphatidylinositol 3-kinase signaling [GO:0014067]; negative regulation of Ras protein signal transduction [GO:0046580]; positive regulation of cell population proliferation [GO:0008284]; protein deubiquitination [GO:0016579]; protein K63-linked deubiquitination [GO:0070536]; receptor signaling pathway via JAK-STAT [GO:0007259]	cleavage furrow [GO:0032154]; cytosol [GO:0005829]; early endosome [GO:0005769]; endosome [GO:0005768]; extracellular exosome [GO:0070062]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	deubiquitinase activity [GO:0101005]; Lys63-specific deubiquitinase activity [GO:0061578]; metal ion binding [GO:0046872]; metal-dependent deubiquitinase activity [GO:0140492]; protein domain specific binding [GO:0019904]	GFHPHSK	0.9113	0	0	8.63572	0	0	0	0	0	0	0	0	0
Q01484	ANK2_HUMAN	Ankyrin-2 (ANK-2) (Ankyrin-B) (Brain ankyrin) (Non-erythroid ankyrin)	ANK2 ANKB	Homo sapiens (Human)	atrial cardiac muscle cell action potential [GO:0086014]; atrial cardiac muscle cell to AV node cell communication [GO:0086066]; atrial septum development [GO:0003283]; cellular calcium ion homeostasis [GO:0006874]; endocytosis [GO:0006897]; membrane depolarization during SA node cell action potential [GO:0086046]; paranodal junction assembly [GO:0030913]; positive regulation of calcium ion transmembrane transporter activity [GO:1901021]; positive regulation of calcium ion transport [GO:0051928]; positive regulation of cation channel activity [GO:2001259]; positive regulation of gene expression [GO:0010628]; positive regulation of potassium ion transmembrane transporter activity [GO:1901018]; positive regulation of potassium ion transport [GO:0043268]; protein localization [GO:0008104]; protein localization to cell surface [GO:0034394]; protein localization to endoplasmic reticulum [GO:0070972]; protein localization to M-band [GO:0036309]; protein localization to organelle [GO:0033365]; protein localization to plasma membrane [GO:0072659]; protein localization to T-tubule [GO:0036371]; protein stabilization [GO:0050821]; protein transport [GO:0015031]; regulation of atrial cardiac muscle cell action potential [GO:0098910]; regulation of calcium ion transmembrane transporter activity [GO:1901019]; regulation of calcium ion transport [GO:0051924]; regulation of cardiac muscle cell contraction [GO:0086004]; regulation of cardiac muscle contraction [GO:0055117]; regulation of cardiac muscle contraction by calcium ion signaling [GO:0010882]; regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion [GO:0010881]; regulation of heart rate [GO:0002027]; regulation of heart rate by cardiac conduction [GO:0086091]; regulation of protein stability [GO:0031647]; regulation of release of sequestered calcium ion into cytosol [GO:0051279]; regulation of SA node cell action potential [GO:0098907]; regulation of ventricular cardiac muscle cell membrane repolarization [GO:0060307]; response to methylmercury [GO:0051597]; SA node cell action potential [GO:0086015]; SA node cell to atrial cardiac muscle cell communication [GO:0086070]; sarcoplasmic reticulum calcium ion transport [GO:0070296]; T-tubule organization [GO:0033292]; ventricular cardiac muscle cell action potential [GO:0086005]	A band [GO:0031672]; apical plasma membrane [GO:0016324]; basolateral plasma membrane [GO:0016323]; costamere [GO:0043034]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; early endosome [GO:0005769]; intercalated disc [GO:0014704]; lysosome [GO:0005764]; M band [GO:0031430]; membrane raft [GO:0045121]; mitochondrion [GO:0005739]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]; postsynaptic membrane [GO:0045211]; recycling endosome [GO:0055037]; sarcolemma [GO:0042383]; T-tubule [GO:0030315]; Z disc [GO:0030018]	ATPase binding [GO:0051117]; cytoskeletal anchor activity [GO:0008093]; enzyme binding [GO:0019899]; phosphorylation-dependent protein binding [GO:0140031]; protein kinase binding [GO:0019901]; protein-macromolecule adaptor activity [GO:0030674]; spectrin binding [GO:0030507]; structural constituent of cytoskeleton [GO:0005200]; transmembrane transporter binding [GO:0044325]	EQVQQDFSGK	0.89941	8.62957	0	0	0	0	0	0	0	0	0	0	0
Q01954	BNC1_HUMAN	Zinc finger protein basonuclin-1	BNC1 BNC	Homo sapiens (Human)	cell differentiation [GO:0030154]; epidermis development [GO:0008544]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of oocyte maturation [GO:1900195]; positive regulation of transcription by RNA polymerase I [GO:0045943]; regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase I [GO:0006356]; spermatogenesis [GO:0007283]	cytoplasm [GO:0005737]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	DNA-binding transcription activator activity [GO:0001216]; metal ion binding [GO:0046872]; rDNA binding [GO:0000182]	EEQSIIIPPSTANVDIR	0.38298	8.62856	0	0	0	0	0	0	0	0	0	0	0
P50150	GBG4_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4	GNG4 GNGT4	Homo sapiens (Human)	G protein-coupled receptor signaling pathway [GO:0007186]; negative regulation of cell growth [GO:0030308]; regulation of G protein-coupled receptor signaling pathway [GO:0008277]	extracellular exosome [GO:0070062]; heterotrimeric G-protein complex [GO:0005834]; plasma membrane [GO:0005886]	G-protein beta-subunit binding [GO:0031681]	EGMSNNSTTSISQARK	0.875	0	0	0	8.62183	0	0	0	0	0	0	0	0
Q9ULL0	K1210_HUMAN	Acrosomal protein KIAA1210	KIAA1210	Homo sapiens (Human)		acrosomal vesicle [GO:0001669]		CKFKALK	0.94106	0	0	0	0	0	0	0	0	0	0	0	8.61842
O60674	JAK2_HUMAN	Tyrosine-protein kinase JAK2 (EC 2.7.10.2) (Janus kinase 2) (JAK-2)	JAK2	Homo sapiens (Human)	actin filament polymerization [GO:0030041]; activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway [GO:0097296]; activation of Janus kinase activity [GO:0042976]; adaptive immune response [GO:0002250]; apoptotic process [GO:0006915]; axon regeneration [GO:0031103]; cell differentiation [GO:0030154]; cellular response to dexamethasone stimulus [GO:0071549]; cellular response to interleukin-3 [GO:0036016]; cellular response to lipopolysaccharide [GO:0071222]; cellular response to virus [GO:0098586]; chromatin organization [GO:0006325]; collagen-activated signaling pathway [GO:0038065]; cytokine-mediated signaling pathway [GO:0019221]; enzyme-linked receptor protein signaling pathway [GO:0007167]; erythrocyte differentiation [GO:0030218]; extrinsic apoptotic signaling pathway [GO:0097191]; G protein-coupled receptor signaling pathway [GO:0007186]; granulocyte-macrophage colony-stimulating factor signaling pathway [GO:0038157]; growth hormone receptor signaling pathway [GO:0060396]; growth hormone receptor signaling pathway via JAK-STAT [GO:0060397]; immune response [GO:0006955]; interferon-gamma-mediated signaling pathway [GO:0060333]; interleukin-12-mediated signaling pathway [GO:0035722]; interleukin-35-mediated signaling pathway [GO:0070757]; interleukin-6-mediated signaling pathway [GO:0070102]; intracellular signal transduction [GO:0035556]; intrinsic apoptotic signaling pathway in response to oxidative stress [GO:0008631]; mammary gland epithelium development [GO:0061180]; mesoderm development [GO:0007498]; microglial cell activation [GO:0001774]; mineralocorticoid receptor signaling pathway [GO:0031959]; modulation of chemical synaptic transmission [GO:0050804]; negative regulation of cardiac muscle cell apoptotic process [GO:0010667]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of cell-cell adhesion [GO:0022408]; negative regulation of DNA binding [GO:0043392]; negative regulation of heart contraction [GO:0045822]; negative regulation of neuron apoptotic process [GO:0043524]; peptidyl-tyrosine phosphorylation [GO:0018108]; platelet-derived growth factor receptor signaling pathway [GO:0048008]; positive regulation of apoptotic signaling pathway [GO:2001235]; positive regulation of cell differentiation [GO:0045597]; positive regulation of cell migration [GO:0030335]; positive regulation of cell-substrate adhesion [GO:0010811]; positive regulation of cold-induced thermogenesis [GO:0120162]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of DNA binding [GO:0043388]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of epithelial cell apoptotic process [GO:1904037]; positive regulation of growth factor dependent skeletal muscle satellite cell proliferation [GO:1902728]; positive regulation of growth hormone receptor signaling pathway [GO:0060399]; positive regulation of inflammatory response [GO:0050729]; positive regulation of insulin secretion [GO:0032024]; positive regulation of interferon-gamma production [GO:0032729]; positive regulation of interleukin-1 beta production [GO:0032731]; positive regulation of interleukin-17 production [GO:0032740]; positive regulation of leukocyte proliferation [GO:0070665]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of MHC class II biosynthetic process [GO:0045348]; positive regulation of natural killer cell proliferation [GO:0032819]; positive regulation of nitric oxide biosynthetic process [GO:0045429]; positive regulation of nitric-oxide synthase biosynthetic process [GO:0051770]; positive regulation of NK T cell proliferation [GO:0051142]; positive regulation of peptidyl-tyrosine phosphorylation [GO:0050731]; positive regulation of phosphatidylinositol 3-kinase signaling [GO:0014068]; positive regulation of phosphoprotein phosphatase activity [GO:0032516]; positive regulation of platelet activation [GO:0010572]; positive regulation of platelet aggregation [GO:1901731]; positive regulation of protein import into nucleus [GO:0042307]; positive regulation of receptor signaling pathway via JAK-STAT [GO:0046427]; positive regulation of signaling receptor activity [GO:2000273]; positive regulation of SMAD protein signal transduction [GO:0060391]; positive regulation of T cell proliferation [GO:0042102]; positive regulation of T-helper 17 type immune response [GO:2000318]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of tyrosine phosphorylation of STAT protein [GO:0042531]; positive regulation of vascular associated smooth muscle cell proliferation [GO:1904707]; post-embryonic hemopoiesis [GO:0035166]; post-translational protein modification [GO:0043687]; postsynapse to nucleus signaling pathway [GO:0099527]; programmed cell death induced by symbiont [GO:0034050]; protein autophosphorylation [GO:0046777]; protein phosphorylation [GO:0006468]; receptor signaling pathway via JAK-STAT [GO:0007259]; regulation of apoptotic process [GO:0042981]; regulation of inflammatory response [GO:0050727]; regulation of nitric oxide biosynthetic process [GO:0045428]; regulation of receptor signaling pathway via JAK-STAT [GO:0046425]; response to amine [GO:0014075]; response to antibiotic [GO:0046677]; response to hydroperoxide [GO:0033194]; response to interleukin-12 [GO:0070671]; response to lipopolysaccharide [GO:0032496]; response to tumor necrosis factor [GO:0034612]; signal transduction [GO:0007165]; transcription by RNA polymerase II [GO:0006366]; tumor necrosis factor-mediated signaling pathway [GO:0033209]; tyrosine phosphorylation of STAT protein [GO:0007260]	caveola [GO:0005901]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; endosome lumen [GO:0031904]; euchromatin [GO:0000791]; focal adhesion [GO:0005925]; glutamatergic synapse [GO:0098978]; granulocyte macrophage colony-stimulating factor receptor complex [GO:0030526]; interleukin-12 receptor complex [GO:0042022]; interleukin-23 receptor complex [GO:0072536]; membrane raft [GO:0045121]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; postsynapse [GO:0098794]	acetylcholine receptor binding [GO:0033130]; ATP binding [GO:0005524]; cytokine receptor binding [GO:0005126]; growth hormone receptor binding [GO:0005131]; heme binding [GO:0020037]; histone binding [GO:0042393]; histone kinase activity (H3-Y41 specific) [GO:0035401]; identical protein binding [GO:0042802]; insulin receptor substrate binding [GO:0043560]; interleukin-12 receptor binding [GO:0005143]; metal ion binding [GO:0046872]; non-membrane spanning protein tyrosine kinase activity [GO:0004715]; peptide hormone receptor binding [GO:0051428]; phosphatidylinositol 3-kinase binding [GO:0043548]; protein C-terminus binding [GO:0008022]; protein kinase activity [GO:0004672]; protein kinase binding [GO:0019901]; protein tyrosine kinase activity [GO:0004713]; SH2 domain binding [GO:0042169]; signaling receptor binding [GO:0005102]; type 1 angiotensin receptor binding [GO:0031702]	ENDQTPLAIYNSISYK	0.67	0	0	0	0	0	0	0	0	8.60811	0	0	0
Q49A26	GLYR1_HUMAN	Cytokine-like nuclear factor N-PAC (NPAC) (3-hydroxyisobutyrate dehydrogenase-like protein) (Glyoxylate reductase 1 homolog) (Nuclear protein NP60) (Nuclear protein of 60 kDa) (Nucleosome-destabilizing factor) (hNDF) (Putative oxidoreductase GLYR1)	GLYR1 HIBDL NDF NP60 NPAC	Homo sapiens (Human)	positive regulation of histone acetylation [GO:0035066]; positive regulation of transcription by RNA polymerase II [GO:0045944]	cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleosome [GO:0000786]	chromatin binding [GO:0003682]; DNA binding [GO:0003677]; histone binding [GO:0042393]; methylated histone binding [GO:0035064]; NAD binding [GO:0051287]; NADP binding [GO:0050661]; nucleosome binding [GO:0031491]; oxidoreductase activity [GO:0016491]	RKLSLSEGK	0.95776	0	0	0	0	0	0	0	8.60192	0	0	0	0
Q86TG7	PEG10_HUMAN	Retrotransposon-derived protein PEG10 (Embryonal carcinoma differentiation-regulated protein) (Mammalian retrotransposon-derived protein 2) (Myelin expression factor 3-like protein 1) (MEF3-like protein 1) (Paternally expressed gene 10 protein) (Retrotransposon gag domain-containing protein 3) (Retrotransposon-derived gag-like polyprotein) (Ty3/Gypsy-like protein)	PEG10 EDR KIAA1051e MAR2 MART2 MEF3L1 RGAG3	Homo sapiens (Human)	apoptotic process [GO:0006915]; cell differentiation [GO:0030154]; mRNA transport [GO:0051028]; negative regulation of transforming growth factor beta receptor signaling pathway [GO:0030512]; protein homooligomerization [GO:0051260]; vesicle-mediated intercellular transport [GO:0110077]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular vesicle [GO:1903561]; membrane [GO:0016020]; nucleoplasm [GO:0005654]	DNA binding [GO:0003677]; mRNA binding [GO:0003729]; RNA binding [GO:0003723]; zinc ion binding [GO:0008270]	SIVFDSEYCR	0.99805	0	8.59612	0	0	0	0	0	0	0	0	0	0
Q4KMQ2	ANO6_HUMAN	Anoctamin-6 (Small-conductance calcium-activated nonselective cation channel) (SCAN channel) (Transmembrane protein 16F)	ANO6 TMEM16F	Homo sapiens (Human)	"activation of blood coagulation via clotting cascade [GO:0002543]; bleb assembly [GO:0032060]; blood coagulation [GO:0007596]; calcium activated phosphatidylcholine scrambling [GO:0061590]; calcium activated phosphatidylserine scrambling [GO:0061589]; calcium ion transmembrane transport [GO:0070588]; cation transport [GO:0006812]; chloride transmembrane transport [GO:1902476]; chloride transport [GO:0006821]; dendritic cell chemotaxis [GO:0002407]; ion transmembrane transport [GO:0034220]; negative regulation of cell volume [GO:0045794]; phosphatidylserine exposure on blood platelet [GO:0097045]; plasma membrane phospholipid scrambling [GO:0017121]; pore complex assembly [GO:0046931]; positive regulation of apoptotic process [GO:0043065]; positive regulation of bone mineralization [GO:0030501]; positive regulation of endothelial cell apoptotic process [GO:2000353]; positive regulation of ion transmembrane transport [GO:0034767]; positive regulation of monocyte chemotaxis [GO:0090026]; positive regulation of phagocytosis, engulfment [GO:0060100]; positive regulation of potassium ion export across plasma membrane [GO:1903766]; purinergic nucleotide receptor signaling pathway [GO:0035590]; sodium ion transmembrane transport [GO:0035725]; transmembrane transport [GO:0055085]"	cell surface [GO:0009986]; chloride channel complex [GO:0034707]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; membrane [GO:0016020]; plasma membrane [GO:0005886]; specific granule membrane [GO:0035579]; tertiary granule membrane [GO:0070821]	calcium activated cation channel activity [GO:0005227]; chloride channel activity [GO:0005254]; intracellular calcium activated chloride channel activity [GO:0005229]; metal ion binding [GO:0046872]; phospholipid scramblase activity [GO:0017128]; protein dimerization activity [GO:0046983]; voltage-gated chloride channel activity [GO:0005247]; voltage-gated ion channel activity [GO:0005244]	ETNKKGTNEK	0.92121	0	0	0	8.59018	0	0	0	0	0	0	0	0
Q9BQG0	MBB1A_HUMAN	Myb-binding protein 1A	MYBBP1A P160	Homo sapiens (Human)	cellular response to glucose starvation [GO:0042149]; chromatin remodeling [GO:0006338]; circadian regulation of gene expression [GO:0032922]; intrinsic apoptotic signaling pathway by p53 class mediator [GO:0072332]; negative regulation of DNA-templated transcription [GO:0045892]; osteoblast differentiation [GO:0001649]; positive regulation of anoikis [GO:2000210]; positive regulation of histone acetylation [GO:0035066]; positive regulation of transcription by RNA polymerase I [GO:0045943]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of transcription by RNA polymerase III [GO:0045945]; regulation of DNA-templated transcription [GO:0006355]; regulation of G1 to G0 transition [GO:1903450]; respiratory electron transport chain [GO:0022904]; ribosome biogenesis [GO:0042254]	B-WICH complex [GO:0110016]; cytoplasm [GO:0005737]; intracellular membrane-bounded organelle [GO:0043231]; membrane [GO:0016020]; NLS-dependent protein nuclear import complex [GO:0042564]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	E-box binding [GO:0070888]; RNA binding [GO:0003723]; sequence-specific DNA binding [GO:0043565]; transcription corepressor activity [GO:0003714]	DQEALMKSVK	1.0002	0	0	0	8.59018	0	0	0	0	0	0	0	0
Q9H8L6	MMRN2_HUMAN	Multimerin-2 (EMILIN-3) (Elastin microfibril interface located protein 3) (Elastin microfibril interfacer 3) (EndoGlyx-1 p125/p140 subunit)	MMRN2 EMILIN3	Homo sapiens (Human)	cell adhesion [GO:0007155]; cell migration involved in sprouting angiogenesis [GO:0002042]; negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis [GO:1903588]; negative regulation of cell migration [GO:0030336]; negative regulation of cell migration involved in sprouting angiogenesis [GO:0090051]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of vascular endothelial growth factor receptor signaling pathway [GO:0030948]; positive regulation of defense response to bacterium [GO:1900426]; positive regulation of epithelial tube formation [GO:1905278]; positive regulation of morphogenesis of an epithelium [GO:1905332]	basement membrane [GO:0005604]; collagen-containing extracellular matrix [GO:0062023]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]		NWCPYPMSKLVTLLALCK	0.874	0	0	0	0	0	0	8.5835	0	0	0	0	0
Q13136	LIPA1_HUMAN	Liprin-alpha-1 (LAR-interacting protein 1) (LIP-1) (Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1) (PTPRF-interacting protein alpha-1)	PPFIA1 LIP1	Homo sapiens (Human)	cell-matrix adhesion [GO:0007160]; negative regulation of protein localization to plasma membrane [GO:1903077]; negative regulation of stress fiber assembly [GO:0051497]; signal transduction [GO:0007165]; synapse organization [GO:0050808]	axon [GO:0030424]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; dendrite [GO:0030425]; focal adhesion [GO:0005925]; presynaptic active zone [GO:0048786]; protein-containing complex [GO:0032991]		LQKKHELLEEAR	0.99877	0	0	0	0	0	0	0	0	0	8.57849	0	0
P49619	DGKG_HUMAN	Diacylglycerol kinase gamma (DAG kinase gamma) (EC 2.7.1.107) (Diglyceride kinase gamma) (DGK-gamma)	DGKG DAGK3	Homo sapiens (Human)	diacylglycerol metabolic process [GO:0046339]; glycerolipid metabolic process [GO:0046486]; intracellular signal transduction [GO:0035556]; lipid phosphorylation [GO:0046834]; negative regulation of protein kinase C signaling [GO:0090038]; neuron development [GO:0048666]; phosphatidic acid biosynthetic process [GO:0006654]; platelet activation [GO:0030168]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]; regulation of dendrite development [GO:0050773]	cytoskeleton [GO:0005856]; cytosol [GO:0005829]; membrane [GO:0016020]; plasma membrane [GO:0005886]	ATP binding [GO:0005524]; calcium ion binding [GO:0005509]; diacylglycerol kinase activity [GO:0004143]; lipid binding [GO:0008289]	ESRKGVTDPK	0.94717	0	0	8.57686	0	0	0	0	0	0	0	0	0
Q9H3Y8	PPDPF_HUMAN	Pancreatic progenitor cell differentiation and proliferation factor (Exocrine differentiation and proliferation factor)	PPDPF C20orf149 EXPDF	Homo sapiens (Human)	cell differentiation [GO:0030154]			DAPRKQPGGQSSTASAGPPS	0.86227	0	0	0	0	0	0	0	0	0	0	0	8.56094
Q9UQ26	RIMS2_HUMAN	Regulating synaptic membrane exocytosis protein 2 (Rab-3-interacting molecule 2) (RIM 2) (Rab-3-interacting protein 3)	RIMS2 KIAA0751 RAB3IP3 RIM2	Homo sapiens (Human)	adenylate cyclase-modulating G protein-coupled receptor signaling pathway [GO:0007188]; calcium ion-regulated exocytosis of neurotransmitter [GO:0048791]; calcium-ion regulated exocytosis [GO:0017156]; cell differentiation [GO:0030154]; insulin secretion [GO:0030073]; intracellular protein transport [GO:0006886]; positive regulation of dendrite extension [GO:1903861]; positive regulation of excitatory postsynaptic potential [GO:2000463]; positive regulation of inhibitory postsynaptic potential [GO:0097151]; positive regulation of synaptic transmission [GO:0050806]; regulation of exocytosis [GO:0017157]; regulation of membrane potential [GO:0042391]; regulation of synaptic plasticity [GO:0048167]; spontaneous neurotransmitter secretion [GO:0061669]	anchoring junction [GO:0070161]; cell projection [GO:0042995]; cytoskeleton of presynaptic active zone [GO:0048788]; extracellular exosome [GO:0070062]; presynaptic active zone [GO:0048786]; presynaptic membrane [GO:0042734]	metal ion binding [GO:0046872]; small GTPase binding [GO:0031267]; transmembrane transporter binding [GO:0044325]	QRSISERR	0.94115	0	0	0	0	0	0	8.56033	0	0	0	0	0
Q9H4L7	SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 (EC 3.6.4.12) (ATP-dependent helicase 1) (hHEL1)	SMARCAD1 KIAA1122	Homo sapiens (Human)	chromatin remodeling [GO:0006338]; chromosome separation [GO:0051304]; DNA double-strand break processing [GO:0000729]; histone H3 deacetylation [GO:0070932]; histone H4 deacetylation [GO:0070933]; regulation of DNA recombination [GO:0000018]	heterochromatin [GO:0000792]; nuclear replication fork [GO:0043596]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; site of double-strand break [GO:0035861]	"ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; ATP-dependent activity, acting on DNA [GO:0008094]; ATP-dependent chromatin remodeler activity [GO:0140658]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; ubiquitin binding [GO:0043130]"	MANHPLLHRQYYTAEK	0.87529	0	0	0	0	0	8.55773	0	0	0	0	0	0
Q01955	CO4A3_HUMAN	Collagen alpha-3(IV) chain (Goodpasture antigen) [Cleaved into: Tumstatin]	COL4A3	Homo sapiens (Human)	activation of cysteine-type endopeptidase activity involved in apoptotic process [GO:0006919]; blood circulation [GO:0008015]; cell adhesion [GO:0007155]; cell surface receptor signaling pathway [GO:0007166]; collagen-activated tyrosine kinase receptor signaling pathway [GO:0038063]; endothelial cell apoptotic process [GO:0072577]; extracellular matrix organization [GO:0030198]; glomerular basement membrane development [GO:0032836]; negative regulation of angiogenesis [GO:0016525]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of vascular endothelial cell proliferation [GO:1905563]; response to glucose [GO:0009749]; sensory perception of sound [GO:0007605]	basement membrane [GO:0005604]; collagen type IV trimer [GO:0005587]; collagen-containing extracellular matrix [GO:0062023]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum lumen [GO:0005788]; extracellular matrix [GO:0031012]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; intracellular membrane-bounded organelle [GO:0043231]	extracellular matrix structural constituent [GO:0005201]; extracellular matrix structural constituent conferring tensile strength [GO:0030020]; integrin binding [GO:0005178]; metalloendopeptidase inhibitor activity [GO:0008191]; structural molecule activity [GO:0005198]	GKPGKDGKPGTPGPAGEK	0.86136	0	0	0	8.55566	0	0	0	0	0	0	0	0
Q8ND82	Z280C_HUMAN	Zinc finger protein 280C (Suppressor of hairy wing homolog 3) (Zinc finger protein 633)	ZNF280C SUHW3 ZNF633	Homo sapiens (Human)	regulation of DNA-templated transcription [GO:0006355]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	ASLGPLQSK	0.9416	0	0	0	0	8.53702	0	0	0	0	0	0	0
O60563	CCNT1_HUMAN	Cyclin-T1 (CycT1) (Cyclin-T)	CCNT1	Homo sapiens (Human)	"cell cycle [GO:0007049]; cell division [GO:0051301]; phosphorylation of RNA polymerase II C-terminal domain serine 2 residues involved in positive regulation of transcription elongation from RNA polymerase II promoter [GO:1903655]; phosphorylation of RNA polymerase II C-terminal domain serine 5 residues involved in positive regulation of transcription elongation from RNA polymerase II promoter [GO:1903654]; positive regulation by host of viral transcription [GO:0043923]; positive regulation of DNA-templated transcription, elongation [GO:0032786]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of transcription elongation by RNA polymerase II [GO:0032968]; protein phosphorylation [GO:0006468]; regulation of cyclin-dependent protein serine/threonine kinase activity [GO:0000079]; regulation of transcription by RNA polymerase II [GO:0006357]; response to xenobiotic stimulus [GO:0009410]; transcription by RNA polymerase II [GO:0006366]"	cyclin/CDK positive transcription elongation factor complex [GO:0008024]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; P-TEFb complex [GO:0070691]	7SK snRNA binding [GO:0097322]; chromatin binding [GO:0003682]; cyclin-dependent protein serine/threonine kinase activator activity [GO:0061575]; cyclin-dependent protein serine/threonine kinase regulator activity [GO:0016538]; DNA binding [GO:0003677]; DNA-binding transcription factor binding [GO:0140297]; molecular condensate scaffold activity [GO:0140693]; protein kinase binding [GO:0019901]; RNA polymerase binding [GO:0070063]; transcription cis-regulatory region binding [GO:0000976]	HAEELAAQKR	0.9979	0	0	0	0	0	0	0	0	0	0	8.53563	0
Q5T8R8	DOAS1_HUMAN	Uncharacterized protein DOCK8-AS1 (DOCK8 antisense RNA 1)	DOCK8-AS1 C9orf66	Homo sapiens (Human)				ADDRRPLRAGR	0.87358	0	0	0	0	0	0	0	0	8.53419	0	0	0
Q9BXM7	PINK1_HUMAN	"Serine/threonine-protein kinase PINK1, mitochondrial (EC 2.7.11.1) (BRPK) (PTEN-induced putative kinase protein 1)"	PINK1	Homo sapiens (Human)	"activation of protein kinase B activity [GO:0032148]; autophagy of mitochondrion [GO:0000422]; cellular response to hydrogen sulfide [GO:1904881]; cellular response to hypoxia [GO:0071456]; cellular response to oxidative stress [GO:0034599]; cellular response to toxic substance [GO:0097237]; dopamine secretion [GO:0014046]; establishment of protein localization to mitochondrion [GO:0072655]; hemopoiesis [GO:0030097]; intracellular signal transduction [GO:0035556]; maintenance of protein location in mitochondrion [GO:0072656]; mitochondrion organization [GO:0007005]; mitochondrion to lysosome transport [GO:0099074]; mitophagy [GO:0000423]; negative regulation of autophagosome assembly [GO:1902902]; negative regulation of gene expression [GO:0010629]; negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway [GO:1903384]; negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway [GO:1903298]; negative regulation of intrinsic apoptotic signaling pathway [GO:2001243]; negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide [GO:1903751]; negative regulation of JNK cascade [GO:0046329]; negative regulation of macroautophagy [GO:0016242]; negative regulation of mitochondrial fission [GO:0090258]; negative regulation of mitophagy [GO:1901525]; negative regulation of neuron apoptotic process [GO:0043524]; negative regulation of oxidative stress-induced cell death [GO:1903202]; negative regulation of oxidative stress-induced neuron death [GO:1903204]; negative regulation of reactive oxygen species metabolic process [GO:2000378]; peptidyl-serine autophosphorylation [GO:0036289]; peptidyl-serine phosphorylation [GO:0018105]; positive regulation of ATP biosynthetic process [GO:2001171]; positive regulation of cristae formation [GO:1903852]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of dopamine secretion [GO:0033603]; positive regulation of free ubiquitin chain polymerization [GO:1904544]; positive regulation of histone deacetylase activity [GO:1901727]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of macroautophagy [GO:0016239]; positive regulation of mitochondrial electron transport, NADH to ubiquinone [GO:1902958]; positive regulation of mitochondrial fission [GO:0090141]; positive regulation of mitophagy in response to mitochondrial depolarization [GO:0098779]; positive regulation of NMDA glutamate receptor activity [GO:1904783]; positive regulation of peptidase activity [GO:0010952]; positive regulation of peptidyl-serine phosphorylation [GO:0033138]; positive regulation of protein dephosphorylation [GO:0035307]; positive regulation of protein kinase B signaling [GO:0051897]; positive regulation of protein phosphorylation [GO:0001934]; positive regulation of protein targeting to mitochondrion [GO:1903955]; positive regulation of protein ubiquitination [GO:0031398]; positive regulation of release of cytochrome c from mitochondria [GO:0090200]; positive regulation of synaptic transmission, dopaminergic [GO:0032226]; positive regulation of translation [GO:0045727]; positive regulation of ubiquitin-protein transferase activity [GO:0051443]; protein phosphorylation [GO:0006468]; protein stabilization [GO:0050821]; protein ubiquitination [GO:0016567]; regulation of apoptotic process [GO:0042981]; regulation of autophagy of mitochondrion [GO:1903146]; regulation of cellular response to oxidative stress [GO:1900407]; regulation of hydrogen peroxide metabolic process [GO:0010310]; regulation of mitochondrial membrane potential [GO:0051881]; regulation of mitochondrion organization [GO:0010821]; regulation of oxidative phosphorylation [GO:0002082]; regulation of proteasomal protein catabolic process [GO:0061136]; regulation of protein targeting to mitochondrion [GO:1903214]; regulation of protein ubiquitination [GO:0031396]; regulation of protein-containing complex assembly [GO:0043254]; regulation of reactive oxygen species metabolic process [GO:2000377]; regulation of synaptic vesicle transport [GO:1902803]; respiratory electron transport chain [GO:0022904]; response to ischemia [GO:0002931]; response to oxidative stress [GO:0006979]; TORC2 signaling [GO:0038203]; ubiquitin-dependent protein catabolic process [GO:0006511]"	astrocyte projection [GO:0097449]; axon [GO:0030424]; cell body [GO:0044297]; chromatin [GO:0000785]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; growth cone [GO:0030426]; integral component of mitochondrial outer membrane [GO:0031307]; Lewy body [GO:0097413]; membrane [GO:0016020]; mitochondrial inner membrane [GO:0005743]; mitochondrial intermembrane space [GO:0005758]; mitochondrial outer membrane [GO:0005741]; mitochondrion [GO:0005739]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]	ATP binding [GO:0005524]; C3HC4-type RING finger domain binding [GO:0055131]; calcium-dependent protein kinase activity [GO:0010857]; kinase activity [GO:0016301]; magnesium ion binding [GO:0000287]; peptidase activator activity [GO:0016504]; protease binding [GO:0002020]; protein kinase activity [GO:0004672]; protein kinase B binding [GO:0043422]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674]; protein-containing complex binding [GO:0044877]; TORC2 complex binding [GO:1904841]; ubiquitin protein ligase binding [GO:0031625]	FTGKPGR	0.9368	0	8.53165	0	0	0	0	0	0	0	0	0	0
Q6IE81	JADE1_HUMAN	Protein Jade-1 (Jade family PHD finger protein 1) (PHD finger protein 17)	JADE1 KIAA1807 PHF17	Homo sapiens (Human)	apoptotic process [GO:0006915]; histone H3 acetylation [GO:0043966]; histone H4-K12 acetylation [GO:0043983]; histone H4-K5 acetylation [GO:0043981]; histone H4-K8 acetylation [GO:0043982]; histone modification [GO:0016570]; negative regulation of canonical Wnt signaling pathway [GO:0090090]; negative regulation of cell growth [GO:0030308]; negative regulation of G1/S transition of mitotic cell cycle [GO:2000134]; regulation of cell cycle [GO:0051726]; regulation of cell growth [GO:0001558]; regulation of DNA biosynthetic process [GO:2000278]; regulation of DNA replication [GO:0006275]; regulation of DNA-templated transcription [GO:0006355]; regulation of transcription by RNA polymerase II [GO:0006357]	chromosome [GO:0005694]; ciliary basal body [GO:0036064]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; histone acetyltransferase complex [GO:0000123]; nuclear speck [GO:0016607]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	metal ion binding [GO:0046872]; transcription coactivator activity [GO:0003713]	SSCSRHEDR	0.99778	0	0	0	0	0	0	0	0	0	0	0	8.52908
Q9P2F8	SI1L2_HUMAN	Signal-induced proliferation-associated 1-like protein 2 (SIPA1-like protein 2)	SIPA1L2 KIAA1389	Homo sapiens (Human)	activation of GTPase activity [GO:0090630]; regulation of small GTPase mediated signal transduction [GO:0051056]	cytoplasm [GO:0005737]	GTPase activator activity [GO:0005096]	IGILYCK	0.86832	8.52568	0	0	0	0	0	0	0	0	0	0	0
P21589	5NTD_HUMAN	5'-nucleotidase (5'-NT) (EC 3.1.3.5) (Ecto-5'-nucleotidase) (CD antigen CD73)	NT5E NT5 NTE	Homo sapiens (Human)	adenosine biosynthetic process [GO:0046086]; ADP catabolic process [GO:0046032]; AMP catabolic process [GO:0006196]; ATP metabolic process [GO:0046034]; biomineralization [GO:0110148]; calcium ion homeostasis [GO:0055074]; DNA metabolic process [GO:0006259]; leukocyte cell-cell adhesion [GO:0007159]; negative regulation of inflammatory response [GO:0050728]; response to ATP [GO:0033198]; response to inorganic substance [GO:0010035]	anchored component of membrane [GO:0031225]; cell surface [GO:0009986]; cytosol [GO:0005829]; external side of plasma membrane [GO:0009897]; extracellular exosome [GO:0070062]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; plasma membrane [GO:0005886]	5'-nucleotidase activity [GO:0008253]; metal ion binding [GO:0046872]; nucleotide binding [GO:0000166]; XMP 5'-nucleosidase activity [GO:0106411]	EVPAGKYPFIVTSDDGR	0.8784	0	0	0	0	0	0	0	0	8.52262	0	0	0
Q5T481	RBM20_HUMAN	RNA-binding protein 20 (RNA-binding motif protein 20)	RBM20	Homo sapiens (Human)	"heart formation [GO:0060914]; mRNA processing [GO:0006397]; negative regulation of mRNA splicing, via spliceosome [GO:0048025]; positive regulation of RNA splicing [GO:0033120]; regulation of alternative mRNA splicing, via spliceosome [GO:0000381]; regulation of mRNA splicing, via spliceosome [GO:0048024]; regulation of RNA splicing [GO:0043484]; RNA splicing [GO:0008380]"	cytoplasmic ribonucleoprotein granule [GO:0036464]; nucleus [GO:0005634]	mRNA binding [GO:0003729]; pre-mRNA intronic binding [GO:0097157]; RNA binding [GO:0003723]; splicing factor binding [GO:1990935]; zinc ion binding [GO:0008270]	AELDERPEGGRPHR	0.99856	0	0	0	0	0	0	0	0	0	8.51995	0	0
P0C0L5	CO4B_HUMAN	Complement C4-B (Basic complement C4) (C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3) [Cleaved into: Complement C4 beta chain; Complement C4-B alpha chain; C4a anaphylatoxin; C4b-B; C4d-B; Complement C4 gamma chain]	C4B CO4 CPAMD3; C4B_2	Homo sapiens (Human)	"complement activation [GO:0006956]; complement activation, classical pathway [GO:0006958]; detection of molecule of bacterial origin [GO:0032490]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; opsonization [GO:0008228]; positive regulation of apoptotic cell clearance [GO:2000427]; positive regulation of immune response [GO:0050778]; positive regulation of opsonization [GO:1903028]"	anchoring junction [GO:0070161]; axon [GO:0030424]; blood microparticle [GO:0072562]; classical-complement-pathway C3/C5 convertase complex [GO:0005601]; dendrite [GO:0030425]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; plasma membrane [GO:0005886]; symbiont cell surface [GO:0106139]; synapse [GO:0045202]	carbohydrate binding [GO:0030246]; complement binding [GO:0001848]; endopeptidase inhibitor activity [GO:0004866]	AACAQLNDFLQEYGTQGCQV	0	8.5168	0	0	0	0	0	0	0	0	0	0	0
Q969S2	NEIL2_HUMAN	Endonuclease 8-like 2 (EC 3.2.2.-) (EC 4.2.99.18) (DNA glycosylase/AP lyase Neil2) (DNA-(apurinic or apyrimidinic site) lyase Neil2) (Endonuclease VIII-like 2) (Nei homolog 2) (NEH2) (Nei-like protein 2)	NEIL2	Homo sapiens (Human)	base-excision repair [GO:0006284]; depyrimidination [GO:0045008]	cytoplasm [GO:0005737]; intracellular membrane-bounded organelle [GO:0043231]; mitotic spindle [GO:0072686]; nucleoplasm [GO:0005654]	class I DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0140078]; damaged DNA binding [GO:0003684]; DNA N-glycosylase activity [GO:0019104]; DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0003906]; microtubule binding [GO:0008017]; zinc ion binding [GO:0008270]	EGAADPK	0.88929	8.50752	0	0	0	0	0	0	0	0	0	0	0
Q8TAA5	GRPE2_HUMAN	"GrpE protein homolog 2, mitochondrial (Mt-GrpE#2)"	GRPEL2	Homo sapiens (Human)	intracellular protein transport [GO:0006886]; protein folding [GO:0006457]; protein import into mitochondrial matrix [GO:0030150]	"mitochondrial inner membrane [GO:0005743]; mitochondrion [GO:0005739]; PAM complex, Tim23 associated import motor [GO:0001405]; TIM23 mitochondrial import inner membrane translocase complex [GO:0005744]"	adenyl-nucleotide exchange factor activity [GO:0000774]; chaperone binding [GO:0051087]; protein homodimerization activity [GO:0042803]; unfolded protein binding [GO:0051082]	VEVAVESQR	0.92114	8.50732	0	0	0	0	0	0	0	0	0	0	0
Q9P2W6	CK021_HUMAN	Uncharacterized protein C11orf21	C11orf21	Homo sapiens (Human)		cytoplasm [GO:0005737]		TWCGMWRR	0.99904	0	0	0	0	0	0	0	8.50704	0	0	0	0
Q8N4B1	SESQ1_HUMAN	Sesquipedalian-1 (Ses1) (27 kDa inositol polyphosphate phosphatase-interacting protein A) (IPIP27A) (PH domain-containing endocytic trafficking adaptor 1)	PHETA1 FAM109A	Homo sapiens (Human)	"endosome organization [GO:0007032]; receptor recycling [GO:0001881]; retrograde transport, endosome to Golgi [GO:0042147]"	clathrin-coated vesicle [GO:0030136]; cytosol [GO:0005829]; early endosome [GO:0005769]; recycling endosome [GO:0055037]; trans-Golgi network [GO:0005802]	protein homodimerization activity [GO:0042803]	KGGRHAAYHR	0.95873	0	0	0	0	0	0	0	8.50426	0	0	0	0
Q92805	GOGA1_HUMAN	Golgin subfamily A member 1 (Golgin-97)	GOLGA1	Homo sapiens (Human)		acrosomal vesicle [GO:0001669]; cytosol [GO:0005829]; Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; perinuclear region of cytoplasm [GO:0048471]; trans-Golgi network [GO:0005802]		DQEWSEK	0.9989	0	8.50303	0	0	0	0	0	0	0	0	0	0
O60759	CYTIP_HUMAN	Cytohesin-interacting protein (Cytohesin binder and regulator) (CYBR) (Cytohesin-associated scaffolding protein) (CASP) (Cytohesin-binding protein HE) (Cbp HE) (Pleckstrin homology Sec7 and coiled-coil domains-binding protein)	CYTIP PSCDBP	Homo sapiens (Human)	regulation of cell adhesion [GO:0030155]	cell cortex [GO:0005938]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; early endosome [GO:0005769]; nucleoplasm [GO:0005654]		QTSTDDECFIPK	0.94235	8.49941	0	0	0	0	0	0	0	0	0	0	0
P13796	PLSL_HUMAN	Plastin-2 (L-plastin) (LC64P) (Lymphocyte cytosolic protein 1) (LCP-1)	LCP1 PLS2	Homo sapiens (Human)	actin crosslink formation [GO:0051764]; actin filament bundle assembly [GO:0051017]; actin filament network formation [GO:0051639]; animal organ regeneration [GO:0031100]; cell migration [GO:0016477]; cortical actin cytoskeleton organization [GO:0030866]; extracellular matrix disassembly [GO:0022617]; positive regulation of podosome assembly [GO:0071803]; protein kinase A signaling [GO:0010737]; regulation of intracellular protein transport [GO:0033157]; T cell activation involved in immune response [GO:0002286]	actin cytoskeleton [GO:0015629]; actin filament [GO:0005884]; actin filament bundle [GO:0032432]; cell junction [GO:0030054]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; extracellular space [GO:0005615]; filopodium [GO:0030175]; focal adhesion [GO:0005925]; glial cell projection [GO:0097386]; perinuclear region of cytoplasm [GO:0048471]; phagocytic cup [GO:0001891]; plasma membrane [GO:0005886]; podosome [GO:0002102]; ruffle [GO:0001726]; ruffle membrane [GO:0032587]	actin binding [GO:0003779]; actin filament binding [GO:0051015]; calcium ion binding [GO:0005509]; GTPase binding [GO:0051020]; integrin binding [GO:0005178]	AACLPLPGYRVR	0.87514	0	0	0	0	0	0	8.48724	0	0	0	0	0
Q9HBL0	TENS1_HUMAN	Tensin-1	TNS1 TNS	Homo sapiens (Human)	fibroblast migration [GO:0010761]	cell surface [GO:0009986]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; focal adhesion [GO:0005925]	actin binding [GO:0003779]; RNA binding [GO:0003723]	EPHLHSYK	0.99694	0	0	0	0	0	0	8.48313	0	0	0	0	0
Q9Y5T5	UBP16_HUMAN	Ubiquitin carboxyl-terminal hydrolase 16 (EC 3.4.19.12) (Deubiquitinating enzyme 16) (Ubiquitin thioesterase 16) (Ubiquitin-processing protease UBP-M) (Ubiquitin-specific-processing protease 16)	USP16 MSTP039	Homo sapiens (Human)	cell division [GO:0051301]; cellular response to DNA damage stimulus [GO:0006974]; chromatin organization [GO:0006325]; histone deubiquitination [GO:0016578]; histone H2A K63-linked deubiquitination [GO:0070537]; mitotic cell cycle [GO:0000278]; mitotic nuclear division [GO:0140014]; monoubiquitinated histone H2A deubiquitination [GO:0035522]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of translational elongation [GO:0045901]; protein deubiquitination [GO:0016579]; protein homotetramerization [GO:0051289]; regulation of cell cycle [GO:0051726]; regulation of transcription by RNA polymerase II [GO:0006357]; ubiquitin-dependent protein catabolic process [GO:0006511]	cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	cysteine-type deubiquitinase activity [GO:0004843]; cysteine-type endopeptidase activity [GO:0004197]; histone binding [GO:0042393]; transcription coactivator activity [GO:0003713]; ubiquitin binding [GO:0043130]; zinc ion binding [GO:0008270]	ELFSQVCK	0.92793	0	0	0	0	0	0	8.48313	0	0	0	0	0
O15037	KHNYN_HUMAN	Protein KHNYN (KH and NYN domain-containing protein)	KHNYN KIAA0323	Homo sapiens (Human)	"RNA phosphodiester bond hydrolysis, endonucleolytic [GO:0090502]"	cytoplasmic ribonucleoprotein granule [GO:0036464]; nucleus [GO:0005634]	endoribonuclease activity [GO:0004521]; mRNA binding [GO:0003729]	ESLDTGSMGPGDCR	0.87226	0	0	0	0	0	0	0	0	0	0	0	8.47982
Q8IYT3	CC170_HUMAN	Coiled-coil domain-containing protein 170	CCDC170 C6orf97	Homo sapiens (Human)	microtubule cytoskeleton organization [GO:0000226]	ciliary basal body [GO:0036064]; Golgi apparatus [GO:0005794]	microtubule binding [GO:0008017]	DLRKENEFVK	0.81643	0	0	0	0	0	0	0	0	8.47845	0	0	0
Q8IY82	DRC7_HUMAN	Dynein regulatory complex subunit 7 (Coiled-coil domain-containing protein 135) (Coiled-coil domain-containing protein lobo homolog)	DRC7 C16orf50 CCDC135	Homo sapiens (Human)	cell motility [GO:0048870]; flagellated sperm motility [GO:0030317]; sperm axoneme assembly [GO:0007288]; spermatogenesis [GO:0007283]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; motile cilium [GO:0031514]		EVCPLTVKPK	0.93699	0	0	0	0	0	0	0	0	0	0	8.47107	0
Q9NR80	ARHG4_HUMAN	Rho guanine nucleotide exchange factor 4 (APC-stimulated guanine nucleotide exchange factor 1) (Asef) (Asef1)	ARHGEF4 KIAA1112	Homo sapiens (Human)	filopodium assembly [GO:0046847]; intracellular signal transduction [GO:0035556]; lamellipodium assembly [GO:0030032]; regulation of small GTPase mediated signal transduction [GO:0051056]	cytosol [GO:0005829]; ruffle membrane [GO:0032587]	guanyl-nucleotide exchange factor activity [GO:0005085]; protein domain specific binding [GO:0019904]	DQMRTNVINEILSTER	0.88927	0	0	0	8.47078	0	0	0	0	0	0	0	0
Q9UGF5	O14J1_HUMAN	Olfactory receptor 14J1 (Hs6M1-28) (Olfactory receptor 5U1) (Olfactory receptor OR6-25)	OR14J1 OR5U1	Homo sapiens (Human)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	G protein-coupled receptor activity [GO:0004930]; odorant binding [GO:0005549]; olfactory receptor activity [GO:0004984]	MCLKAMFKL	0.95573	0	8.46418	0	0	0	0	0	0	0	0	0	0
Q7Z408	CSMD2_HUMAN	CUB and sushi domain-containing protein 2 (CUB and sushi multiple domains protein 2)	CSMD2 KIAA1884	Homo sapiens (Human)		integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]		WSSDHAYNR	0.88803	0	0	0	8.46074	0	0	0	0	0	0	0	0
Q96FL9	GLT14_HUMAN	Polypeptide N-acetylgalactosaminyltransferase 14 (EC 2.4.1.41) (Polypeptide GalNAc transferase 14) (GalNAc-T14) (pp-GaNTase 14) (Protein-UDP acetylgalactosaminyltransferase 14) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14)	GALNT14 UNQ2434/PRO4994	Homo sapiens (Human)	O-glycan processing [GO:0016266]; protein O-linked glycosylation [GO:0006493]	Golgi apparatus [GO:0005794]; Golgi membrane [GO:0000139]; integral component of membrane [GO:0016021]	carbohydrate binding [GO:0030246]; metal ion binding [GO:0046872]; polypeptide N-acetylgalactosaminyltransferase activity [GO:0004653]	QKCLESQR	0.99643	0	8.45389	0	0	0	0	0	0	0	0	0	0
O60315	ZEB2_HUMAN	Zinc finger E-box-binding homeobox 2 (Smad-interacting protein 1) (SMADIP1) (Zinc finger homeobox protein 1b)	ZEB2 KIAA0569 SIP1 ZFHX1B ZFX1B HRIHFB2411	Homo sapiens (Human)	anatomical structure development [GO:0048856]; developmental pigmentation [GO:0048066]; melanocyte migration [GO:0097324]; negative regulation of transcription by RNA polymerase II [GO:0000122]; nervous system development [GO:0007399]; positive regulation of canonical Wnt signaling pathway [GO:0090263]; positive regulation of melanin biosynthetic process [GO:0048023]; positive regulation of melanocyte differentiation [GO:0045636]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of transforming growth factor beta receptor signaling pathway [GO:0030511]; regulation of melanosome organization [GO:1903056]; regulation of transcription by RNA polymerase II [GO:0006357]	chromatin [GO:0000785]; cytosol [GO:0005829]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; metal ion binding [GO:0046872]; phosphatase regulator activity [GO:0019208]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific DNA binding [GO:0043565]"	AEEISKLKGYHMK	0.99727	8.44004	0	0	0	0	0	0	0	0	0	0	0
Q6KC79	NIPBL_HUMAN	Nipped-B-like protein (Delangin) (SCC2 homolog)	NIPBL IDN3 SCC2	Homo sapiens (Human)	brain development [GO:0007420]; cellular response to DNA damage stimulus [GO:0006974]; cellular response to X-ray [GO:0071481]; cognition [GO:0050890]; cohesin loading [GO:0071921]; developmental growth [GO:0048589]; digestive tract development [GO:0048565]; ear morphogenesis [GO:0042471]; embryonic digestive tract morphogenesis [GO:0048557]; embryonic forelimb morphogenesis [GO:0035115]; embryonic viscerocranium morphogenesis [GO:0048703]; establishment of mitotic sister chromatid cohesion [GO:0034087]; establishment of protein localization to chromatin [GO:0071169]; external genitalia morphogenesis [GO:0035261]; eye morphogenesis [GO:0048592]; face morphogenesis [GO:0060325]; fat cell differentiation [GO:0045444]; forelimb morphogenesis [GO:0035136]; gall bladder development [GO:0061010]; heart morphogenesis [GO:0003007]; maintenance of mitotic sister chromatid cohesion [GO:0034088]; metanephros development [GO:0001656]; mitotic cohesin loading [GO:0061780]; mitotic sister chromatid cohesion [GO:0007064]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of transcription by RNA polymerase II [GO:0000122]; outflow tract morphogenesis [GO:0003151]; positive regulation of histone deacetylation [GO:0031065]; positive regulation of multicellular organism growth [GO:0040018]; positive regulation of neuron migration [GO:2001224]; positive regulation of ossification [GO:0045778]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein localization [GO:0008104]; regulation of developmental growth [GO:0048638]; regulation of embryonic development [GO:0045995]; regulation of hair cycle [GO:0042634]; replication-born double-strand break repair via sister chromatid exchange [GO:1990414]; sensory perception of sound [GO:0007605]; somatic stem cell population maintenance [GO:0035019]; uterus morphogenesis [GO:0061038]	chromatin [GO:0000785]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; integrator complex [GO:0032039]; intracellular membrane-bounded organelle [GO:0043231]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; Scc2-Scc4 cohesin loading complex [GO:0090694]; SMC loading complex [GO:0032116]	chromatin binding [GO:0003682]; chromo shadow domain binding [GO:0070087]; histone deacetylase binding [GO:0042826]; mediator complex binding [GO:0036033]; promoter-specific chromatin binding [GO:1990841]; protein C-terminus binding [GO:0008022]; protein N-terminus binding [GO:0047485]	AEFPSYLLGGR	0.8646	0	0	8.43867	0	0	0	0	0	0	0	0	0
Q12888	TP53B_HUMAN	TP53-binding protein 1 (53BP1) (p53-binding protein 1) (p53BP1)	TP53BP1	Homo sapiens (Human)	cellular response to DNA damage stimulus [GO:0006974]; cellular response to X-ray [GO:0071481]; DNA damage checkpoint signaling [GO:0000077]; double-strand break repair via nonhomologous end joining [GO:0006303]; negative regulation of double-strand break repair via homologous recombination [GO:2000042]; positive regulation of DNA-binding transcription factor activity [GO:0051091]; positive regulation of DNA-templated transcription [GO:0045893]; positive regulation of isotype switching [GO:0045830]; positive regulation of transcription by RNA polymerase II [GO:0045944]; protein homooligomerization [GO:0051260]	"chromosome, telomeric region [GO:0000781]; cytoplasm [GO:0005737]; DNA repair complex [GO:1990391]; kinetochore [GO:0000776]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; replication fork [GO:0005657]; site of double-strand break [GO:0035861]"	damaged DNA binding [GO:0003684]; histone binding [GO:0042393]; methylated histone binding [GO:0035064]; p53 binding [GO:0002039]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; telomeric DNA binding [GO:0042162]; transcription coregulator activity [GO:0003712]; ubiquitin modification-dependent histone binding [GO:0061649]	LAILDQELEHK	0.93736	0	0	0	0	0	0	0	0	0	0	8.43846	0
Q92543	SNX19_HUMAN	Sorting nexin-19	SNX19 KIAA0254	Homo sapiens (Human)	chondrocyte differentiation [GO:0002062]; dense core granule maturation [GO:1990502]; establishment of localization in cell [GO:0051649]; exocytosis [GO:0006887]; insulin secretion [GO:0030073]	cytoplasm [GO:0005737]; early endosome membrane [GO:0031901]; intracellular membrane-bounded organelle [GO:0043231]	phosphatidylinositol binding [GO:0035091]	LLEMQPTK	0.8752	8.43563	0	0	0	0	0	0	0	0	0	0	0
Q5SVQ8	ZBT41_HUMAN	Zinc finger and BTB domain-containing protein 41	ZBTB41 FRBZ1	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]"	SLENHLAK	0.99854	0	0	0	0	0	0	0	0	0	0	8.43359	0
A0A0C4DH31	HV118_HUMAN	Immunoglobulin heavy variable 1-18	IGHV1-18	Homo sapiens (Human)	"B cell receptor signaling pathway [GO:0050853]; complement activation, classical pathway [GO:0006958]; defense response to bacterium [GO:0042742]; innate immune response [GO:0045087]; phagocytosis, engulfment [GO:0006911]; phagocytosis, recognition [GO:0006910]; positive regulation of B cell activation [GO:0050871]"	"external side of plasma membrane [GO:0009897]; immunoglobulin complex, circulating [GO:0042571]"	antigen binding [GO:0003823]; immunoglobulin receptor binding [GO:0034987]	SDDTAVYYCAR	0	8.43334	0	0	0	0	0	0	0	0	0	0	0
P00450	CERU_HUMAN	Ceruloplasmin (EC 1.16.3.1) (Ferroxidase)	CP	Homo sapiens (Human)	cellular iron ion homeostasis [GO:0006879]; copper ion transport [GO:0006825]; iron ion homeostasis [GO:0055072]; iron ion transport [GO:0006826]	blood microparticle [GO:0072562]; endoplasmic reticulum lumen [GO:0005788]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; lysosomal membrane [GO:0005765]; plasma membrane [GO:0005886]	chaperone binding [GO:0051087]; copper ion binding [GO:0005507]; ferroxidase activity [GO:0004322]; oxidoreductase activity [GO:0016491]	EVGPTNADPVCLAK	0	8.4192	0	0	0	0	0	0	0	0	0	0	0
Q8TF76	HASP_HUMAN	Serine/threonine-protein kinase haspin (EC 2.7.11.1) (Germ cell-specific gene 2 protein) (H-haspin) (Haploid germ cell-specific nuclear protein kinase)	HASPIN GSG2	Homo sapiens (Human)	"chromatin organization [GO:0006325]; intracellular signal transduction [GO:0035556]; mitotic cell cycle [GO:0000278]; mitotic sister chromatid cohesion [GO:0007064]; mitotic spindle assembly checkpoint signaling [GO:0007094]; protein localization to chromosome, centromeric region [GO:0071459]; protein phosphorylation [GO:0006468]"	centrosome [GO:0005813]; chromosome [GO:0005694]; cytoplasm [GO:0005737]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; spindle [GO:0005819]	ATP binding [GO:0005524]; histone kinase activity (H3-T3 specific) [GO:0072354]; protein kinase activity [GO:0004672]; protein serine kinase activity [GO:0106310]	TYGAADGRR	0.97131	8.40625	0	0	0	0	0	0	0	0	0	0	0
Q9UHB7	AFF4_HUMAN	AF4/FMR2 family member 4 (ALL1-fused gene from chromosome 5q31 protein) (Protein AF-5q31) (Major CDK9 elongation factor-associated protein)	AFF4 AF5Q31 MCEF HSPC092	Homo sapiens (Human)	regulation of gene expression [GO:0010468]; spermatid development [GO:0007286]	euchromatin [GO:0000791]; fibrillar center [GO:0001650]; nucleoplasm [GO:0005654]; super elongation complex [GO:0032783]; transcription elongation factor complex [GO:0008023]		NSSSTSKQK	0.99861	8.40625	0	0	0	0	0	0	0	0	0	0	0
Q14781	CBX2_HUMAN	Chromobox protein homolog 2	CBX2	Homo sapiens (Human)	cell differentiation [GO:0030154]; chromatin organization [GO:0006325]; development of primary sexual characteristics [GO:0045137]; negative regulation of transcription by RNA polymerase II [GO:0000122]	euchromatin [GO:0000791]; heterochromatin [GO:0000792]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; PcG protein complex [GO:0031519]; PRC1 complex [GO:0035102]	chromatin binding [GO:0003682]; DNA binding [GO:0003677]; methylated histone binding [GO:0035064]	WRGWSSK	0.99546	0	0	0	0	0	0	0	0	0	0	0	8.40331
Q16760	DGKD_HUMAN	Diacylglycerol kinase delta (DAG kinase delta) (EC 2.7.1.107) (130 kDa diacylglycerol kinase) (Diglyceride kinase delta) (DGK-delta)	DGKD KIAA0145	Homo sapiens (Human)	diacylglycerol metabolic process [GO:0046339]; endocytosis [GO:0006897]; epidermal growth factor receptor signaling pathway [GO:0007173]; intracellular signal transduction [GO:0035556]; lipid phosphorylation [GO:0046834]; negative regulation of protein kinase C signaling [GO:0090038]; phosphatidic acid biosynthetic process [GO:0006654]; platelet activation [GO:0030168]; positive regulation of clathrin-dependent endocytosis [GO:2000370]; positive regulation of epidermal growth factor receptor signaling pathway [GO:0045742]; protein kinase C-activating G protein-coupled receptor signaling pathway [GO:0007205]; protein transport [GO:0015031]; response to organic substance [GO:0010033]; signal transduction [GO:0007165]	clathrin-coated pit [GO:0005905]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; cytosol [GO:0005829]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	ATP binding [GO:0005524]; diacylglycerol binding [GO:0019992]; diacylglycerol kinase activity [GO:0004143]; identical protein binding [GO:0042802]; kinase binding [GO:0019900]; metal ion binding [GO:0046872]; protein heterodimerization activity [GO:0046982]; protein homodimerization activity [GO:0042803]	SAPAVEA	0.99127	8.3975	0	0	0	0	0	0	0	0	0	0	0
Q9UQ84	EXO1_HUMAN	Exonuclease 1 (hExo1) (EC 3.1.-.-) (Exonuclease I) (hExoI)	EXO1 EXOI HEX1	Homo sapiens (Human)	DNA recombination [GO:0006310]; DNA repair [GO:0006281]; humoral immune response mediated by circulating immunoglobulin [GO:0002455]; isotype switching [GO:0045190]; meiotic cell cycle [GO:0051321]; mismatch repair [GO:0006298]; somatic hypermutation of immunoglobulin genes [GO:0016446]; t-circle formation [GO:0090656]	nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	5'-3' exodeoxyribonuclease activity [GO:0035312]; 5'-3' exonuclease activity [GO:0008409]; 5'-flap endonuclease activity [GO:0017108]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; double-stranded DNA 5'-3' exodeoxyribonuclease activity [GO:0051908]; exonuclease activity [GO:0004527]; flap endonuclease activity [GO:0048256]; metal ion binding [GO:0046872]; RNA-DNA hybrid ribonuclease activity [GO:0004523]; single-stranded DNA 5'-3' exodeoxyribonuclease activity [GO:0045145]	YVGFCMK	0.93713	0	0	8.39421	0	0	0	0	0	0	0	0	0
Q9BS31	ZN649_HUMAN	Zinc finger protein 649	ZNF649	Homo sapiens (Human)	regulation of transcription by RNA polymerase II [GO:0006357]	extracellular space [GO:0005615]; nucleus [GO:0005634]	DNA-binding transcription factor activity [GO:0003700]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]	AFSQKSCLVAHQR	0.87967	0	0	0	0	8.3909	0	0	0	0	0	0	0
Q9H307	PININ_HUMAN	Pinin (140 kDa nuclear and cell adhesion-related phosphoprotein) (Desmosome-associated protein) (Domain-rich serine protein) (DRS protein) (DRSP) (Melanoma metastasis clone A protein) (Nuclear protein SDK3) (SR-like protein)	PNN DRS MEMA	Homo sapiens (Human)	"cell adhesion [GO:0007155]; mRNA splicing, via spliceosome [GO:0000398]"	catalytic step 2 spliceosome [GO:0071013]; cell-cell junction [GO:0005911]; desmosome [GO:0030057]; intermediate filament [GO:0005882]; membrane [GO:0016020]; nuclear speck [GO:0016607]; plasma membrane [GO:0005886]	DNA binding [GO:0003677]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198]	MEEETEVR	0.81862	0	8.38776	0	0	0	0	0	0	0	0	0	0
Q15262	PTPRK_HUMAN	Receptor-type tyrosine-protein phosphatase kappa (Protein-tyrosine phosphatase kappa) (R-PTP-kappa) (EC 3.1.3.48)	PTPRK PTPK	Homo sapiens (Human)	cell adhesion [GO:0007155]; cell migration [GO:0016477]; cellular response to reactive oxygen species [GO:0034614]; cellular response to UV [GO:0034644]; focal adhesion assembly [GO:0048041]; negative regulation of cell cycle [GO:0045786]; negative regulation of cell migration [GO:0030336]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of DNA-templated transcription [GO:0045892]; negative regulation of keratinocyte proliferation [GO:0010839]; protein dephosphorylation [GO:0006470]; protein localization to cell surface [GO:0034394]; signal transduction [GO:0007165]; transforming growth factor beta receptor signaling pathway [GO:0007179]	adherens junction [GO:0005912]; cell junction [GO:0030054]; cell surface [GO:0009986]; cell-cell junction [GO:0005911]; integral component of membrane [GO:0016021]; integral component of plasma membrane [GO:0005887]; intracellular membrane-bounded organelle [GO:0043231]; leading edge membrane [GO:0031256]; plasma membrane [GO:0005886]	beta-catenin binding [GO:0008013]; gamma-catenin binding [GO:0045295]; protein kinase binding [GO:0019901]; protein tyrosine phosphatase activity [GO:0004725]; transmembrane receptor protein tyrosine phosphatase activity [GO:0005001]	ETKTQCVR	0.99807	0	0	0	0	0	0	0	0	0	0	0	8.38759
Q13753	LAMC2_HUMAN	Laminin subunit gamma-2 (Cell-scattering factor 140 kDa subunit) (CSF 140 kDa subunit) (Epiligrin subunit gamma) (Kalinin subunit gamma) (Kalinin/nicein/epiligrin 100 kDa subunit) (Ladsin 140 kDa subunit) (Laminin B2t chain) (Laminin-5 subunit gamma) (Large adhesive scatter factor 140 kDa subunit) (Nicein subunit gamma)	LAMC2 LAMB2T LAMNB2	Homo sapiens (Human)	animal organ morphogenesis [GO:0009887]; cell adhesion [GO:0007155]; dendrite development [GO:0016358]; epidermis development [GO:0008544]; motor neuron axon guidance [GO:0008045]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; tissue development [GO:0009888]	basement membrane [GO:0005604]; cell cortex [GO:0005938]; collagen-containing extracellular matrix [GO:0062023]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; laminin-2 complex [GO:0005607]; membrane [GO:0016020]; perinuclear region of cytoplasm [GO:0048471]	heparin binding [GO:0008201]; signaling receptor binding [GO:0005102]	CLPGFHMLTDAGCTQDQR	0.93519	0	8.38452	0	0	0	0	0	0	0	0	0	0
Q99501	GA2L1_HUMAN	GAS2-like protein 1 (GAS2-related protein on chromosome 22) (Growth arrest-specific protein 2-like 1)	GAS2L1 GAR22	Homo sapiens (Human)	actin crosslink formation [GO:0051764]; cellular response to starvation [GO:0009267]; cellular response to thyroid hormone stimulus [GO:0097067]; microtubule bundle formation [GO:0001578]; negative regulation of cell growth [GO:0030308]; negative regulation of erythrocyte differentiation [GO:0045647]; negative regulation of gene expression [GO:0010629]; negative regulation of microtubule depolymerization [GO:0007026]; protein localization to microtubule plus-end [GO:1904825]; regulation of cell cycle [GO:0051726]; regulation of microtubule polymerization or depolymerization [GO:0031110]	cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]	actin filament binding [GO:0051015]; cytoskeletal anchor activity [GO:0008093]; microtubule binding [GO:0008017]; nuclear thyroid hormone receptor binding [GO:0046966]	GPRMTPSDLR	0.99877	0	8.37691	0	0	0	0	0	0	0	0	0	0
O95861	BPNT1_HUMAN	"3'(2'),5'-bisphosphate nucleotidase 1 (EC 3.1.3.7) (Bisphosphate 3'-nucleotidase 1) (PAP-inositol 1,4-phosphatase) (PIP)"	BPNT1	Homo sapiens (Human)	3'-phosphoadenosine 5'-phosphosulfate metabolic process [GO:0050427]; inositol phosphate dephosphorylation [GO:0046855]; nervous system development [GO:0007399]; nucleobase-containing compound metabolic process [GO:0006139]; phosphatidylinositol phosphate biosynthetic process [GO:0046854]	cytosol [GO:0005829]	"3'(2'),5'-bisphosphate nucleotidase activity [GO:0008441]; metal ion binding [GO:0046872]"	VGGAGNK	0.87581	0	0	0	0	0	0	0	8.37408	0	0	0	0
Q9NV58	RN19A_HUMAN	E3 ubiquitin-protein ligase RNF19A (EC 2.3.2.31) (Double ring-finger protein) (Dorfin) (RING finger protein 19A) (p38)	RNF19A RNF19	Homo sapiens (Human)	"microtubule cytoskeleton organization [GO:0000226]; positive regulation of proteasomal ubiquitin-dependent protein catabolic process [GO:0032436]; protein polyubiquitination [GO:0000209]; regulation of protein catabolic process at postsynapse, modulating synaptic transmission [GO:0099576]; ubiquitin-dependent protein catabolic process [GO:0006511]"	centrosome [GO:0005813]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; glutamatergic synapse [GO:0098978]; hippocampal mossy fiber to CA3 synapse [GO:0098686]; integral component of membrane [GO:0016021]; postsynapse [GO:0098794]; ubiquitin ligase complex [GO:0000151]	metal ion binding [GO:0046872]; ubiquitin conjugating enzyme binding [GO:0031624]; ubiquitin protein ligase activity [GO:0061630]	EGCGTEFCYHCK	0.94239	8.37374	0	0	0	0	0	0	0	0	0	0	0
Q15147	PLCB4_HUMAN	"1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (EC 3.1.4.11) (Phosphoinositide phospholipase C-beta-4) (Phospholipase C-beta-4) (PLC-beta-4)"	PLCB4	Homo sapiens (Human)	G protein-coupled receptor signaling pathway [GO:0007186]; lipid catabolic process [GO:0016042]; phosphatidylinositol-mediated signaling [GO:0048015]	cytosol [GO:0005829]	calcium ion binding [GO:0005509]; phosphatidylinositol phospholipase C activity [GO:0004435]; phospholipase C activity [GO:0004629]	CVELDCWDGK	0.93272	0	0	0	0	0	0	0	0	0	0	0	8.37003
Q8MH63	LAT1N_HUMAN	Putative L-type amino acid transporter 1-like protein MLAS (hLAT1 3-transmembrane protein MLAS) (hLAT1 3TM MLAS)	SLC7A5P1 MLAS	Homo sapiens (Human)		integral component of membrane [GO:0016021]	L-amino acid transmembrane transporter activity [GO:0015179]	MAGAGPK	0.89204	0	0	0	0	0	0	0	0	8.35125	0	0	0
Q08211	DHX9_HUMAN	ATP-dependent RNA helicase A (EC 3.6.4.13) (DEAH box protein 9) (DExH-box helicase 9) (Leukophysin) (LKP) (Nuclear DNA helicase II) (NDH II) (RNA helicase A)	DHX9 DDX9 LKP NDH2	Homo sapiens (Human)	"alternative mRNA splicing, via spliceosome [GO:0000380]; cellular response to exogenous dsRNA [GO:0071360]; cellular response to tumor necrosis factor [GO:0071356]; CRD-mediated mRNA stabilization [GO:0070934]; DNA duplex unwinding [GO:0032508]; DNA replication [GO:0006260]; DNA-templated transcription termination [GO:0006353]; DNA-templated viral transcription [GO:0039695]; G-quadruplex DNA unwinding [GO:0044806]; global gene silencing by mRNA cleavage [GO:0098795]; inflammatory response [GO:0006954]; innate immune response [GO:0045087]; mRNA transport [GO:0051028]; negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay [GO:1900152]; osteoblast differentiation [GO:0001649]; positive regulation of cytoplasmic translation [GO:2000767]; positive regulation of DNA repair [GO:0045739]; positive regulation of DNA replication [GO:0045740]; positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity [GO:2000373]; positive regulation of fibroblast proliferation [GO:0048146]; positive regulation of inflammatory response [GO:0050729]; positive regulation of innate immune response [GO:0045089]; positive regulation of interferon-alpha production [GO:0032727]; positive regulation of interferon-beta production [GO:0032728]; positive regulation of interleukin-18 production [GO:0032741]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of miRNA-mediated gene silencing [GO:2000637]; positive regulation of NF-kappaB transcription factor activity [GO:0051092]; positive regulation of polysome binding [GO:1905698]; positive regulation of response to cytokine stimulus [GO:0060760]; positive regulation of RNA export from nucleus [GO:0046833]; positive regulation of transcription by RNA polymerase II [GO:0045944]; positive regulation of tumor necrosis factor production [GO:0032760]; positive regulation of viral transcription [GO:0050434]; positive regulation of viral translation [GO:1904973]; protein localization to cytoplasmic stress granule [GO:1903608]; protein-containing complex assembly [GO:0065003]; pyroptosis [GO:0070269]; regulation of cytoplasmic translation [GO:2000765]; regulation of defense response to virus by host [GO:0050691]; regulation of mRNA processing [GO:0050684]; regulation of transcription by RNA polymerase II [GO:0006357]; rhythmic process [GO:0048511]; RISC complex assembly [GO:0070922]; RNA secondary structure unwinding [GO:0010501]"	actin cytoskeleton [GO:0015629]; centrosome [GO:0005813]; CRD-mediated mRNA stability complex [GO:0070937]; cytoplasm [GO:0005737]; cytoplasmic ribonucleoprotein granule [GO:0036464]; cytosol [GO:0005829]; membrane [GO:0016020]; nuclear body [GO:0016604]; nuclear stress granule [GO:0097165]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perichromatin fibrils [GO:0005726]; polysomal ribosome [GO:0042788]; polysome [GO:0005844]; protein-containing complex [GO:0032991]; ribonucleoprotein complex [GO:1990904]; RISC complex [GO:0016442]; RISC-loading complex [GO:0070578]	3'-5' DNA helicase activity [GO:0043138]; 3'-5' DNA/RNA helicase activity [GO:0033679]; 3'-5' RNA helicase activity [GO:0034458]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; chromatin DNA binding [GO:0031490]; DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; DNA replication origin binding [GO:0003688]; double-stranded DNA binding [GO:0003690]; double-stranded RNA binding [GO:0003725]; importin-alpha family protein binding [GO:0061676]; metal ion binding [GO:0046872]; mRNA binding [GO:0003729]; nucleoside triphosphate diphosphatase activity [GO:0047429]; polysome binding [GO:1905538]; promoter-specific chromatin binding [GO:1990841]; regulatory region RNA binding [GO:0001069]; ribonucleoside triphosphate phosphatase activity [GO:0017111]; RISC complex binding [GO:1905172]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724]; RNA polymerase binding [GO:0070063]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; RNA polymerase II complex binding [GO:0000993]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; RNA stem-loop binding [GO:0035613]; sequence-specific mRNA binding [GO:1990825]; single-stranded 3'-5' DNA helicase activity [GO:1990518]; single-stranded DNA binding [GO:0003697]; single-stranded RNA binding [GO:0003727]; siRNA binding [GO:0035197]; transcription coactivator activity [GO:0003713]; transcription coregulator activity [GO:0003712]; triplex DNA binding [GO:0045142]	KMTPSYEIR	0.99733	0	0	0	0	0	0	0	8.33333	0	0	0	0
Q9Y2L9	LRCH1_HUMAN	Leucine-rich repeat and calponin homology domain-containing protein 1 (Calponin homology domain-containing protein 1) (Neuronal protein 81) (NP81)	LRCH1 CHDC1 KIAA1016	Homo sapiens (Human)	cellular response to chemokine [GO:1990869]; negative regulation of GTPase activity [GO:0034260]; negative regulation of T cell migration [GO:2000405]	cytoplasm [GO:0005737]		KDSDSGVGSDNGDKR	0.97571	0	0	0	0	0	0	0	8.33083	0	0	0	0
P27816	MAP4_HUMAN	Microtubule-associated protein 4 (MAP-4)	MAP4	Homo sapiens (Human)	cell division [GO:0051301]; establishment of spindle orientation [GO:0051294]; microtubule cytoskeleton organization [GO:0000226]; microtubule sliding [GO:0051012]; mitotic spindle organization [GO:0007052]; negative regulation of non-motile cilium assembly [GO:1902856]; neuron projection development [GO:0031175]	axon [GO:0030424]; axoneme [GO:0005930]; microtubule [GO:0005874]; microtubule associated complex [GO:0005875]; microtubule organizing center [GO:0005815]; mitotic spindle [GO:0072686]; neuron projection [GO:0043005]	microtubule binding [GO:0008017]; RNA binding [GO:0003723]; structural molecule activity [GO:0005198]	TGNSESK	0.89048	8.3298	0	0	0	0	0	0	0	0	0	0	0
Q5T1B0	AXDN1_HUMAN	Axonemal dynein light chain domain-containing protein 1	AXDND1 C1orf125	Homo sapiens (Human)				SAENSSK	0.67419	8.3298	0	0	0	0	0	0	0	0	0	0	0
Q12802	AKP13_HUMAN	A-kinase anchor protein 13 (AKAP-13) (AKAP-Lbc) (Breast cancer nuclear receptor-binding auxiliary protein) (Guanine nucleotide exchange factor Lbc) (Human thyroid-anchoring protein 31) (Lymphoid blast crisis oncogene) (LBC oncogene) (Non-oncogenic Rho GTPase-specific GTP exchange factor) (Protein kinase A-anchoring protein 13) (PRKA13) (p47)	AKAP13 BRX HT31 LBC	Homo sapiens (Human)	adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process [GO:0086023]; adrenergic receptor signaling pathway [GO:0071875]; bone development [GO:0060348]; cardiac muscle cell differentiation [GO:0055007]; cell growth involved in cardiac muscle cell development [GO:0061049]; G protein-coupled receptor signaling pathway [GO:0007186]; heart development [GO:0007507]; nuclear export [GO:0051168]; positive regulation of I-kappaB kinase/NF-kappaB signaling [GO:0043123]; positive regulation of MAP kinase activity [GO:0043406]; positive regulation of Rho protein signal transduction [GO:0035025]; regulation of Rho protein signal transduction [GO:0035023]; regulation of sarcomere organization [GO:0060297]; regulation of small GTPase mediated signal transduction [GO:0051056]	cell cortex [GO:0005938]; cytosol [GO:0005829]; membrane [GO:0016020]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]	cAMP-dependent protein kinase activity [GO:0004691]; guanyl-nucleotide exchange factor activity [GO:0005085]; MAP-kinase scaffold activity [GO:0005078]; metal ion binding [GO:0046872]; molecular adaptor activity [GO:0060090]; protein kinase A binding [GO:0051018]; small GTPase binding [GO:0031267]	DSKDKEK	0.98018	0	0	0	0	0	0	0	0	0	8.3185	0	0
P05165	PCCA_HUMAN	"Propionyl-CoA carboxylase alpha chain, mitochondrial (PCCase subunit alpha) (EC 6.4.1.3) (Propanoyl-CoA:carbon dioxide ligase subunit alpha)"	PCCA	Homo sapiens (Human)	branched-chain amino acid metabolic process [GO:0009081]; fatty acid metabolic process [GO:0006631]; short-chain fatty acid catabolic process [GO:0019626]	catalytic complex [GO:1902494]; cytosol [GO:0005829]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]	ATP binding [GO:0005524]; biotin binding [GO:0009374]; enzyme binding [GO:0019899]; metal ion binding [GO:0046872]; propionyl-CoA carboxylase activity [GO:0004658]	ASAGGGGK	0.87392	0	0	0	8.31786	0	0	0	0	0	0	0	0
Q6ZQN7	SO4C1_HUMAN	Solute carrier organic anion transporter family member 4C1 (OATP-H) (Organic anion transporter M1) (OATP-M1) (Solute carrier family 21 member 20)	SLCO4C1 OATP4C1 OATPX SLC21A20	Homo sapiens (Human)	cell differentiation [GO:0030154]; sodium-independent organic anion transport [GO:0043252]; spermatogenesis [GO:0007283]	azurophil granule membrane [GO:0035577]; basolateral plasma membrane [GO:0016323]; extracellular exosome [GO:0070062]; integral component of plasma membrane [GO:0005887]; plasma membrane [GO:0005886]; specific granule membrane [GO:0035579]	sodium-independent organic anion transmembrane transporter activity [GO:0015347]	AGKCETHCAK	0.99886	8.31701	0	0	0	0	0	0	0	0	0	0	0
Q9BSH3	NICN1_HUMAN	Nicolin-1 (NPCEDRG) (Tubulin polyglutamylase complex subunit 5) (PGs5)	NICN1	Homo sapiens (Human)		microtubule [GO:0005874]; nucleoplasm [GO:0005654]		HQMLCDMAR	0.94521	8.31701	0	0	0	0	0	0	0	0	0	0	0
Q15642	CIP4_HUMAN	Cdc42-interacting protein 4 (Protein Felic) (Salt tolerant protein) (hSTP) (Thyroid receptor-interacting protein 10) (TR-interacting protein 10) (TRIP-10)	TRIP10 CIP4 STOT STP	Homo sapiens (Human)	actin cytoskeleton organization [GO:0030036]; cell communication [GO:0007154]; endocytosis [GO:0006897]; signal transduction [GO:0007165]	cell cortex [GO:0005938]; cell projection [GO:0042995]; cytoplasm [GO:0005737]; cytoskeleton [GO:0005856]; cytosol [GO:0005829]; extracellular exosome [GO:0070062]; Golgi apparatus [GO:0005794]; intracellular membrane-bounded organelle [GO:0043231]; lysosome [GO:0005764]; nucleoplasm [GO:0005654]; perinuclear region of cytoplasm [GO:0048471]; phagocytic cup [GO:0001891]	identical protein binding [GO:0042802]; lipid binding [GO:0008289]	LDQDINATKADVEK	0.83507	0	0	0	0	0	0	0	0	0	0	8.31048	0
C9JL84	HHLA1_HUMAN	HERV-H LTR-associating protein 1	HHLA1	Homo sapiens (Human)		extracellular region [GO:0005576]		YCYCLNNR	0.93642	8.30529	0	0	0	0	0	0	0	0	0	0	0
Q3KP22	MAJIN_HUMAN	Membrane-anchored junction protein	MAJIN C11orf85	Homo sapiens (Human)	homologous chromosome pairing at meiosis [GO:0007129]; meiotic attachment of telomere to nuclear envelope [GO:0070197]; meiotic telomere clustering [GO:0045141]	"chromosome, telomeric region [GO:0000781]; integral component of nuclear inner membrane [GO:0005639]"	DNA binding [GO:0003677]	KPPVETRR	0.99684	0	0	0	0	0	0	0	0	0	8.29797	0	0
Q6ZU35	CRACD_HUMAN	Capping protein-inhibiting regulator of actin dynamics (Cancer-related regulator of actin dynamics)	CRACD CRAD KIAA1211	Homo sapiens (Human)	epithelial structure maintenance [GO:0010669]; maintenance of gastrointestinal epithelium [GO:0030277]; negative regulation of barbed-end actin filament capping [GO:2000813]; positive regulation of actin filament polymerization [GO:0030838]	cytosol [GO:0005829]		ELEAKCKR	0.98275	0	0	0	0	0	0	0	0	0	0	8.27817	0
P58304	VSX2_HUMAN	Visual system homeobox 2 (Ceh-10 homeodomain-containing homolog) (Homeobox protein CHX10)	VSX2 CHX10 HOX10	Homo sapiens (Human)	negative regulation of transcription by RNA polymerase II [GO:0000122]; regulation of transcription by RNA polymerase II [GO:0006357]; response to stimulus [GO:0050896]; visual perception [GO:0007601]	chromatin [GO:0000785]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; RNA polymerase II transcription regulatory region sequence-specific DNA binding [GO:0000977]; sequence-specific double-stranded DNA binding [GO:1990837]"	EPPSSHPR	0.93267	0	0	8.25091	0	0	0	0	0	0	0	0	0
Q7Z478	DHX29_HUMAN	ATP-dependent RNA helicase DHX29 (EC 3.6.4.13) (DEAH box protein 29) (Nucleic acid helicase DDXx)	DHX29 DDX29	Homo sapiens (Human)	formation of translation preinitiation complex [GO:0001731]; positive regulation of translational initiation [GO:0045948]; ribosome assembly [GO:0042255]	cytosolic small ribosomal subunit [GO:0022627]; eukaryotic 43S preinitiation complex [GO:0016282]	ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; cadherin binding [GO:0045296]; ribonucleoside triphosphate phosphatase activity [GO:0017111]; ribosomal small subunit binding [GO:0043024]; RNA binding [GO:0003723]; RNA helicase activity [GO:0003724]; translation activator activity [GO:0008494]; translation initiation factor activity [GO:0003743]	RFYSERYK	0.92005	0	0	0	0	0	0	0	8.24146	0	0	0	0
Q9BYT9	ANO3_HUMAN	Anoctamin-3 (Transmembrane protein 16C)	ANO3 C11orf25 TMEM16C GENX-3947	Homo sapiens (Human)	calcium activated galactosylceramide scrambling [GO:0061591]; calcium activated phosphatidylcholine scrambling [GO:0061590]; chloride transmembrane transport [GO:1902476]; detection of mechanical stimulus [GO:0050982]; detection of temperature stimulus [GO:0016048]; establishment of localization in cell [GO:0051649]; ion transmembrane transport [GO:0034220]; transmembrane transport [GO:0055085]	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	chloride channel activity [GO:0005254]; intracellular calcium activated chloride channel activity [GO:0005229]; phospholipid scramblase activity [GO:0017128]; protein dimerization activity [GO:0046983]	LVVMEQFASFK	0.86729	0	0	0	0	0	0	0	0	8.23654	0	0	0
Q9UL62	TRPC5_HUMAN	Short transient receptor potential channel 5 (TrpC5) (Transient receptor protein 5) (TRP-5) (hTRP-5) (hTRP5)	TRPC5 TRP5	Homo sapiens (Human)	calcium ion transmembrane transport [GO:0070588]; calcium ion transport [GO:0006816]; manganese ion transport [GO:0006828]; negative regulation of dendrite morphogenesis [GO:0050774]; nervous system development [GO:0007399]; neuron apoptotic process [GO:0051402]; neuron differentiation [GO:0030182]; phosphatidylserine exposure on apoptotic cell surface [GO:0070782]; positive regulation of axon extension [GO:0045773]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of cytosolic calcium ion concentration [GO:0007204]; positive regulation of neuron differentiation [GO:0045666]; positive regulation of peptidyl-threonine phosphorylation [GO:0010800]; regulation of cytosolic calcium ion concentration [GO:0051480]; regulation of membrane hyperpolarization [GO:1902630]	calcium channel complex [GO:0034704]; cation channel complex [GO:0034703]; cytoplasm [GO:0005737]; dendrite [GO:0030425]; growth cone [GO:0030426]; integral component of plasma membrane [GO:0005887]; membrane raft [GO:0045121]; neuronal cell body [GO:0043025]; plasma membrane [GO:0005886]	"actin binding [GO:0003779]; actinin binding [GO:0042805]; ATPase binding [GO:0051117]; calcium channel activity [GO:0005262]; clathrin binding [GO:0030276]; inositol 1,4,5 trisphosphate binding [GO:0070679]; store-operated calcium channel activity [GO:0015279]"	SSGAQGK	0.77159	0	0	8.2196	0	0	0	0	0	0	0	0	0
Q12815	TROAP_HUMAN	Tastin (Trophinin-assisting protein) (Trophinin-associated protein)	TROAP	Homo sapiens (Human)	cell adhesion [GO:0007155]	cytoplasm [GO:0005737]		GVSPTPSKIPVR	0.98883	0	0	0	0	8.20687	0	0	0	0	0	0	0
Q8WWW0	RASF5_HUMAN	Ras association domain-containing protein 5 (New ras effector 1) (Regulator for cell adhesion and polarization enriched in lymphoid tissues) (RAPL)	RASSF5 NORE1 RAPL	Homo sapiens (Human)	apoptotic process [GO:0006915]; lymphocyte proliferation [GO:0046651]; negative regulation of lymphocyte proliferation [GO:0050672]; positive regulation of protein ubiquitination [GO:0031398]; regulation of apoptotic process [GO:0042981]; regulation of protein localization to nucleus [GO:1900180]; signal transduction [GO:0007165]	cytoplasm [GO:0005737]; microtubule [GO:0005874]; nucleus [GO:0005634]	identical protein binding [GO:0042802]; metal ion binding [GO:0046872]; small GTPase binding [GO:0031267]	SIFEQPQDPR	0.99856	0	8.20261	0	0	0	0	0	0	0	0	0	0
Q04721	NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 (Notch 2) (hN2) [Cleaved into: Notch 2 extracellular truncation (N2ECD); Notch 2 intracellular domain (N2ICD)]	NOTCH2	Homo sapiens (Human)	animal organ morphogenesis [GO:0009887]; apoptotic process [GO:0006915]; atrial septum morphogenesis [GO:0060413]; atrioventricular node development [GO:0003162]; axon guidance [GO:0007411]; BMP signaling pathway [GO:0030509]; bone remodeling [GO:0046849]; cell fate determination [GO:0001709]; cellular response to tumor cell [GO:0071228]; cholangiocyte proliferation [GO:1990705]; ciliary body morphogenesis [GO:0061073]; defense response to bacterium [GO:0042742]; embryonic limb morphogenesis [GO:0030326]; glomerular capillary formation [GO:0072104]; heart looping [GO:0001947]; hemopoiesis [GO:0030097]; hepatocyte proliferation [GO:0072574]; humoral immune response [GO:0006959]; in utero embryonic development [GO:0001701]; inflammatory response to antigenic stimulus [GO:0002437]; intrahepatic bile duct development [GO:0035622]; left/right axis specification [GO:0070986]; marginal zone B cell differentiation [GO:0002315]; morphogenesis of an epithelial sheet [GO:0002011]; multicellular organism growth [GO:0035264]; myeloid dendritic cell differentiation [GO:0043011]; negative regulation of apoptotic process [GO:0043066]; negative regulation of gene expression [GO:0010629]; negative regulation of transcription by RNA polymerase II [GO:0000122]; nervous system development [GO:0007399]; Notch signaling involved in heart development [GO:0061314]; Notch signaling pathway [GO:0007219]; placenta blood vessel development [GO:0060674]; podocyte development [GO:0072015]; positive regulation of apoptotic process [GO:0043065]; positive regulation of BMP signaling pathway [GO:0030513]; positive regulation of ERK1 and ERK2 cascade [GO:0070374]; positive regulation of keratinocyte proliferation [GO:0010838]; positive regulation of osteoclast differentiation [GO:0045672]; positive regulation of Ras protein signal transduction [GO:0046579]; proximal tubule development [GO:0072014]; pulmonary valve morphogenesis [GO:0003184]; regulation of actin cytoskeleton reorganization [GO:2000249]; regulation of osteoclast development [GO:2001204]; wound healing [GO:0042060]	cell surface [GO:0009986]; cilium [GO:0005929]; endoplasmic reticulum membrane [GO:0005789]; extracellular region [GO:0005576]; Golgi membrane [GO:0000139]; integral component of plasma membrane [GO:0005887]; membrane [GO:0016020]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]	calcium ion binding [GO:0005509]; enzyme binding [GO:0019899]; NF-kappaB binding [GO:0051059]; signaling receptor activity [GO:0038023]	NRVTDLDAR	0.998	0	0	8.19805	0	0	0	0	0	0	0	0	0
P29508	SPB3_HUMAN	Serpin B3 (Protein T4-A) (Squamous cell carcinoma antigen 1) (SCCA-1)	SERPINB3 SCCA SCCA1	Homo sapiens (Human)	autocrine signaling [GO:0035425]; negative regulation of catalytic activity [GO:0043086]; negative regulation of endopeptidase activity [GO:0010951]; negative regulation of JUN kinase activity [GO:0043508]; negative regulation of peptidase activity [GO:0010466]; negative regulation of proteolysis [GO:0045861]; paracrine signaling [GO:0038001]; positive regulation of cell migration [GO:0030335]; positive regulation of cell population proliferation [GO:0008284]; positive regulation of endopeptidase activity [GO:0010950]; positive regulation of epithelial to mesenchymal transition [GO:0010718]	azurophil granule lumen [GO:0035578]; cytoplasm [GO:0005737]; cytoplasmic vesicle [GO:0031410]; extracellular exosome [GO:0070062]; extracellular region [GO:0005576]; extracellular space [GO:0005615]; nucleus [GO:0005634]; vesicle [GO:0031982]	cysteine-type endopeptidase inhibitor activity [GO:0004869]; protease binding [GO:0002020]; serine-type endopeptidase inhibitor activity [GO:0004867]; virus receptor activity [GO:0001618]	FYQTSVESVDFANAPEESR	0.79587	0	0	0	0	0	0	0	0	0	0	8.16103	0
P48549	KCNJ3_HUMAN	"G protein-activated inward rectifier potassium channel 1 (GIRK-1) (Inward rectifier K(+) channel Kir3.1) (Potassium channel, inwardly rectifying subfamily J member 3)"	KCNJ3 GIRK1	Homo sapiens (Human)	membrane repolarization during atrial cardiac muscle cell action potential [GO:0098914]; potassium ion import across plasma membrane [GO:1990573]; potassium ion transport [GO:0006813]; regulation of heart rate by cardiac conduction [GO:0086091]; regulation of ion transmembrane transport [GO:0034765]; response to electrical stimulus [GO:0051602]; ventricular cardiac muscle cell membrane repolarization [GO:0099625]	external side of plasma membrane [GO:0009897]; integral component of presynaptic membrane [GO:0099056]; parallel fiber to Purkinje cell synapse [GO:0098688]; plasma membrane [GO:0005886]; T-tubule [GO:0030315]; voltage-gated potassium channel complex [GO:0008076]	G-protein activated inward rectifier potassium channel activity [GO:0015467]; voltage-gated potassium channel activity involved in atrial cardiac muscle cell action potential repolarization [GO:0086089]; voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization [GO:1902282]	MAGGAAR	0.91319	0	0	0	0	0	0	0	8.15826	0	0	0	0
Q8TBZ2	MYBPP_HUMAN	MYCBP-associated protein (AMAM-1) (AMY-1-binding protein 1) (AMAP-1)	MYCBPAP AMAP1	Homo sapiens (Human)	cell differentiation [GO:0030154]; chemical synaptic transmission [GO:0007268]; spermatogenesis [GO:0007283]	cytoplasm [GO:0005737]; membrane [GO:0016020]; synapse [GO:0045202]		EDLKEQHIPR	0.99643	0	0	0	0	0	0	0	0	0	0	8.12221	0
Q9NYQ7	CELR3_HUMAN	Cadherin EGF LAG seven-pass G-type receptor 3 (Cadherin family member 11) (Epidermal growth factor-like protein 1) (EGF-like protein 1) (Flamingo homolog 1) (hFmi1) (Multiple epidermal growth factor-like domains protein 2) (Multiple EGF-like domains protein 2)	CELSR3 CDHF11 EGFL1 FMI1 KIAA0812 MEGF2	Homo sapiens (Human)	"cell-cell adhesion [GO:0098609]; G protein-coupled receptor signaling pathway [GO:0007186]; homophilic cell adhesion via plasma membrane adhesion molecules [GO:0007156]; Wnt signaling pathway, planar cell polarity pathway [GO:0060071]"	integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]	calcium ion binding [GO:0005509]; G protein-coupled receptor activity [GO:0004930]	EQLDLLLRRQLSR	0.99825	8.0789	0	0	0	0	0	0	0	0	0	0	0
Q99708	CTIP_HUMAN	DNA endonuclease RBBP8 (EC 3.1.-.-) (CtBP-interacting protein) (CtIP) (Retinoblastoma-binding protein 8) (RBBP-8) (Retinoblastoma-interacting protein and myosin-like) (RIM) (Sporulation in the absence of SPO11 protein 2 homolog) (SAE2)	RBBP8 CTIP	Homo sapiens (Human)	blastocyst hatching [GO:0001835]; cell division [GO:0051301]; DNA double-strand break processing involved in repair via single-strand annealing [GO:0010792]; DNA repair [GO:0006281]; DNA strand resection involved in replication fork processing [GO:0110025]; double-strand break repair via homologous recombination [GO:0000724]; G1/S transition of mitotic cell cycle [GO:0000082]; homologous recombination [GO:0035825]; meiotic cell cycle [GO:0051321]; mitotic G2/M transition checkpoint [GO:0044818]; positive regulation of double-strand break repair via homologous recombination [GO:1905168]; regulation of transcription by RNA polymerase II [GO:0006357]	BRCA1-C complex [GO:0070533]; intracellular membrane-bounded organelle [GO:0043231]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; site of double-strand break [GO:0035861]; transcription repressor complex [GO:0017053]	damaged DNA binding [GO:0003684]; double-strand/single-strand DNA junction binding [GO:0000406]; double-stranded DNA binding [GO:0003690]; flap-structured DNA binding [GO:0070336]; identical protein binding [GO:0042802]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; single-stranded DNA binding [GO:0003697]; single-stranded DNA endodeoxyribonuclease activity [GO:0000014]; transcription corepressor activity [GO:0003714]; Y-form DNA binding [GO:0000403]	VLEDRLR	0.99598	0	0	0	0	0	0	0	0	8.07521	0	0	0
O00142	KITM_HUMAN	"Thymidine kinase 2, mitochondrial (EC 2.7.1.21) (2'-deoxyuridine kinase TK2) (EC 2.7.1.74) (Deoxycytidine kinase TK2) (EC 2.7.1.-) (Mt-TK)"	TK2	Homo sapiens (Human)	deoxycytidine metabolic process [GO:0046092]; DNA biosynthetic process [GO:0071897]; nucleobase-containing compound metabolic process [GO:0006139]; phosphorylation [GO:0016310]; pyrimidine nucleoside salvage [GO:0043097]; thymidine metabolic process [GO:0046104]	cytoplasm [GO:0005737]; mitochondrial matrix [GO:0005759]; mitochondrion [GO:0005739]	ATP binding [GO:0005524]; deoxycytidine kinase activity [GO:0004137]; deoxynucleoside kinase activity [GO:0019136]; nucleoside kinase activity [GO:0019206]; thymidine kinase activity [GO:0004797]	GWAARALR	0.99955	0	8.06059	0	0	0	0	0	0	0	0	0	0
Q9H147	TDIF1_HUMAN	Deoxynucleotidyltransferase terminal-interacting protein 1 (Terminal deoxynucleotidyltransferase-interacting factor 1) (TdIF1) (TdT-interacting factor 1)	DNTTIP1 C20orf167 TDIF1	Homo sapiens (Human)		chromosome [GO:0005694]; histone deacetylase complex [GO:0000118]; nucleolus [GO:0005730]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	DNA binding [GO:0003677]; nucleosome binding [GO:0031491]; protein homodimerization activity [GO:0042803]	GPSGAER	0.86357	0	0	0	0	8.05891	0	0	0	0	0	0	0
P17706	PTN2_HUMAN	Tyrosine-protein phosphatase non-receptor type 2 (EC 3.1.3.48) (T-cell protein-tyrosine phosphatase) (TCPTP)	PTPN2 PTPT	Homo sapiens (Human)	B cell differentiation [GO:0030183]; erythrocyte differentiation [GO:0030218]; glucose homeostasis [GO:0042593]; insulin receptor signaling pathway [GO:0008286]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of chemotaxis [GO:0050922]; negative regulation of epidermal growth factor receptor signaling pathway [GO:0042059]; negative regulation of ERK1 and ERK2 cascade [GO:0070373]; negative regulation of inflammatory response [GO:0050728]; negative regulation of insulin receptor signaling pathway [GO:0046627]; negative regulation of interferon-gamma-mediated signaling pathway [GO:0060336]; negative regulation of interleukin-2-mediated signaling pathway [GO:1902206]; negative regulation of interleukin-4-mediated signaling pathway [GO:1902215]; negative regulation of interleukin-6-mediated signaling pathway [GO:0070104]; negative regulation of lipid storage [GO:0010888]; negative regulation of macrophage colony-stimulating factor signaling pathway [GO:1902227]; negative regulation of macrophage differentiation [GO:0045650]; negative regulation of platelet-derived growth factor receptor-beta signaling pathway [GO:2000587]; negative regulation of positive thymic T cell selection [GO:1902233]; negative regulation of protein tyrosine kinase activity [GO:0061099]; negative regulation of receptor signaling pathway via JAK-STAT [GO:0046426]; negative regulation of T cell receptor signaling pathway [GO:0050860]; negative regulation of transcription by RNA polymerase II [GO:0000122]; negative regulation of tumor necrosis factor-mediated signaling pathway [GO:0010804]; negative regulation of type I interferon-mediated signaling pathway [GO:0060339]; negative regulation of tyrosine phosphorylation of STAT protein [GO:0042532]; peptidyl-tyrosine dephosphorylation [GO:0035335]; positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway [GO:1902237]; positive regulation of gluconeogenesis [GO:0045722]; positive regulation of PERK-mediated unfolded protein response [GO:1903899]; regulation of hepatocyte growth factor receptor signaling pathway [GO:1902202]; regulation of interferon-gamma-mediated signaling pathway [GO:0060334]; T cell differentiation [GO:0030217]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; endoplasmic reticulum [GO:0005783]; endoplasmic reticulum-Golgi intermediate compartment [GO:0005793]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; plasma membrane [GO:0005886]	integrin binding [GO:0005178]; non-membrane spanning protein tyrosine phosphatase activity [GO:0004726]; protein kinase binding [GO:0019901]; protein tyrosine phosphatase activity [GO:0004725]; receptor tyrosine kinase binding [GO:0030971]; STAT family protein binding [GO:0097677]; syntaxin binding [GO:0019905]	NESHDYPHR	0.94545	0	8.05143	0	0	0	0	0	0	0	0	0	0
P35228	NOS2_HUMAN	"Nitric oxide synthase, inducible (EC 1.14.13.39) (Hepatocyte NOS) (HEP-NOS) (Inducible NO synthase) (Inducible NOS) (iNOS) (NOS type II) (Peptidyl-cysteine S-nitrosylase NOS2)"	NOS2 NOS2A	Homo sapiens (Human)	arginine catabolic process [GO:0006527]; cell redox homeostasis [GO:0045454]; cellular response to interferon-gamma [GO:0071346]; cellular response to lipopolysaccharide [GO:0071222]; cellular response to xenobiotic stimulus [GO:0071466]; circadian rhythm [GO:0007623]; defense response to bacterium [GO:0042742]; defense response to Gram-negative bacterium [GO:0050829]; inflammatory response [GO:0006954]; innate immune response in mucosa [GO:0002227]; negative regulation of blood pressure [GO:0045776]; negative regulation of gene expression [GO:0010629]; negative regulation of protein catabolic process [GO:0042177]; nitric oxide biosynthetic process [GO:0006809]; nitric oxide mediated signal transduction [GO:0007263]; peptidyl-cysteine S-nitrosylation [GO:0018119]; positive regulation of guanylate cyclase activity [GO:0031284]; positive regulation of interleukin-6 production [GO:0032755]; positive regulation of interleukin-8 production [GO:0032757]; positive regulation of killing of cells of another organism [GO:0051712]; positive regulation of leukocyte mediated cytotoxicity [GO:0001912]; prostaglandin secretion [GO:0032310]; regulation of cell population proliferation [GO:0042127]; regulation of cellular respiration [GO:0043457]; regulation of cytokine production involved in inflammatory response [GO:1900015]; regulation of insulin secretion [GO:0050796]; response to bacterium [GO:0009617]; response to hormone [GO:0009725]; response to hypoxia [GO:0001666]; response to lipopolysaccharide [GO:0032496]; superoxide metabolic process [GO:0006801]	cortical cytoskeleton [GO:0030863]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; perinuclear region of cytoplasm [GO:0048471]; peroxisomal matrix [GO:0005782]; peroxisome [GO:0005777]; plasma membrane [GO:0005886]; vesicle membrane [GO:0012506]	arginine binding [GO:0034618]; calmodulin binding [GO:0005516]; flavin adenine dinucleotide binding [GO:0050660]; FMN binding [GO:0010181]; heme binding [GO:0020037]; metal ion binding [GO:0046872]; NADP binding [GO:0050661]; nitric-oxide synthase activity [GO:0004517]; oxidoreductase activity [GO:0016491]; protein homodimerization activity [GO:0042803]; tetrahydrobiopterin binding [GO:0034617]	LKLNEEQVEDYFFQLK	0.58203	0	0	0	0	0	8.04237	0	0	0	0	0	0
Q8WWI1	LMO7_HUMAN	LIM domain only protein 7 (LMO-7) (F-box only protein 20) (LOMP)	LMO7 FBX20 FBXO20 KIAA0858	Homo sapiens (Human)	positive regulation of transcription by RNA polymerase II [GO:0045944]; protein ubiquitination [GO:0016567]; regulation of cell adhesion [GO:0030155]; regulation of signaling [GO:0023051]	apical plasma membrane [GO:0016324]; cell surface [GO:0009986]; cytoplasm [GO:0005737]; cytosol [GO:0005829]; focal adhesion [GO:0005925]; nuclear envelope [GO:0005635]; nucleus [GO:0005634]; ubiquitin ligase complex [GO:0000151]	metal ion binding [GO:0046872]; ubiquitin-protein transferase activity [GO:0004842]	AGSPETK	0.58209	0	8.03727	0	0	0	0	0	0	0	0	0	0
Q9H967	WDR76_HUMAN	WD repeat-containing protein 76	WDR76	Homo sapiens (Human)	cellular response to DNA damage stimulus [GO:0006974]; regulation of DNA damage checkpoint [GO:2000001]	heterochromatin [GO:0000792]; nucleus [GO:0005634]; site of DNA damage [GO:0090734]	DNA binding [GO:0003677]; enzyme binding [GO:0019899]	SGAAAEK	0.93563	0	0	0	0	0	8.02713	0	0	0	0	0	0
Q9UQ13	SHOC2_HUMAN	Leucine-rich repeat protein SHOC-2 (Protein soc-2 homolog) (Protein sur-8 homolog)	SHOC2 KIAA0862	Homo sapiens (Human)	fibroblast growth factor receptor signaling pathway [GO:0008543]; positive regulation of Ras protein signal transduction [GO:0046579]; Ras protein signal transduction [GO:0007265]; signal transduction [GO:0007165]	cytoplasm [GO:0005737]; cytosol [GO:0005829]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]; protein phosphatase type 1 complex [GO:0000164]	protein phosphatase 1 binding [GO:0008157]; protein phosphatase binding [GO:0019903]; protein phosphatase regulator activity [GO:0019888]	ASGGFGK	0.89073	0	0	0	0	7.95896	0	0	0	0	0	0	0
P29322	EPHA8_HUMAN	Ephrin type-A receptor 8 (EC 2.7.10.1) (EPH- and ELK-related kinase) (EPH-like kinase 3) (EK3) (hEK3) (Tyrosine-protein kinase receptor EEK)	EPHA8 EEK HEK3 KIAA1459	Homo sapiens (Human)	axon guidance [GO:0007411]; cell adhesion [GO:0007155]; cellular response to follicle-stimulating hormone stimulus [GO:0071372]; ephrin receptor signaling pathway [GO:0048013]; neuron projection development [GO:0031175]; neuron remodeling [GO:0016322]; positive regulation of kinase activity [GO:0033674]; positive regulation of MAPK cascade [GO:0043410]; positive regulation of phosphatidylinositol 3-kinase activity [GO:0043552]; protein autophosphorylation [GO:0046777]; regulation of cell adhesion [GO:0030155]; regulation of cell adhesion mediated by integrin [GO:0033628]; substrate-dependent cell migration [GO:0006929]; transmembrane receptor protein tyrosine kinase signaling pathway [GO:0007169]	early endosome membrane [GO:0031901]; integral component of plasma membrane [GO:0005887]; neuron projection [GO:0043005]; plasma membrane [GO:0005886]; receptor complex [GO:0043235]	ATP binding [GO:0005524]; GPI-linked ephrin receptor activity [GO:0005004]; growth factor binding [GO:0019838]; transmembrane receptor protein tyrosine kinase activity [GO:0004714]; transmembrane-ephrin receptor activity [GO:0005005]	GVGAGMR	0.83234	0	0	0	0	0	0	7.86388	0	0	0	0	0
Q9NU02	ANKE1_HUMAN	Ankyrin repeat and EF-hand domain-containing protein 1 (Ankyrin repeat domain-containing protein 5)	ANKEF1 ANKRD5	Homo sapiens (Human)			calcium ion binding [GO:0005509]	EGVVEIVR	0.8666	0	0	7.7666	0	0	0	0	0	0	0	0	0
Q9Y4G2	PKHM1_HUMAN	Pleckstrin homology domain-containing family M member 1 (PH domain-containing family M member 1) (162 kDa adapter protein) (AP162)	PLEKHM1 KIAA0356	Homo sapiens (Human)	autophagosome-lysosome fusion [GO:0061909]; late endosome to lysosome transport [GO:1902774]; lysosome localization [GO:0032418]; positive regulation of bone resorption [GO:0045780]; positive regulation of ruffle assembly [GO:1900029]; protein transport [GO:0015031]	autolysosome [GO:0044754]; intracellular membrane-bounded organelle [GO:0043231]; late endosome membrane [GO:0031902]; lysosomal membrane [GO:0005765]; lysosome [GO:0005764]; nucleolus [GO:0005730]	metal ion binding [GO:0046872]	SFRVVHR	0.99905	0	0	7.7666	0	0	0	0	0	0	0	0	0
Q9ULE3	DEN2A_HUMAN	DENN domain-containing protein 2A	DENND2A KIAA1277	Homo sapiens (Human)	"protein transport [GO:0015031]; retrograde transport, endosome to Golgi [GO:0042147]"	actin cytoskeleton [GO:0015629]; cytosol [GO:0005829]	guanyl-nucleotide exchange factor activity [GO:0005085]	HAGEGDK	0.89221	0	7.7148	0	0	0	0	0	0	0	0	0	0
P15822	ZEP1_HUMAN	Zinc finger protein 40 (Cirhin interaction protein) (CIRIP) (Gate keeper of apoptosis-activating protein) (GAAP) (Human immunodeficiency virus type I enhancer-binding protein 1) (HIV-EP1) (Major histocompatibility complex-binding protein 1) (MBP-1) (Positive regulatory domain II-binding factor 1) (PRDII-BF1)	HIVEP1 ZNF40	Homo sapiens (Human)	BMP signaling pathway [GO:0030509]; negative regulation of transcription by RNA polymerase II [GO:0000122]; positive regulation of transcription by RNA polymerase II [GO:0045944]; regulation of transcription by RNA polymerase II [GO:0006357]	cytosol [GO:0005829]; mitochondrion [GO:0005739]; nuclear body [GO:0016604]; nucleoplasm [GO:0005654]; nucleus [GO:0005634]	"DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; metal ion binding [GO:0046872]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; sequence-specific double-stranded DNA binding [GO:1990837]"	GTMFECETCR	0.92313	0	0	0	0	0	0	0	0	0	0	0	7.66789